F405299

General Info

Members Datasets Scaffolds Average Seq Length
319 184 294 124

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_13238_c1|nmdc:mga0k408_13238_c1_884_1273
Length 129
Sequence MPLRKSVVVLSLALIGVAASSGAFSQDGHHGNGHAQNHDWYQQLKQPGTGYSCCNGTMTSPQGTTIEGDCRPTRAYMGDDGVWRALIDGKWVTVPPRVVLQQLAPDGRSHICASRSGLIFCFLGGSPRS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
152 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
182 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
183 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.84
Nodule 0
Rhizoplane 0.63
Rhizosphere 68.97
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10036561 3300002067 Unclassified 1440
2 JGI25406J46586_10072433 3300003203 Bacteria 1077
3 rootL2_10313149 3300003322 Bacteria 1173
4 JGI25405J52794_10024322 3300003911 Bacteria 1236
5 Ga0070658_10044021 3300005327 Bacteria 3606
6 Ga0070658_10261094 3300005327 Unclassified 1471
7 Ga0070676_10137648 3300005328 Bacteria 1551
8 Ga0070683_100024620 3300005329 Bacteria 5394
9 Ga0070677_10391927 3300005333 Bacteria 730
10 Ga0070680_100004156 3300005336 Bacteria 10845
11 Ga0070680_100311772 3300005336 Bacteria 1335
12 Ga0070682_101250520 3300005337 Unclassified 629
13 Ga0070660_100184557 3300005339 Bacteria 1689
14 Ga0070691_10012467 3300005341 Bacteria 3892
15 Ga0070691_10932214 3300005341 Bacteria 538
16 Ga0070661_100142741 3300005344 Bacteria 1805
17 Ga0070668_101381122 3300005347 Bacteria 642
18 Ga0070669_100277957 3300005353 Bacteria 1341
19 Ga0070675_101657351 3300005354 Bacteria 590
20 Ga0070674_100242866 3300005356 Bacteria 1411
21 Ga0070673_100714410 3300005364 Unclassified 921
22 Ga0070673_101020380 3300005364 Bacteria 771
23 Ga0070688_100568651 3300005365 Bacteria 864
24 Ga0070659_100663687 3300005366 Bacteria 900
25 Ga0070667_100832159 3300005367 Bacteria 858
26 Ga0070701_10527928 3300005438 Unclassified 771
27 Ga0070701_11025897 3300005438 Bacteria 577
28 Ga0070694_100787092 3300005444 Unclassified 779
29 Ga0070708_100177188 3300005445 Bacteria 1992
30 Ga0070708_101306740 3300005445 Bacteria 677
31 Ga0070678_100027981 3300005456 Bacteria 3837
32 Ga0070681_10013219 3300005458 Bacteria 8202
33 Ga0070685_11180781 3300005466 Bacteria 581
34 Ga0070706_100239926 3300005467 Bacteria 1692
35 Ga0070706_100973609 3300005467 Bacteria 783
36 Ga0070707_100051994 3300005468 Bacteria 3927
37 Ga0070707_102186834 3300005468 Unclassified 521
38 Ga0070698_100001169 3300005471 Bacteria 29110
39 Ga0070698_101444185 3300005471 Bacteria 639
40 Ga0070679_100014136 3300005530 Bacteria 7656
41 Ga0070679_100934778 3300005530 Bacteria 811
42 Ga0070684_100067050 3300005535 Bacteria 3151
43 Ga0070697_100739904 3300005536 Bacteria 869
44 Ga0068853_100205219 3300005539 Bacteria 1795
45 Ga0070686_100161552 3300005544 Bacteria 1578
46 Ga0070665_100263747 3300005548 Unclassified 1724
47 Ga0070665_100397754 3300005548 Unclassified 1385
48 Ga0070665_100666040 3300005548 Bacteria 1054
49 Ga0070665_101456652 3300005548 Unclassified 693
50 Ga0068855_100008229 3300005563 Bacteria 12605
51 Ga0068855_100450551 3300005563 Bacteria 1404
52 Ga0068854_100653825 3300005578 Bacteria 903
53 Ga0068856_100032108 3300005614 Bacteria 5139
54 Ga0068856_100714032 3300005614 Bacteria 1023
55 Ga0068852_100017035 3300005616 Bacteria 5690
56 Ga0068864_100411505 3300005618 Bacteria 1287
57 Ga0068864_101800205 3300005618 Bacteria 618
58 Ga0068851_10531158 3300005834 Unclassified 709
59 Ga0068862_101276709 3300005844 Unclassified 735
60 Ga0081455_10000857 3300005937 Bacteria 39181
61 Ga0081538_10312751 3300005981 Unclassified 574
62 Ga0081539_10000830 3300005985 Bacteria 59681
63 Ga0081539_10007269 3300005985 Bacteria 10168
64 Ga0075365_10147594 3300006038 Bacteria 1635
65 Ga0075365_10158498 3300006038 Bacteria 1576
66 Ga0075365_10162911 3300006038 Bacteria 1554
67 Ga0075365_10240428 3300006038 Bacteria 1272
68 Ga0075365_10338446 3300006038 Unclassified 1060
69 Ga0075368_10137360 3300006042 Bacteria 1018
70 Ga0075368_10195582 3300006042 Bacteria 855
71 Ga0075363_100032895 3300006048 Bacteria 2697
72 Ga0075363_100253988 3300006048 Bacteria 1013
73 Ga0075363_100275087 3300006048 Bacteria 973
74 Ga0075364_10111585 3300006051 Bacteria 1825
75 Ga0075364_10379657 3300006051 Bacteria 964
76 Ga0075364_10527923 3300006051 Unclassified 807
77 Ga0075432_10395108 3300006058 Bacteria 596
78 Ga0070716_100939324 3300006173 Bacteria 680
79 Ga0075362_10007130 3300006177 Bacteria 4212
80 Ga0075362_10028004 3300006177 Bacteria 2417
81 Ga0075362_10037583 3300006177 Bacteria 2123
82 Ga0075362_10270761 3300006177 Bacteria 838
83 Ga0075362_10309811 3300006177 Bacteria 785
84 Ga0075362_10433040 3300006177 Bacteria 666
85 Ga0075367_10029788 3300006178 Bacteria 3125
86 Ga0075367_10226110 3300006178 Bacteria 1172
87 Ga0075367_10272685 3300006178 Unclassified 1063
88 Ga0075369_10000423 3300006186 Bacteria 12833
89 Ga0075369_10041320 3300006186 Bacteria 1974
90 Ga0075369_10248566 3300006186 Bacteria 826
91 Ga0075366_10033102 3300006195 Bacteria 3044
92 Ga0075366_10055951 3300006195 Bacteria 2343
93 Ga0075366_10077138 3300006195 Unclassified 1989
94 Ga0097621_100250700 3300006237 Bacteria 1550
95 Ga0097621_101251275 3300006237 Bacteria 700
96 Ga0075370_10114428 3300006353 Bacteria 1568
97 Ga0075370_10234325 3300006353 Bacteria 1086
98 Ga0075370_10337086 3300006353 Bacteria 900
99 Ga0075428_100863482 3300006844 Unclassified 961
100 Ga0068865_100514312 3300006881 Bacteria 1000
101 Ga0097620_101768376 3300006931 Unclassified 683
102 Ga0099794_10038729 3300007265 Bacteria 2259
103 Ga0099795_10135974 3300007788 Bacteria 996
104 Ga0099795_10212541 3300007788 Bacteria 820
105 Ga0105240_10045115 3300009093 Bacteria 5594
106 Ga0111539_11054930 3300009094 Bacteria 945
107 Ga0111539_13370067 3300009094 Bacteria 514
108 Ga0105245_11009185 3300009098 Unclassified 877
109 Ga0105243_11071102 3300009148 Bacteria 813
110 Ga0105243_12344002 3300009148 Bacteria 572
111 Ga0105243_12590536 3300009148 Bacteria 547
112 Ga0105241_10197162 3300009174 Unclassified 1679
113 Ga0105242_11135267 3300009176 Bacteria 797
114 Ga0105242_12307433 3300009176 Unclassified 584
115 Ga0105248_11315389 3300009177 Bacteria 818
116 Ga0105237_10291541 3300009545 Bacteria 1634
117 Ga0105238_10075159 3300009551 Bacteria 3371
118 Ga0105238_10151347 3300009551 Bacteria 2295
119 Ga0105238_11188764 3300009551 Unclassified 787
120 Ga0105238_11375215 3300009551 Bacteria 733
121 Ga0105249_13276489 3300009553 Bacteria 521
122 Ga0099796_10502198 3300010159 Bacteria 543
123 Ga0105239_10131632 3300010375 Bacteria 2783
124 Ga0105246_10921292 3300011119 Bacteria 785
125 Ga0157373_10084305 3300013100 Bacteria 2240
126 Ga0157371_10097578 3300013102 Bacteria 2083
127 Ga0157370_11610066 3300013104 Unclassified 583
128 Ga0157369_10403074 3300013105 Unclassified 1419
129 Ga0157369_10716424 3300013105 Bacteria 1030
130 Ga0157374_11394295 3300013296 Bacteria 723
131 Ga0157378_10473071 3300013297 Bacteria 1247
132 Ga0163162_11382211 3300013306 Bacteria 801
133 Ga0163162_12789581 3300013306 Bacteria 562
134 Ga0157372_10208373 3300013307 Bacteria 2265
135 Ga0157375_11257416 3300013308 Bacteria 869
136 Ga0157375_12055316 3300013308 Bacteria 679
137 Ga0157380_10483148 3300014326 Bacteria 1199
138 Ga0182008_10194541 3300014497 Bacteria 1030
139 Ga0157376_11365448 3300014969 Bacteria 740
140 Ga0163161_10549189 3300017792 Bacteria 947
141 Ga0163161_11798935 3300017792 Bacteria 545
142 Ga0206356_11699585 3300020070 Bacteria 896
143 Ga0206353_11515071 3300020082 Bacteria 938
144 Ga0213872_10044204 3300021361 Bacteria 2028
145 Ga0213871_10006572 3300021441 Bacteria 2466
146 Ga0207426_1018368 3300025302 Bacteria 2465
147 Ga0207426_1025300 3300025302 Bacteria 2000
148 Ga0207688_10559429 3300025901 Bacteria 719
149 Ga0207645_10438886 3300025907 Bacteria 881
150 Ga0207705_10205651 3300025909 Bacteria 1492
151 Ga0207705_10280205 3300025909 Unclassified 1276
152 Ga0207684_10074149 3300025910 Bacteria 2891
153 Ga0207684_10757812 3300025910 Bacteria 822
154 Ga0207654_10115880 3300025911 Unclassified 1674
155 Ga0207707_10030869 3300025912 Bacteria 4687
156 Ga0207707_10412585 3300025912 Bacteria 1158
157 Ga0207695_10024252 3300025913 Bacteria 6830
158 Ga0207660_10023904 3300025917 Bacteria 4132
159 Ga0207657_10032528 3300025919 Bacteria 4711
160 Ga0207649_10074013 3300025920 Bacteria 2184
161 Ga0207652_10799580 3300025921 Unclassified 837
162 Ga0207646_10118969 3300025922 Bacteria 2373
163 Ga0207681_10965915 3300025923 Bacteria 714
164 Ga0207694_10077736 3300025924 Bacteria 2601
165 Ga0207694_10097414 3300025924 Bacteria 2327
166 Ga0207650_10496410 3300025925 Unclassified 1020
167 Ga0207659_10448608 3300025926 Bacteria 1086
168 Ga0207659_11917187 3300025926 Unclassified 502
169 Ga0207687_10614125 3300025927 Bacteria 917
170 Ga0207706_10495666 3300025933 Unclassified 1055
171 Ga0207669_10564968 3300025937 Unclassified 920
172 Ga0207691_10516666 3300025940 Bacteria 1013
173 Ga0207661_10156987 3300025944 Bacteria 1971
174 Ga0207679_10004810 3300025945 Bacteria 8414
175 Ga0207667_10013050 3300025949 Bacteria 9538
176 Ga0207667_10137570 3300025949 Bacteria 2515
177 Ga0207667_10215935 3300025949 Bacteria 1965
178 Ga0207651_10260975 3300025960 Bacteria 1422
179 Ga0207651_10658248 3300025960 Bacteria 920
180 Ga0207651_11403049 3300025960 Unclassified 629
181 Ga0207712_10565792 3300025961 Bacteria 979
182 Ga0207640_10030671 3300025981 Bacteria 3314
183 Ga0207677_10545394 3300026023 Unclassified 1010
184 Ga0207639_10087155 3300026041 Bacteria 2488
185 Ga0207702_10741322 3300026078 Bacteria 969
186 Ga0207676_10945446 3300026095 Bacteria 847
187 Ga0207674_10444399 3300026116 Bacteria 1253
188 Ga0207674_11606903 3300026116 Bacteria 619
189 Ga0207683_10032445 3300026121 Bacteria 4537
190 Ga0207698_10020207 3300026142 Bacteria 4578
191 Ga0209813_10196839 3300027866 Bacteria 744
192 Ga0209813_10225063 3300027866 Bacteria 704
193 Ga0209813_10322071 3300027866 Unclassified 605
194 Ga0207428_10517747 3300027907 Unclassified 865
195 Ga0268266_10046276 3300028379 Bacteria 3725
196 Ga0268266_10062021 3300028379 Bacteria 3225
197 Ga0307517_10574809 3300028786 Unclassified 559
198 Ga0265316_11038050 3300031344 Bacteria 570
199 Ga0307409_101275839 3300031995 Unclassified 759
200 Ga0307415_100496763 3300032126 Bacteria 1066
201 Ga0373948_0139344 3300034817 Unclassified 599
202 Ga0373945_0109648 3300035116 Bacteria 1088
203 Ga0373945_0183848 3300035116 Bacteria 862
204 Ga0373931_0676858 3300035691 Bacteria 680
205 Ga0373931_0781384 3300035691 Bacteria 635
206 Ga0373935_0602267 3300035692 Unclassified 804
207 Ga0373927_0440651 3300035695 Bacteria 860
208 Ga0373933_0037220 3300035724 Bacteria 2853
209 Ga0373925_0541092 3300037068 Bacteria 957
210 Ga0395899_0012179 3300037312 Bacteria 6585
211 Ga0395899_0052178 3300037312 Bacteria 3032
212 Ga0395899_0091340 3300037312 Bacteria 2206
213 Ga0395899_0133358 3300037312 Bacteria 1772
214 Ga0395900_0008391 3300037418 Bacteria 10631
215 Ga0395900_0061349 3300037418 Bacteria 3866
216 Ga0395900_0065930 3300037418 Bacteria 3720
217 Ga0395900_0430601 3300037418 Unclassified 1278
218 Ga0395898_0050998 3300037466 Bacteria 4047
219 Ga0395898_0274270 3300037466 Unclassified 1608
220 Ga0395898_0438366 3300037466 Unclassified 1244
221 Ga0395898_1109199 3300037466 Bacteria 724
222 Ga0395901_0007675 3300038443 Bacteria 10881
223 Ga0395901_0009503 3300038443 Bacteria 9864
224 Ga0395901_0023444 3300038443 Bacteria 6327
225 Ga0395901_0119637 3300038443 Bacteria 2767
226 Ga0395901_0153094 3300038443 Bacteria 2422
227 Ga0436360_0975466 3300039438 Bacteria 4931
228 Ga0436361_0014907 3300039447 Bacteria 1710
229 Ga0436361_0583487 3300039447 Unclassified 835
230 Ga0436361_0628117 3300039447 Bacteria 2005
231 Ga0439465_0060951 3300041413 Bacteria 1250
232 Ga0451853_2895774 3300041512 Unclassified 624
233 Ga0439448_0154950 3300042005 Unclassified 796
234 Ga0439458_0051369 3300042157 Bacteria 1018
235 Ga0439459_0181057 3300042438 Unclassified 566
236 Ga0466963_0074175 3300044694 Bacteria 2294
237 Ga0466964_0146518 3300044706 Unclassified 1090
238 Ga0466957_0037751 3300044842 Bacteria 2909
239 Ga0466959_1091208 3300045049 Unclassified 531
240 Ga0466967_0004686 3300045976 Bacteria 9289
241 Ga0495603_0651368 3300046455 Bacteria 603
242 Ga0496112_0811236 3300048915 Bacteria 860
243 Ga0496113_1275714 3300048916 Unclassified 572
244 Ga0496126_0108897 3300048929 Bacteria 2415
245 Ga0501034_0002101 3300049571 Bacteria 24863
246 Ga0501034_0019414 3300049571 Bacteria 6952
247 Ga0501037_0256152 3300049573 Bacteria 1224
248 Ga0501070_0768577 3300049586 Bacteria 758
249 Ga0501081_1003987 3300049743 Bacteria 631
250 Ga0501044_0052459 3300049823 Bacteria 4202
251 nmdc:mga03683_158301_c1 3300050489 Unclassified 1025
252 nmdc:mga03683_2186_c1 3300050489 Bacteria 6038
253 nmdc:mga03683_231369_c1 3300050489 Unclassified 855
254 nmdc:mga03683_240019_c1 3300050489 Bacteria 840
255 nmdc:mga03683_356786_c1 3300050489 Bacteria 693
256 nmdc:mga03683_90122_c1 3300050489 Bacteria 1336
257 nmdc:mga03683_97657_c1 3300050489 Bacteria 1288
258 nmdc:mga03n38_181634_c1 3300050490 Bacteria 1078
259 nmdc:mga03n38_267963_c1 3300050490 Bacteria 907
260 nmdc:mga03n38_916745_c1 3300050490 Unclassified 515
261 nmdc:mga00v17_387644_c1 3300050491 Bacteria 908
262 nmdc:mga00v17_395791_c1 3300050491 Bacteria 898
263 nmdc:mga00v17_399207_c1 3300050491 Bacteria 893
264 nmdc:mga0yw44_162002_c1 3300050492 Bacteria 1465
265 nmdc:mga0yw44_303944_c1 3300050492 Bacteria 1069
266 nmdc:mga0yw44_335995_c1 3300050492 Unclassified 1016
267 nmdc:mga0yw44_509182_c1 3300050492 Bacteria 817
268 nmdc:mga0yw44_587162_c1 3300050492 Unclassified 757
269 nmdc:mga0yw44_60302_c1 3300050492 Bacteria 2324
270 nmdc:mga0k408_13238_c1 3300050493 Bacteria 3818
271 nmdc:mga0k408_343377_c1 3300050493 Bacteria 890
272 nmdc:mga0k408_62687_c1 3300050493 Bacteria 2162
273 nmdc:mga0k408_652210_c1 3300050493 Unclassified 619
274 nmdc:mga0k408_95983_c1 3300050493 Unclassified 1745
275 nmdc:mga06z11_40738_c1 3300050494 Bacteria 2320
276 nmdc:mga06z11_776919_c1 3300050494 Bacteria 584
277 nmdc:mga04h51_294433_c1 3300050495 Bacteria 660
278 nmdc:mga04h51_64738_c1 3300050495 Bacteria 1262
279 nmdc:mga07m45_168394_c1 3300050496 Unclassified 1273
280 nmdc:mga07m45_338092_c1 3300050496 Bacteria 875
281 nmdc:mga07m45_495528_c1 3300050496 Bacteria 707
282 nmdc:mga08y16_147152_c1 3300050511 Bacteria 2448
283 nmdc:mga08y16_226094_c1 3300050511 Bacteria 1936
284 nmdc:mga08x19_536496_c1 3300050514 Bacteria 827
285 nmdc:mga08x19_969668_c1 3300050514 Unclassified 604
286 nmdc:mga0sz30_3309_c1 3300050516 Bacteria 5796
287 nmdc:mga0sz30_462271_c1 3300050516 Unclassified 570
288 Ga0500644_0474535 3300053088 Bacteria 549
289 Ga0500651_0451994 3300053093 Unclassified 714
290 Ga0500641_0002888 3300053096 Bacteria 6093
291 Ga0500642_0298463 3300053130 Unclassified 728
292 Ga0500633_0319907 3300053160 Unclassified 568
293 Ga0500609_013688 3300053731 Bacteria 1098
294 Ga0501082_0908779 3300060353 Unclassified 770

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0781384 Ga0373931_0781384_130_459 103
2 3300035692 Ga0373935_0602267 Ga0373935_0602267_395_724 103
3 3300039447 Ga0436361_0583487 Ga0436361_0583487_397_768 108
4 3300053088 Ga0500644_0474535 Ga0500644_0474535_93_425 108
5 3300007265 Ga0099794_10038729 Ga0099794_100387292 110
6 3300010159 Ga0099796_10502198 Ga0099796_105021981 110
7 3300035116 Ga0373945_0109648 Ga0373945_0109648_589_957 110
8 3300037068 Ga0373925_0541092 Ga0373925_0541092_143_511 110
9 3300048929 Ga0496126_0108897 Ga0496126_0108897_1165_1533 110
10 3300049571 Ga0501034_0019414 Ga0501034_0019414_14_352 110
11 3300050489 nmdc:mga03683_97657_c1 nmdc:mga03683_97657_c1_319_678 110
12 3300050491 nmdc:mga00v17_399207_c1 nmdc:mga00v17_399207_c1_496_855 110
13 3300050492 nmdc:mga0yw44_60302_c1 nmdc:mga0yw44_60302_c1_252_611 110
14 3300050494 nmdc:mga06z11_40738_c1 nmdc:mga06z11_40738_c1_1094_1453 110
15 3300050495 nmdc:mga04h51_64738_c1 nmdc:mga04h51_64738_c1_612_971 110
16 3300050496 nmdc:mga07m45_495528_c1 nmdc:mga07m45_495528_c1_326_685 110
17 3300035695 Ga0373927_0440651 Ga0373927_0440651_222_566 111
18 3300003322 rootL2_10313149 rootL2_103131492 114
19 3300009553 Ga0105249_13276489 Ga0105249_132764891 114
20 3300005327 Ga0070658_10044021 Ga0070658_100440213 115
21 3300005336 Ga0070680_100004156 Ga0070680_1000041569 115
22 3300005341 Ga0070691_10012467 Ga0070691_100124673 115
23 3300005458 Ga0070681_10013219 Ga0070681_100132195 115
24 3300005530 Ga0070679_100014136 Ga0070679_1000141367 115
25 3300005548 Ga0070665_101456652 Ga0070665_1014566522 115
26 3300005563 Ga0068855_100008229 Ga0068855_1000082298 115
27 3300005614 Ga0068856_100714032 Ga0068856_1007140321 115
28 3300009093 Ga0105240_10045115 Ga0105240_100451152 115
29 3300009551 Ga0105238_10151347 Ga0105238_101513472 115
30 3300025909 Ga0207705_10205651 Ga0207705_102056511 115
31 3300025912 Ga0207707_10030869 Ga0207707_100308695 115
32 3300025913 Ga0207695_10024252 Ga0207695_100242529 115
33 3300025917 Ga0207660_10023904 Ga0207660_100239044 115
34 3300025924 Ga0207694_10097414 Ga0207694_100974143 115
35 3300025949 Ga0207667_10137570 Ga0207667_101375701 115
36 3300026078 Ga0207702_10741322 Ga0207702_107413223 115
37 3300003911 JGI25405J52794_10024322 JGI25405J52794_100243222 117
38 3300005445 Ga0070708_100177188 Ga0070708_1001771881 117
39 3300005467 Ga0070706_100973609 Ga0070706_1009736091 117
40 3300005468 Ga0070707_100051994 Ga0070707_1000519941 117
41 3300005471 Ga0070698_100001169 Ga0070698_10000116913 117
42 3300005471 Ga0070698_101444185 Ga0070698_1014441852 117
43 3300005536 Ga0070697_100739904 Ga0070697_1007399041 117
44 3300005937 Ga0081455_10000857 Ga0081455_1000085716 117
45 3300006038 Ga0075365_10158498 Ga0075365_101584982 117
46 3300006173 Ga0070716_100939324 Ga0070716_1009393242 117
47 3300006177 Ga0075362_10028004 Ga0075362_100280043 117
48 3300006178 Ga0075367_10029788 Ga0075367_100297882 117
49 3300006186 Ga0075369_10041320 Ga0075369_100413203 117
50 3300006195 Ga0075366_10055951 Ga0075366_100559513 117
51 3300006353 Ga0075370_10114428 Ga0075370_101144283 117
52 3300007788 Ga0099795_10212541 Ga0099795_102125412 117
53 3300020082 Ga0206353_11515071 Ga0206353_115150712 117
54 3300021361 Ga0213872_10044204 Ga0213872_100442043 117
55 3300021441 Ga0213871_10006572 Ga0213871_100065723 117
56 3300025910 Ga0207684_10074149 Ga0207684_100741494 117
57 3300025922 Ga0207646_10118969 Ga0207646_101189692 117
58 3300037312 Ga0395899_0091340 Ga0395899_0091340_325_714 117
59 3300037312 Ga0395899_0133358 Ga0395899_0133358_970_1359 117
60 3300037418 Ga0395900_0061349 Ga0395900_0061349_2046_2435 117
61 3300037466 Ga0395898_0050998 Ga0395898_0050998_3037_3426 117
62 3300038443 Ga0395901_0007675 Ga0395901_0007675_5373_5762 117
63 3300038443 Ga0395901_0153094 Ga0395901_0153094_1900_2289 117
64 3300039438 Ga0436360_0975466 Ga0436360_0975466_2846_3214 117
65 3300039447 Ga0436361_0628117 Ga0436361_0628117_155_523 117
66 3300050491 nmdc:mga00v17_399207_c1 nmdc:mga00v17_399207_c1_76_447 117
67 3300050493 nmdc:mga0k408_62687_c1 nmdc:mga0k408_62687_c1_852_1223 117
68 3300050494 nmdc:mga06z11_40738_c1 nmdc:mga06z11_40738_c1_674_1045 117
69 3300050495 nmdc:mga04h51_64738_c1 nmdc:mga04h51_64738_c1_192_563 117
70 3300005333 Ga0070677_10391927 Ga0070677_103919271 118
71 3300005354 Ga0070675_101657351 Ga0070675_1016573511 118
72 3300005364 Ga0070673_101020380 Ga0070673_1010203802 118
73 3300005548 Ga0070665_100666040 Ga0070665_1006660402 118
74 3300005981 Ga0081538_10312751 Ga0081538_103127511 118
75 3300006038 Ga0075365_10240428 Ga0075365_102404283 118
76 3300006042 Ga0075368_10137360 Ga0075368_101373602 118
77 3300006048 Ga0075363_100253988 Ga0075363_1002539882 118
78 3300006048 Ga0075363_100275087 Ga0075363_1002750872 118
79 3300006051 Ga0075364_10111585 Ga0075364_101115853 118
80 3300006051 Ga0075364_10527923 Ga0075364_105279232 118
81 3300006177 Ga0075362_10007130 Ga0075362_100071303 118
82 3300006177 Ga0075362_10037583 Ga0075362_100375834 118
83 3300006177 Ga0075362_10270761 Ga0075362_102707611 118
84 3300006177 Ga0075362_10309811 Ga0075362_103098112 118
85 3300006178 Ga0075367_10226110 Ga0075367_102261102 118
86 3300006178 Ga0075367_10272685 Ga0075367_102726852 118
87 3300006186 Ga0075369_10000423 Ga0075369_1000042313 118
88 3300006195 Ga0075366_10077138 Ga0075366_100771382 118
89 3300006353 Ga0075370_10234325 Ga0075370_102343251 118
90 3300006353 Ga0075370_10337086 Ga0075370_103370862 118
91 3300006844 Ga0075428_100863482 Ga0075428_1008634822 118
92 3300009094 Ga0111539_11054930 Ga0111539_110549302 118
93 3300009176 Ga0105242_12307433 Ga0105242_123074331 118
94 3300009551 Ga0105238_11375215 Ga0105238_113752152 118
95 3300013297 Ga0157378_10473071 Ga0157378_104730712 118
96 3300013306 Ga0163162_12789581 Ga0163162_127895812 118
97 3300013308 Ga0157375_11257416 Ga0157375_112574162 118
98 3300014326 Ga0157380_10483148 Ga0157380_104831482 118
99 3300025901 Ga0207688_10559429 Ga0207688_105594292 118
100 3300025960 Ga0207651_10658248 Ga0207651_106582482 118
101 3300026023 Ga0207677_10545394 Ga0207677_105453942 118
102 3300027866 Ga0209813_10322071 Ga0209813_103220712 118
103 3300028786 Ga0307517_10574809 Ga0307517_105748091 118
104 3300031995 Ga0307409_101275839 Ga0307409_1012758392 118
105 3300034817 Ga0373948_0139344 Ga0373948_0139344_141_518 118
106 3300042157 Ga0439458_0051369 Ga0439458_0051369_328_705 118
107 3300042438 Ga0439459_0181057 Ga0439459_0181057_36_413 118
108 3300049743 Ga0501081_1003987 Ga0501081_1003987_183_572 118
109 3300050489 nmdc:mga03683_158301_c1 nmdc:mga03683_158301_c1_460_837 118
110 3300050489 nmdc:mga03683_2186_c1 nmdc:mga03683_2186_c1_3011_3388 118
111 3300050489 nmdc:mga03683_231369_c1 nmdc:mga03683_231369_c1_377_754 118
112 3300050489 nmdc:mga03683_240019_c1 nmdc:mga03683_240019_c1_29_406 118
113 3300050489 nmdc:mga03683_356786_c1 nmdc:mga03683_356786_c1_201_578 118
114 3300050490 nmdc:mga03n38_181634_c1 nmdc:mga03n38_181634_c1_534_911 118
115 3300050490 nmdc:mga03n38_267963_c1 nmdc:mga03n38_267963_c1_109_519 118
116 3300050490 nmdc:mga03n38_916745_c1 nmdc:mga03n38_916745_c1_119_496 118
117 3300050491 nmdc:mga00v17_395791_c1 nmdc:mga00v17_395791_c1_397_774 118
118 3300050492 nmdc:mga0yw44_162002_c1 nmdc:mga0yw44_162002_c1_80_457 118
119 3300050492 nmdc:mga0yw44_303944_c1 nmdc:mga0yw44_303944_c1_70_447 118
120 3300050492 nmdc:mga0yw44_587162_c1 nmdc:mga0yw44_587162_c1_351_728 118
121 3300050493 nmdc:mga0k408_652210_c1 nmdc:mga0k408_652210_c1_67_444 118
122 3300050493 nmdc:mga0k408_95983_c1 nmdc:mga0k408_95983_c1_855_1232 118
123 3300050494 nmdc:mga06z11_776919_c1 nmdc:mga06z11_776919_c1_159_536 118
124 3300050496 nmdc:mga07m45_168394_c1 nmdc:mga07m45_168394_c1_801_1178 118
125 3300050496 nmdc:mga07m45_338092_c1 nmdc:mga07m45_338092_c1_183_560 118
126 3300050511 nmdc:mga08y16_147152_c1 nmdc:mga08y16_147152_c1_1034_1411 118
127 3300050514 nmdc:mga08x19_536496_c1 nmdc:mga08x19_536496_c1_137_508 118
128 3300050514 nmdc:mga08x19_969668_c1 nmdc:mga08x19_969668_c1_123_515 118
129 3300050516 nmdc:mga0sz30_3309_c1 nmdc:mga0sz30_3309_c1_2033_2410 118
130 3300053096 Ga0500641_0002888 Ga0500641_0002888_996_1391 118
131 3300060353 Ga0501082_0908779 Ga0501082_0908779_136_513 118
132 3300005438 Ga0070701_10527928 Ga0070701_105279281 119
133 3300005468 Ga0070707_102186834 Ga0070707_1021868341 119
134 3300005985 Ga0081539_10000830 Ga0081539_100008302 119
135 3300006038 Ga0075365_10147594 Ga0075365_101475942 119
136 3300006038 Ga0075365_10158498 Ga0075365_101584983 119
137 3300006038 Ga0075365_10162911 Ga0075365_101629112 119
138 3300006038 Ga0075365_10338446 Ga0075365_103384462 119
139 3300006042 Ga0075368_10195582 Ga0075368_101955822 119
140 3300006048 Ga0075363_100032895 Ga0075363_1000328953 119
141 3300006048 Ga0075363_100253988 Ga0075363_1002539881 119
142 3300006051 Ga0075364_10379657 Ga0075364_103796572 119
143 3300006058 Ga0075432_10395108 Ga0075432_103951081 119
144 3300006177 Ga0075362_10007130 Ga0075362_100071302 119
145 3300006177 Ga0075362_10028004 Ga0075362_100280042 119
146 3300006177 Ga0075362_10037583 Ga0075362_100375833 119
147 3300006177 Ga0075362_10433040 Ga0075362_104330401 119
148 3300006178 Ga0075367_10029788 Ga0075367_100297883 119
149 3300006178 Ga0075367_10226110 Ga0075367_102261101 119
150 3300006186 Ga0075369_10000423 Ga0075369_1000042312 119
151 3300006186 Ga0075369_10248566 Ga0075369_102485661 119
152 3300006195 Ga0075366_10055951 Ga0075366_100559512 119
153 3300006195 Ga0075366_10077138 Ga0075366_100771383 119
154 3300006353 Ga0075370_10234325 Ga0075370_102343252 119
155 3300009148 Ga0105243_12590536 Ga0105243_125905362 119
156 3300009551 Ga0105238_11188764 Ga0105238_111887642 119
157 3300011119 Ga0105246_10921292 Ga0105246_109212922 119
158 3300027866 Ga0209813_10196839 Ga0209813_101968392 119
159 3300027866 Ga0209813_10225063 Ga0209813_102250631 119
160 3300027907 Ga0207428_10517747 Ga0207428_105177471 119
161 3300032126 Ga0307415_100496763 Ga0307415_1004967632 119
162 3300035691 Ga0373931_0676858 Ga0373931_0676858_66_473 119
163 3300050491 nmdc:mga00v17_387644_c1 nmdc:mga00v17_387644_c1_368_754 119
164 3300050492 nmdc:mga0yw44_162002_c1 nmdc:mga0yw44_162002_c1_511_897 119
165 3300050492 nmdc:mga0yw44_335995_c1 nmdc:mga0yw44_335995_c1_365_763 119
166 3300050492 nmdc:mga0yw44_509182_c1 nmdc:mga0yw44_509182_c1_287_673 119
167 3300050493 nmdc:mga0k408_343377_c1 nmdc:mga0k408_343377_c1_396_794 119
168 3300050493 nmdc:mga0k408_62687_c1 nmdc:mga0k408_62687_c1_1245_1631 119
169 3300050495 nmdc:mga04h51_294433_c1 nmdc:mga04h51_294433_c1_40_438 119
170 3300050511 nmdc:mga08y16_147152_c1 nmdc:mga08y16_147152_c1_594_980 119
171 3300050516 nmdc:mga0sz30_462271_c1 nmdc:mga0sz30_462271_c1_111_497 119
172 3300053093 Ga0500651_0451994 Ga0500651_0451994_252_638 119
173 3300053130 Ga0500642_0298463 Ga0500642_0298463_255_641 119
174 3300053160 Ga0500633_0319907 Ga0500633_0319907_138_524 119
175 3300053731 Ga0500609_013688 Ga0500609_013688_618_983 119
176 3300002067 JGI24735J21928_10036561 JGI24735J21928_100365611 120
177 3300003203 JGI25406J46586_10072433 JGI25406J46586_100724332 120
178 3300005327 Ga0070658_10261094 Ga0070658_102610942 120
179 3300005328 Ga0070676_10137648 Ga0070676_101376483 120
180 3300005329 Ga0070683_100024620 Ga0070683_1000246206 120
181 3300005336 Ga0070680_100311772 Ga0070680_1003117722 120
182 3300005337 Ga0070682_101250520 Ga0070682_1012505202 120
183 3300005339 Ga0070660_100184557 Ga0070660_1001845571 120
184 3300005341 Ga0070691_10932214 Ga0070691_109322141 120
185 3300005344 Ga0070661_100142741 Ga0070661_1001427411 120
186 3300005347 Ga0070668_101381122 Ga0070668_1013811221 120
187 3300005353 Ga0070669_100277957 Ga0070669_1002779572 120
188 3300005356 Ga0070674_100242866 Ga0070674_1002428662 120
189 3300005364 Ga0070673_100714410 Ga0070673_1007144102 120
190 3300005365 Ga0070688_100568651 Ga0070688_1005686512 120
191 3300005366 Ga0070659_100663687 Ga0070659_1006636871 120
192 3300005367 Ga0070667_100832159 Ga0070667_1008321592 120
193 3300005438 Ga0070701_11025897 Ga0070701_110258971 120
194 3300005444 Ga0070694_100787092 Ga0070694_1007870921 120
195 3300005445 Ga0070708_101306740 Ga0070708_1013067402 120
196 3300005456 Ga0070678_100027981 Ga0070678_1000279815 120
197 3300005466 Ga0070685_11180781 Ga0070685_111807811 120
198 3300005467 Ga0070706_100239926 Ga0070706_1002399262 120
199 3300005471 Ga0070698_100001169 Ga0070698_10000116912 120
200 3300005530 Ga0070679_100934778 Ga0070679_1009347782 120
201 3300005535 Ga0070684_100067050 Ga0070684_1000670503 120
202 3300005539 Ga0068853_100205219 Ga0068853_1002052191 120
203 3300005544 Ga0070686_100161552 Ga0070686_1001615523 120
204 3300005548 Ga0070665_100263747 Ga0070665_1002637472 120
205 3300005548 Ga0070665_100397754 Ga0070665_1003977542 120
206 3300005563 Ga0068855_100450551 Ga0068855_1004505511 120
207 3300005578 Ga0068854_100653825 Ga0068854_1006538251 120
208 3300005614 Ga0068856_100032108 Ga0068856_1000321083 120
209 3300005616 Ga0068852_100017035 Ga0068852_1000170357 120
210 3300005618 Ga0068864_100411505 Ga0068864_1004115052 120
211 3300005618 Ga0068864_101800205 Ga0068864_1018002051 120
212 3300005834 Ga0068851_10531158 Ga0068851_105311582 120
213 3300005844 Ga0068862_101276709 Ga0068862_1012767092 120
214 3300005985 Ga0081539_10007269 Ga0081539_100072698 120
215 3300005985 Ga0081539_10007269 Ga0081539_100072699 120
216 3300006195 Ga0075366_10033102 Ga0075366_100331023 120
217 3300006237 Ga0097621_100250700 Ga0097621_1002507003 120
218 3300006237 Ga0097621_101251275 Ga0097621_1012512752 120
219 3300006881 Ga0068865_100514312 Ga0068865_1005143121 120
220 3300006931 Ga0097620_101768376 Ga0097620_1017683762 120
221 3300007265 Ga0099794_10038729 Ga0099794_100387293 120
222 3300007788 Ga0099795_10135974 Ga0099795_101359742 120
223 3300009094 Ga0111539_13370067 Ga0111539_133700671 120
224 3300009098 Ga0105245_11009185 Ga0105245_110091852 120
225 3300009148 Ga0105243_11071102 Ga0105243_110711021 120
226 3300009148 Ga0105243_12344002 Ga0105243_123440021 120
227 3300009174 Ga0105241_10197162 Ga0105241_101971622 120
228 3300009176 Ga0105242_11135267 Ga0105242_111352671 120
229 3300009177 Ga0105248_11315389 Ga0105248_113153892 120
230 3300009545 Ga0105237_10291541 Ga0105237_102915412 120
231 3300009551 Ga0105238_10075159 Ga0105238_100751596 120
232 3300010375 Ga0105239_10131632 Ga0105239_101316321 120
233 3300013100 Ga0157373_10084305 Ga0157373_100843053 120
234 3300013102 Ga0157371_10097578 Ga0157371_100975782 120
235 3300013104 Ga0157370_11610066 Ga0157370_116100661 120
236 3300013105 Ga0157369_10403074 Ga0157369_104030742 120
237 3300013105 Ga0157369_10716424 Ga0157369_107164242 120
238 3300013296 Ga0157374_11394295 Ga0157374_113942952 120
239 3300013306 Ga0163162_11382211 Ga0163162_113822112 120
240 3300013307 Ga0157372_10208373 Ga0157372_102083733 120
241 3300013308 Ga0157375_12055316 Ga0157375_120553162 120
242 3300014497 Ga0182008_10194541 Ga0182008_101945412 120
243 3300014969 Ga0157376_11365448 Ga0157376_113654482 120
244 3300017792 Ga0163161_10549189 Ga0163161_105491892 120
245 3300017792 Ga0163161_11798935 Ga0163161_117989351 120
246 3300020070 Ga0206356_11699585 Ga0206356_116995852 120
247 3300025302 Ga0207426_1018368 Ga0207426_10183682 120
248 3300025302 Ga0207426_1025300 Ga0207426_10253003 120
249 3300025907 Ga0207645_10438886 Ga0207645_104388862 120
250 3300025909 Ga0207705_10280205 Ga0207705_102802053 120
251 3300025910 Ga0207684_10074149 Ga0207684_100741495 120
252 3300025910 Ga0207684_10757812 Ga0207684_107578121 120
253 3300025911 Ga0207654_10115880 Ga0207654_101158802 120
254 3300025912 Ga0207707_10412585 Ga0207707_104125852 120
255 3300025919 Ga0207657_10032528 Ga0207657_100325283 120
256 3300025920 Ga0207649_10074013 Ga0207649_100740133 120
257 3300025921 Ga0207652_10799580 Ga0207652_107995801 120
258 3300025922 Ga0207646_10118969 Ga0207646_101189693 120
259 3300025923 Ga0207681_10965915 Ga0207681_109659152 120
260 3300025924 Ga0207694_10077736 Ga0207694_100777364 120
261 3300025925 Ga0207650_10496410 Ga0207650_104964102 120
262 3300025926 Ga0207659_10448608 Ga0207659_104486081 120
263 3300025926 Ga0207659_11917187 Ga0207659_119171871 120
264 3300025927 Ga0207687_10614125 Ga0207687_106141251 120
265 3300025933 Ga0207706_10495666 Ga0207706_104956662 120
266 3300025937 Ga0207669_10564968 Ga0207669_105649682 120
267 3300025940 Ga0207691_10516666 Ga0207691_105166661 120
268 3300025944 Ga0207661_10156987 Ga0207661_101569872 120
269 3300025945 Ga0207679_10004810 Ga0207679_100048106 120
270 3300025949 Ga0207667_10013050 Ga0207667_100130503 120
271 3300025949 Ga0207667_10215935 Ga0207667_102159352 120
272 3300025960 Ga0207651_10260975 Ga0207651_102609752 120
273 3300025960 Ga0207651_11403049 Ga0207651_114030491 120
274 3300025961 Ga0207712_10565792 Ga0207712_105657922 120
275 3300025981 Ga0207640_10030671 Ga0207640_100306712 120
276 3300026041 Ga0207639_10087155 Ga0207639_100871552 120
277 3300026095 Ga0207676_10945446 Ga0207676_109454462 120
278 3300026116 Ga0207674_10444399 Ga0207674_104443991 120
279 3300026116 Ga0207674_11606903 Ga0207674_116069031 120
280 3300026121 Ga0207683_10032445 Ga0207683_100324455 120
281 3300026142 Ga0207698_10020207 Ga0207698_100202076 120
282 3300028379 Ga0268266_10046276 Ga0268266_100462764 120
283 3300028379 Ga0268266_10062021 Ga0268266_100620211 120
284 3300031344 Ga0265316_11038050 Ga0265316_110380502 120
285 3300035116 Ga0373945_0183848 Ga0373945_0183848_254_646 120
286 3300035724 Ga0373933_0037220 Ga0373933_0037220_513_881 120
287 3300037312 Ga0395899_0012179 Ga0395899_0012179_3107_3493 120
288 3300037312 Ga0395899_0052178 Ga0395899_0052178_491_859 120
289 3300037418 Ga0395900_0008391 Ga0395900_0008391_6292_6678 120
290 3300037418 Ga0395900_0065930 Ga0395900_0065930_2209_2601 120
291 3300037418 Ga0395900_0430601 Ga0395900_0430601_420_788 120
292 3300037466 Ga0395898_0274270 Ga0395898_0274270_789_1157 120
293 3300037466 Ga0395898_0438366 Ga0395898_0438366_704_1090 120
294 3300037466 Ga0395898_1109199 Ga0395898_1109199_175_573 120
295 3300038443 Ga0395901_0009503 Ga0395901_0009503_4479_4871 120
296 3300038443 Ga0395901_0023444 Ga0395901_0023444_921_1307 120
297 3300038443 Ga0395901_0119637 Ga0395901_0119637_2347_2715 120
298 3300039438 Ga0436360_0975466 Ga0436360_0975466_2388_2759 120
299 3300039447 Ga0436361_0014907 Ga0436361_0014907_262_654 120
300 3300041413 Ga0439465_0060951 Ga0439465_0060951_25_414 120
301 3300041512 Ga0451853_2895774 Ga0451853_2895774_155_544 120
302 3300042005 Ga0439448_0154950 Ga0439448_0154950_136_528 120
303 3300044694 Ga0466963_0074175 Ga0466963_0074175_777_1145 120
304 3300044706 Ga0466964_0146518 Ga0466964_0146518_667_1035 120
305 3300044842 Ga0466957_0037751 Ga0466957_0037751_1539_1907 120
306 3300045049 Ga0466959_1091208 Ga0466959_1091208_127_495 120
307 3300045976 Ga0466967_0004686 Ga0466967_0004686_8664_9032 120
308 3300046455 Ga0495603_0651368 Ga0495603_0651368_34_405 120
309 3300048915 Ga0496112_0811236 Ga0496112_0811236_237_629 120
310 3300048916 Ga0496113_1275714 Ga0496113_1275714_145_537 120
311 3300048929 Ga0496126_0108897 Ga0496126_0108897_711_1082 120
312 3300049571 Ga0501034_0002101 Ga0501034_0002101_19531_19899 120
313 3300049573 Ga0501037_0256152 Ga0501037_0256152_49_441 120
314 3300049586 Ga0501070_0768577 Ga0501070_0768577_46_414 120
315 3300049823 Ga0501044_0052459 Ga0501044_0052459_3491_3859 120
316 3300050489 nmdc:mga03683_90122_c1 nmdc:mga03683_90122_c1_566_955 120
317 3300050493 nmdc:mga0k408_13238_c1 nmdc:mga0k408_13238_c1_884_1273 120
318 3300050511 nmdc:mga08y16_226094_c1 nmdc:mga08y16_226094_c1_340_708 120
319 3300053096 Ga0500641_0002888 Ga0500641_0002888_1466_1855 120

Feature Viewer

pLDDT pTM Quality
58.47 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map