F405299
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 184 | 294 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_13238_c1|nmdc:mga0k408_13238_c1_884_1273 |
| Length | 129 |
| Sequence | MPLRKSVVVLSLALIGVAASSGAFSQDGHHGNGHAQNHDWYQQLKQPGTGYSCCNGTMTSPQGTTIEGDCRPTRAYMGDDGVWRALIDGKWVTVPPRVVLQQLAPDGRSHICASRSGLIFCFLGGSPRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 132 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 149 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 150 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 151 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 152 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 168 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 169 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 171 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 172 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 174 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 178 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 180 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 181 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 182 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 184 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 28.84 |
| Nodule | 0 |
| Rhizoplane | 0.63 |
| Rhizosphere | 68.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10036561 | 3300002067 | Unclassified | 1440 |
| 2 | JGI25406J46586_10072433 | 3300003203 | Bacteria | 1077 |
| 3 | rootL2_10313149 | 3300003322 | Bacteria | 1173 |
| 4 | JGI25405J52794_10024322 | 3300003911 | Bacteria | 1236 |
| 5 | Ga0070658_10044021 | 3300005327 | Bacteria | 3606 |
| 6 | Ga0070658_10261094 | 3300005327 | Unclassified | 1471 |
| 7 | Ga0070676_10137648 | 3300005328 | Bacteria | 1551 |
| 8 | Ga0070683_100024620 | 3300005329 | Bacteria | 5394 |
| 9 | Ga0070677_10391927 | 3300005333 | Bacteria | 730 |
| 10 | Ga0070680_100004156 | 3300005336 | Bacteria | 10845 |
| 11 | Ga0070680_100311772 | 3300005336 | Bacteria | 1335 |
| 12 | Ga0070682_101250520 | 3300005337 | Unclassified | 629 |
| 13 | Ga0070660_100184557 | 3300005339 | Bacteria | 1689 |
| 14 | Ga0070691_10012467 | 3300005341 | Bacteria | 3892 |
| 15 | Ga0070691_10932214 | 3300005341 | Bacteria | 538 |
| 16 | Ga0070661_100142741 | 3300005344 | Bacteria | 1805 |
| 17 | Ga0070668_101381122 | 3300005347 | Bacteria | 642 |
| 18 | Ga0070669_100277957 | 3300005353 | Bacteria | 1341 |
| 19 | Ga0070675_101657351 | 3300005354 | Bacteria | 590 |
| 20 | Ga0070674_100242866 | 3300005356 | Bacteria | 1411 |
| 21 | Ga0070673_100714410 | 3300005364 | Unclassified | 921 |
| 22 | Ga0070673_101020380 | 3300005364 | Bacteria | 771 |
| 23 | Ga0070688_100568651 | 3300005365 | Bacteria | 864 |
| 24 | Ga0070659_100663687 | 3300005366 | Bacteria | 900 |
| 25 | Ga0070667_100832159 | 3300005367 | Bacteria | 858 |
| 26 | Ga0070701_10527928 | 3300005438 | Unclassified | 771 |
| 27 | Ga0070701_11025897 | 3300005438 | Bacteria | 577 |
| 28 | Ga0070694_100787092 | 3300005444 | Unclassified | 779 |
| 29 | Ga0070708_100177188 | 3300005445 | Bacteria | 1992 |
| 30 | Ga0070708_101306740 | 3300005445 | Bacteria | 677 |
| 31 | Ga0070678_100027981 | 3300005456 | Bacteria | 3837 |
| 32 | Ga0070681_10013219 | 3300005458 | Bacteria | 8202 |
| 33 | Ga0070685_11180781 | 3300005466 | Bacteria | 581 |
| 34 | Ga0070706_100239926 | 3300005467 | Bacteria | 1692 |
| 35 | Ga0070706_100973609 | 3300005467 | Bacteria | 783 |
| 36 | Ga0070707_100051994 | 3300005468 | Bacteria | 3927 |
| 37 | Ga0070707_102186834 | 3300005468 | Unclassified | 521 |
| 38 | Ga0070698_100001169 | 3300005471 | Bacteria | 29110 |
| 39 | Ga0070698_101444185 | 3300005471 | Bacteria | 639 |
| 40 | Ga0070679_100014136 | 3300005530 | Bacteria | 7656 |
| 41 | Ga0070679_100934778 | 3300005530 | Bacteria | 811 |
| 42 | Ga0070684_100067050 | 3300005535 | Bacteria | 3151 |
| 43 | Ga0070697_100739904 | 3300005536 | Bacteria | 869 |
| 44 | Ga0068853_100205219 | 3300005539 | Bacteria | 1795 |
| 45 | Ga0070686_100161552 | 3300005544 | Bacteria | 1578 |
| 46 | Ga0070665_100263747 | 3300005548 | Unclassified | 1724 |
| 47 | Ga0070665_100397754 | 3300005548 | Unclassified | 1385 |
| 48 | Ga0070665_100666040 | 3300005548 | Bacteria | 1054 |
| 49 | Ga0070665_101456652 | 3300005548 | Unclassified | 693 |
| 50 | Ga0068855_100008229 | 3300005563 | Bacteria | 12605 |
| 51 | Ga0068855_100450551 | 3300005563 | Bacteria | 1404 |
| 52 | Ga0068854_100653825 | 3300005578 | Bacteria | 903 |
| 53 | Ga0068856_100032108 | 3300005614 | Bacteria | 5139 |
| 54 | Ga0068856_100714032 | 3300005614 | Bacteria | 1023 |
| 55 | Ga0068852_100017035 | 3300005616 | Bacteria | 5690 |
| 56 | Ga0068864_100411505 | 3300005618 | Bacteria | 1287 |
| 57 | Ga0068864_101800205 | 3300005618 | Bacteria | 618 |
| 58 | Ga0068851_10531158 | 3300005834 | Unclassified | 709 |
| 59 | Ga0068862_101276709 | 3300005844 | Unclassified | 735 |
| 60 | Ga0081455_10000857 | 3300005937 | Bacteria | 39181 |
| 61 | Ga0081538_10312751 | 3300005981 | Unclassified | 574 |
| 62 | Ga0081539_10000830 | 3300005985 | Bacteria | 59681 |
| 63 | Ga0081539_10007269 | 3300005985 | Bacteria | 10168 |
| 64 | Ga0075365_10147594 | 3300006038 | Bacteria | 1635 |
| 65 | Ga0075365_10158498 | 3300006038 | Bacteria | 1576 |
| 66 | Ga0075365_10162911 | 3300006038 | Bacteria | 1554 |
| 67 | Ga0075365_10240428 | 3300006038 | Bacteria | 1272 |
| 68 | Ga0075365_10338446 | 3300006038 | Unclassified | 1060 |
| 69 | Ga0075368_10137360 | 3300006042 | Bacteria | 1018 |
| 70 | Ga0075368_10195582 | 3300006042 | Bacteria | 855 |
| 71 | Ga0075363_100032895 | 3300006048 | Bacteria | 2697 |
| 72 | Ga0075363_100253988 | 3300006048 | Bacteria | 1013 |
| 73 | Ga0075363_100275087 | 3300006048 | Bacteria | 973 |
| 74 | Ga0075364_10111585 | 3300006051 | Bacteria | 1825 |
| 75 | Ga0075364_10379657 | 3300006051 | Bacteria | 964 |
| 76 | Ga0075364_10527923 | 3300006051 | Unclassified | 807 |
| 77 | Ga0075432_10395108 | 3300006058 | Bacteria | 596 |
| 78 | Ga0070716_100939324 | 3300006173 | Bacteria | 680 |
| 79 | Ga0075362_10007130 | 3300006177 | Bacteria | 4212 |
| 80 | Ga0075362_10028004 | 3300006177 | Bacteria | 2417 |
| 81 | Ga0075362_10037583 | 3300006177 | Bacteria | 2123 |
| 82 | Ga0075362_10270761 | 3300006177 | Bacteria | 838 |
| 83 | Ga0075362_10309811 | 3300006177 | Bacteria | 785 |
| 84 | Ga0075362_10433040 | 3300006177 | Bacteria | 666 |
| 85 | Ga0075367_10029788 | 3300006178 | Bacteria | 3125 |
| 86 | Ga0075367_10226110 | 3300006178 | Bacteria | 1172 |
| 87 | Ga0075367_10272685 | 3300006178 | Unclassified | 1063 |
| 88 | Ga0075369_10000423 | 3300006186 | Bacteria | 12833 |
| 89 | Ga0075369_10041320 | 3300006186 | Bacteria | 1974 |
| 90 | Ga0075369_10248566 | 3300006186 | Bacteria | 826 |
| 91 | Ga0075366_10033102 | 3300006195 | Bacteria | 3044 |
| 92 | Ga0075366_10055951 | 3300006195 | Bacteria | 2343 |
| 93 | Ga0075366_10077138 | 3300006195 | Unclassified | 1989 |
| 94 | Ga0097621_100250700 | 3300006237 | Bacteria | 1550 |
| 95 | Ga0097621_101251275 | 3300006237 | Bacteria | 700 |
| 96 | Ga0075370_10114428 | 3300006353 | Bacteria | 1568 |
| 97 | Ga0075370_10234325 | 3300006353 | Bacteria | 1086 |
| 98 | Ga0075370_10337086 | 3300006353 | Bacteria | 900 |
| 99 | Ga0075428_100863482 | 3300006844 | Unclassified | 961 |
| 100 | Ga0068865_100514312 | 3300006881 | Bacteria | 1000 |
| 101 | Ga0097620_101768376 | 3300006931 | Unclassified | 683 |
| 102 | Ga0099794_10038729 | 3300007265 | Bacteria | 2259 |
| 103 | Ga0099795_10135974 | 3300007788 | Bacteria | 996 |
| 104 | Ga0099795_10212541 | 3300007788 | Bacteria | 820 |
| 105 | Ga0105240_10045115 | 3300009093 | Bacteria | 5594 |
| 106 | Ga0111539_11054930 | 3300009094 | Bacteria | 945 |
| 107 | Ga0111539_13370067 | 3300009094 | Bacteria | 514 |
| 108 | Ga0105245_11009185 | 3300009098 | Unclassified | 877 |
| 109 | Ga0105243_11071102 | 3300009148 | Bacteria | 813 |
| 110 | Ga0105243_12344002 | 3300009148 | Bacteria | 572 |
| 111 | Ga0105243_12590536 | 3300009148 | Bacteria | 547 |
| 112 | Ga0105241_10197162 | 3300009174 | Unclassified | 1679 |
| 113 | Ga0105242_11135267 | 3300009176 | Bacteria | 797 |
| 114 | Ga0105242_12307433 | 3300009176 | Unclassified | 584 |
| 115 | Ga0105248_11315389 | 3300009177 | Bacteria | 818 |
| 116 | Ga0105237_10291541 | 3300009545 | Bacteria | 1634 |
| 117 | Ga0105238_10075159 | 3300009551 | Bacteria | 3371 |
| 118 | Ga0105238_10151347 | 3300009551 | Bacteria | 2295 |
| 119 | Ga0105238_11188764 | 3300009551 | Unclassified | 787 |
| 120 | Ga0105238_11375215 | 3300009551 | Bacteria | 733 |
| 121 | Ga0105249_13276489 | 3300009553 | Bacteria | 521 |
| 122 | Ga0099796_10502198 | 3300010159 | Bacteria | 543 |
| 123 | Ga0105239_10131632 | 3300010375 | Bacteria | 2783 |
| 124 | Ga0105246_10921292 | 3300011119 | Bacteria | 785 |
| 125 | Ga0157373_10084305 | 3300013100 | Bacteria | 2240 |
| 126 | Ga0157371_10097578 | 3300013102 | Bacteria | 2083 |
| 127 | Ga0157370_11610066 | 3300013104 | Unclassified | 583 |
| 128 | Ga0157369_10403074 | 3300013105 | Unclassified | 1419 |
| 129 | Ga0157369_10716424 | 3300013105 | Bacteria | 1030 |
| 130 | Ga0157374_11394295 | 3300013296 | Bacteria | 723 |
| 131 | Ga0157378_10473071 | 3300013297 | Bacteria | 1247 |
| 132 | Ga0163162_11382211 | 3300013306 | Bacteria | 801 |
| 133 | Ga0163162_12789581 | 3300013306 | Bacteria | 562 |
| 134 | Ga0157372_10208373 | 3300013307 | Bacteria | 2265 |
| 135 | Ga0157375_11257416 | 3300013308 | Bacteria | 869 |
| 136 | Ga0157375_12055316 | 3300013308 | Bacteria | 679 |
| 137 | Ga0157380_10483148 | 3300014326 | Bacteria | 1199 |
| 138 | Ga0182008_10194541 | 3300014497 | Bacteria | 1030 |
| 139 | Ga0157376_11365448 | 3300014969 | Bacteria | 740 |
| 140 | Ga0163161_10549189 | 3300017792 | Bacteria | 947 |
| 141 | Ga0163161_11798935 | 3300017792 | Bacteria | 545 |
| 142 | Ga0206356_11699585 | 3300020070 | Bacteria | 896 |
| 143 | Ga0206353_11515071 | 3300020082 | Bacteria | 938 |
| 144 | Ga0213872_10044204 | 3300021361 | Bacteria | 2028 |
| 145 | Ga0213871_10006572 | 3300021441 | Bacteria | 2466 |
| 146 | Ga0207426_1018368 | 3300025302 | Bacteria | 2465 |
| 147 | Ga0207426_1025300 | 3300025302 | Bacteria | 2000 |
| 148 | Ga0207688_10559429 | 3300025901 | Bacteria | 719 |
| 149 | Ga0207645_10438886 | 3300025907 | Bacteria | 881 |
| 150 | Ga0207705_10205651 | 3300025909 | Bacteria | 1492 |
| 151 | Ga0207705_10280205 | 3300025909 | Unclassified | 1276 |
| 152 | Ga0207684_10074149 | 3300025910 | Bacteria | 2891 |
| 153 | Ga0207684_10757812 | 3300025910 | Bacteria | 822 |
| 154 | Ga0207654_10115880 | 3300025911 | Unclassified | 1674 |
| 155 | Ga0207707_10030869 | 3300025912 | Bacteria | 4687 |
| 156 | Ga0207707_10412585 | 3300025912 | Bacteria | 1158 |
| 157 | Ga0207695_10024252 | 3300025913 | Bacteria | 6830 |
| 158 | Ga0207660_10023904 | 3300025917 | Bacteria | 4132 |
| 159 | Ga0207657_10032528 | 3300025919 | Bacteria | 4711 |
| 160 | Ga0207649_10074013 | 3300025920 | Bacteria | 2184 |
| 161 | Ga0207652_10799580 | 3300025921 | Unclassified | 837 |
| 162 | Ga0207646_10118969 | 3300025922 | Bacteria | 2373 |
| 163 | Ga0207681_10965915 | 3300025923 | Bacteria | 714 |
| 164 | Ga0207694_10077736 | 3300025924 | Bacteria | 2601 |
| 165 | Ga0207694_10097414 | 3300025924 | Bacteria | 2327 |
| 166 | Ga0207650_10496410 | 3300025925 | Unclassified | 1020 |
| 167 | Ga0207659_10448608 | 3300025926 | Bacteria | 1086 |
| 168 | Ga0207659_11917187 | 3300025926 | Unclassified | 502 |
| 169 | Ga0207687_10614125 | 3300025927 | Bacteria | 917 |
| 170 | Ga0207706_10495666 | 3300025933 | Unclassified | 1055 |
| 171 | Ga0207669_10564968 | 3300025937 | Unclassified | 920 |
| 172 | Ga0207691_10516666 | 3300025940 | Bacteria | 1013 |
| 173 | Ga0207661_10156987 | 3300025944 | Bacteria | 1971 |
| 174 | Ga0207679_10004810 | 3300025945 | Bacteria | 8414 |
| 175 | Ga0207667_10013050 | 3300025949 | Bacteria | 9538 |
| 176 | Ga0207667_10137570 | 3300025949 | Bacteria | 2515 |
| 177 | Ga0207667_10215935 | 3300025949 | Bacteria | 1965 |
| 178 | Ga0207651_10260975 | 3300025960 | Bacteria | 1422 |
| 179 | Ga0207651_10658248 | 3300025960 | Bacteria | 920 |
| 180 | Ga0207651_11403049 | 3300025960 | Unclassified | 629 |
| 181 | Ga0207712_10565792 | 3300025961 | Bacteria | 979 |
| 182 | Ga0207640_10030671 | 3300025981 | Bacteria | 3314 |
| 183 | Ga0207677_10545394 | 3300026023 | Unclassified | 1010 |
| 184 | Ga0207639_10087155 | 3300026041 | Bacteria | 2488 |
| 185 | Ga0207702_10741322 | 3300026078 | Bacteria | 969 |
| 186 | Ga0207676_10945446 | 3300026095 | Bacteria | 847 |
| 187 | Ga0207674_10444399 | 3300026116 | Bacteria | 1253 |
| 188 | Ga0207674_11606903 | 3300026116 | Bacteria | 619 |
| 189 | Ga0207683_10032445 | 3300026121 | Bacteria | 4537 |
| 190 | Ga0207698_10020207 | 3300026142 | Bacteria | 4578 |
| 191 | Ga0209813_10196839 | 3300027866 | Bacteria | 744 |
| 192 | Ga0209813_10225063 | 3300027866 | Bacteria | 704 |
| 193 | Ga0209813_10322071 | 3300027866 | Unclassified | 605 |
| 194 | Ga0207428_10517747 | 3300027907 | Unclassified | 865 |
| 195 | Ga0268266_10046276 | 3300028379 | Bacteria | 3725 |
| 196 | Ga0268266_10062021 | 3300028379 | Bacteria | 3225 |
| 197 | Ga0307517_10574809 | 3300028786 | Unclassified | 559 |
| 198 | Ga0265316_11038050 | 3300031344 | Bacteria | 570 |
| 199 | Ga0307409_101275839 | 3300031995 | Unclassified | 759 |
| 200 | Ga0307415_100496763 | 3300032126 | Bacteria | 1066 |
| 201 | Ga0373948_0139344 | 3300034817 | Unclassified | 599 |
| 202 | Ga0373945_0109648 | 3300035116 | Bacteria | 1088 |
| 203 | Ga0373945_0183848 | 3300035116 | Bacteria | 862 |
| 204 | Ga0373931_0676858 | 3300035691 | Bacteria | 680 |
| 205 | Ga0373931_0781384 | 3300035691 | Bacteria | 635 |
| 206 | Ga0373935_0602267 | 3300035692 | Unclassified | 804 |
| 207 | Ga0373927_0440651 | 3300035695 | Bacteria | 860 |
| 208 | Ga0373933_0037220 | 3300035724 | Bacteria | 2853 |
| 209 | Ga0373925_0541092 | 3300037068 | Bacteria | 957 |
| 210 | Ga0395899_0012179 | 3300037312 | Bacteria | 6585 |
| 211 | Ga0395899_0052178 | 3300037312 | Bacteria | 3032 |
| 212 | Ga0395899_0091340 | 3300037312 | Bacteria | 2206 |
| 213 | Ga0395899_0133358 | 3300037312 | Bacteria | 1772 |
| 214 | Ga0395900_0008391 | 3300037418 | Bacteria | 10631 |
| 215 | Ga0395900_0061349 | 3300037418 | Bacteria | 3866 |
| 216 | Ga0395900_0065930 | 3300037418 | Bacteria | 3720 |
| 217 | Ga0395900_0430601 | 3300037418 | Unclassified | 1278 |
| 218 | Ga0395898_0050998 | 3300037466 | Bacteria | 4047 |
| 219 | Ga0395898_0274270 | 3300037466 | Unclassified | 1608 |
| 220 | Ga0395898_0438366 | 3300037466 | Unclassified | 1244 |
| 221 | Ga0395898_1109199 | 3300037466 | Bacteria | 724 |
| 222 | Ga0395901_0007675 | 3300038443 | Bacteria | 10881 |
| 223 | Ga0395901_0009503 | 3300038443 | Bacteria | 9864 |
| 224 | Ga0395901_0023444 | 3300038443 | Bacteria | 6327 |
| 225 | Ga0395901_0119637 | 3300038443 | Bacteria | 2767 |
| 226 | Ga0395901_0153094 | 3300038443 | Bacteria | 2422 |
| 227 | Ga0436360_0975466 | 3300039438 | Bacteria | 4931 |
| 228 | Ga0436361_0014907 | 3300039447 | Bacteria | 1710 |
| 229 | Ga0436361_0583487 | 3300039447 | Unclassified | 835 |
| 230 | Ga0436361_0628117 | 3300039447 | Bacteria | 2005 |
| 231 | Ga0439465_0060951 | 3300041413 | Bacteria | 1250 |
| 232 | Ga0451853_2895774 | 3300041512 | Unclassified | 624 |
| 233 | Ga0439448_0154950 | 3300042005 | Unclassified | 796 |
| 234 | Ga0439458_0051369 | 3300042157 | Bacteria | 1018 |
| 235 | Ga0439459_0181057 | 3300042438 | Unclassified | 566 |
| 236 | Ga0466963_0074175 | 3300044694 | Bacteria | 2294 |
| 237 | Ga0466964_0146518 | 3300044706 | Unclassified | 1090 |
| 238 | Ga0466957_0037751 | 3300044842 | Bacteria | 2909 |
| 239 | Ga0466959_1091208 | 3300045049 | Unclassified | 531 |
| 240 | Ga0466967_0004686 | 3300045976 | Bacteria | 9289 |
| 241 | Ga0495603_0651368 | 3300046455 | Bacteria | 603 |
| 242 | Ga0496112_0811236 | 3300048915 | Bacteria | 860 |
| 243 | Ga0496113_1275714 | 3300048916 | Unclassified | 572 |
| 244 | Ga0496126_0108897 | 3300048929 | Bacteria | 2415 |
| 245 | Ga0501034_0002101 | 3300049571 | Bacteria | 24863 |
| 246 | Ga0501034_0019414 | 3300049571 | Bacteria | 6952 |
| 247 | Ga0501037_0256152 | 3300049573 | Bacteria | 1224 |
| 248 | Ga0501070_0768577 | 3300049586 | Bacteria | 758 |
| 249 | Ga0501081_1003987 | 3300049743 | Bacteria | 631 |
| 250 | Ga0501044_0052459 | 3300049823 | Bacteria | 4202 |
| 251 | nmdc:mga03683_158301_c1 | 3300050489 | Unclassified | 1025 |
| 252 | nmdc:mga03683_2186_c1 | 3300050489 | Bacteria | 6038 |
| 253 | nmdc:mga03683_231369_c1 | 3300050489 | Unclassified | 855 |
| 254 | nmdc:mga03683_240019_c1 | 3300050489 | Bacteria | 840 |
| 255 | nmdc:mga03683_356786_c1 | 3300050489 | Bacteria | 693 |
| 256 | nmdc:mga03683_90122_c1 | 3300050489 | Bacteria | 1336 |
| 257 | nmdc:mga03683_97657_c1 | 3300050489 | Bacteria | 1288 |
| 258 | nmdc:mga03n38_181634_c1 | 3300050490 | Bacteria | 1078 |
| 259 | nmdc:mga03n38_267963_c1 | 3300050490 | Bacteria | 907 |
| 260 | nmdc:mga03n38_916745_c1 | 3300050490 | Unclassified | 515 |
| 261 | nmdc:mga00v17_387644_c1 | 3300050491 | Bacteria | 908 |
| 262 | nmdc:mga00v17_395791_c1 | 3300050491 | Bacteria | 898 |
| 263 | nmdc:mga00v17_399207_c1 | 3300050491 | Bacteria | 893 |
| 264 | nmdc:mga0yw44_162002_c1 | 3300050492 | Bacteria | 1465 |
| 265 | nmdc:mga0yw44_303944_c1 | 3300050492 | Bacteria | 1069 |
| 266 | nmdc:mga0yw44_335995_c1 | 3300050492 | Unclassified | 1016 |
| 267 | nmdc:mga0yw44_509182_c1 | 3300050492 | Bacteria | 817 |
| 268 | nmdc:mga0yw44_587162_c1 | 3300050492 | Unclassified | 757 |
| 269 | nmdc:mga0yw44_60302_c1 | 3300050492 | Bacteria | 2324 |
| 270 | nmdc:mga0k408_13238_c1 | 3300050493 | Bacteria | 3818 |
| 271 | nmdc:mga0k408_343377_c1 | 3300050493 | Bacteria | 890 |
| 272 | nmdc:mga0k408_62687_c1 | 3300050493 | Bacteria | 2162 |
| 273 | nmdc:mga0k408_652210_c1 | 3300050493 | Unclassified | 619 |
| 274 | nmdc:mga0k408_95983_c1 | 3300050493 | Unclassified | 1745 |
| 275 | nmdc:mga06z11_40738_c1 | 3300050494 | Bacteria | 2320 |
| 276 | nmdc:mga06z11_776919_c1 | 3300050494 | Bacteria | 584 |
| 277 | nmdc:mga04h51_294433_c1 | 3300050495 | Bacteria | 660 |
| 278 | nmdc:mga04h51_64738_c1 | 3300050495 | Bacteria | 1262 |
| 279 | nmdc:mga07m45_168394_c1 | 3300050496 | Unclassified | 1273 |
| 280 | nmdc:mga07m45_338092_c1 | 3300050496 | Bacteria | 875 |
| 281 | nmdc:mga07m45_495528_c1 | 3300050496 | Bacteria | 707 |
| 282 | nmdc:mga08y16_147152_c1 | 3300050511 | Bacteria | 2448 |
| 283 | nmdc:mga08y16_226094_c1 | 3300050511 | Bacteria | 1936 |
| 284 | nmdc:mga08x19_536496_c1 | 3300050514 | Bacteria | 827 |
| 285 | nmdc:mga08x19_969668_c1 | 3300050514 | Unclassified | 604 |
| 286 | nmdc:mga0sz30_3309_c1 | 3300050516 | Bacteria | 5796 |
| 287 | nmdc:mga0sz30_462271_c1 | 3300050516 | Unclassified | 570 |
| 288 | Ga0500644_0474535 | 3300053088 | Bacteria | 549 |
| 289 | Ga0500651_0451994 | 3300053093 | Unclassified | 714 |
| 290 | Ga0500641_0002888 | 3300053096 | Bacteria | 6093 |
| 291 | Ga0500642_0298463 | 3300053130 | Unclassified | 728 |
| 292 | Ga0500633_0319907 | 3300053160 | Unclassified | 568 |
| 293 | Ga0500609_013688 | 3300053731 | Bacteria | 1098 |
| 294 | Ga0501082_0908779 | 3300060353 | Unclassified | 770 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0781384 | Ga0373931_0781384_130_459 | 103 |
| 2 | 3300035692 | Ga0373935_0602267 | Ga0373935_0602267_395_724 | 103 |
| 3 | 3300039447 | Ga0436361_0583487 | Ga0436361_0583487_397_768 | 108 |
| 4 | 3300053088 | Ga0500644_0474535 | Ga0500644_0474535_93_425 | 108 |
| 5 | 3300007265 | Ga0099794_10038729 | Ga0099794_100387292 | 110 |
| 6 | 3300010159 | Ga0099796_10502198 | Ga0099796_105021981 | 110 |
| 7 | 3300035116 | Ga0373945_0109648 | Ga0373945_0109648_589_957 | 110 |
| 8 | 3300037068 | Ga0373925_0541092 | Ga0373925_0541092_143_511 | 110 |
| 9 | 3300048929 | Ga0496126_0108897 | Ga0496126_0108897_1165_1533 | 110 |
| 10 | 3300049571 | Ga0501034_0019414 | Ga0501034_0019414_14_352 | 110 |
| 11 | 3300050489 | nmdc:mga03683_97657_c1 | nmdc:mga03683_97657_c1_319_678 | 110 |
| 12 | 3300050491 | nmdc:mga00v17_399207_c1 | nmdc:mga00v17_399207_c1_496_855 | 110 |
| 13 | 3300050492 | nmdc:mga0yw44_60302_c1 | nmdc:mga0yw44_60302_c1_252_611 | 110 |
| 14 | 3300050494 | nmdc:mga06z11_40738_c1 | nmdc:mga06z11_40738_c1_1094_1453 | 110 |
| 15 | 3300050495 | nmdc:mga04h51_64738_c1 | nmdc:mga04h51_64738_c1_612_971 | 110 |
| 16 | 3300050496 | nmdc:mga07m45_495528_c1 | nmdc:mga07m45_495528_c1_326_685 | 110 |
| 17 | 3300035695 | Ga0373927_0440651 | Ga0373927_0440651_222_566 | 111 |
| 18 | 3300003322 | rootL2_10313149 | rootL2_103131492 | 114 |
| 19 | 3300009553 | Ga0105249_13276489 | Ga0105249_132764891 | 114 |
| 20 | 3300005327 | Ga0070658_10044021 | Ga0070658_100440213 | 115 |
| 21 | 3300005336 | Ga0070680_100004156 | Ga0070680_1000041569 | 115 |
| 22 | 3300005341 | Ga0070691_10012467 | Ga0070691_100124673 | 115 |
| 23 | 3300005458 | Ga0070681_10013219 | Ga0070681_100132195 | 115 |
| 24 | 3300005530 | Ga0070679_100014136 | Ga0070679_1000141367 | 115 |
| 25 | 3300005548 | Ga0070665_101456652 | Ga0070665_1014566522 | 115 |
| 26 | 3300005563 | Ga0068855_100008229 | Ga0068855_1000082298 | 115 |
| 27 | 3300005614 | Ga0068856_100714032 | Ga0068856_1007140321 | 115 |
| 28 | 3300009093 | Ga0105240_10045115 | Ga0105240_100451152 | 115 |
| 29 | 3300009551 | Ga0105238_10151347 | Ga0105238_101513472 | 115 |
| 30 | 3300025909 | Ga0207705_10205651 | Ga0207705_102056511 | 115 |
| 31 | 3300025912 | Ga0207707_10030869 | Ga0207707_100308695 | 115 |
| 32 | 3300025913 | Ga0207695_10024252 | Ga0207695_100242529 | 115 |
| 33 | 3300025917 | Ga0207660_10023904 | Ga0207660_100239044 | 115 |
| 34 | 3300025924 | Ga0207694_10097414 | Ga0207694_100974143 | 115 |
| 35 | 3300025949 | Ga0207667_10137570 | Ga0207667_101375701 | 115 |
| 36 | 3300026078 | Ga0207702_10741322 | Ga0207702_107413223 | 115 |
| 37 | 3300003911 | JGI25405J52794_10024322 | JGI25405J52794_100243222 | 117 |
| 38 | 3300005445 | Ga0070708_100177188 | Ga0070708_1001771881 | 117 |
| 39 | 3300005467 | Ga0070706_100973609 | Ga0070706_1009736091 | 117 |
| 40 | 3300005468 | Ga0070707_100051994 | Ga0070707_1000519941 | 117 |
| 41 | 3300005471 | Ga0070698_100001169 | Ga0070698_10000116913 | 117 |
| 42 | 3300005471 | Ga0070698_101444185 | Ga0070698_1014441852 | 117 |
| 43 | 3300005536 | Ga0070697_100739904 | Ga0070697_1007399041 | 117 |
| 44 | 3300005937 | Ga0081455_10000857 | Ga0081455_1000085716 | 117 |
| 45 | 3300006038 | Ga0075365_10158498 | Ga0075365_101584982 | 117 |
| 46 | 3300006173 | Ga0070716_100939324 | Ga0070716_1009393242 | 117 |
| 47 | 3300006177 | Ga0075362_10028004 | Ga0075362_100280043 | 117 |
| 48 | 3300006178 | Ga0075367_10029788 | Ga0075367_100297882 | 117 |
| 49 | 3300006186 | Ga0075369_10041320 | Ga0075369_100413203 | 117 |
| 50 | 3300006195 | Ga0075366_10055951 | Ga0075366_100559513 | 117 |
| 51 | 3300006353 | Ga0075370_10114428 | Ga0075370_101144283 | 117 |
| 52 | 3300007788 | Ga0099795_10212541 | Ga0099795_102125412 | 117 |
| 53 | 3300020082 | Ga0206353_11515071 | Ga0206353_115150712 | 117 |
| 54 | 3300021361 | Ga0213872_10044204 | Ga0213872_100442043 | 117 |
| 55 | 3300021441 | Ga0213871_10006572 | Ga0213871_100065723 | 117 |
| 56 | 3300025910 | Ga0207684_10074149 | Ga0207684_100741494 | 117 |
| 57 | 3300025922 | Ga0207646_10118969 | Ga0207646_101189692 | 117 |
| 58 | 3300037312 | Ga0395899_0091340 | Ga0395899_0091340_325_714 | 117 |
| 59 | 3300037312 | Ga0395899_0133358 | Ga0395899_0133358_970_1359 | 117 |
| 60 | 3300037418 | Ga0395900_0061349 | Ga0395900_0061349_2046_2435 | 117 |
| 61 | 3300037466 | Ga0395898_0050998 | Ga0395898_0050998_3037_3426 | 117 |
| 62 | 3300038443 | Ga0395901_0007675 | Ga0395901_0007675_5373_5762 | 117 |
| 63 | 3300038443 | Ga0395901_0153094 | Ga0395901_0153094_1900_2289 | 117 |
| 64 | 3300039438 | Ga0436360_0975466 | Ga0436360_0975466_2846_3214 | 117 |
| 65 | 3300039447 | Ga0436361_0628117 | Ga0436361_0628117_155_523 | 117 |
| 66 | 3300050491 | nmdc:mga00v17_399207_c1 | nmdc:mga00v17_399207_c1_76_447 | 117 |
| 67 | 3300050493 | nmdc:mga0k408_62687_c1 | nmdc:mga0k408_62687_c1_852_1223 | 117 |
| 68 | 3300050494 | nmdc:mga06z11_40738_c1 | nmdc:mga06z11_40738_c1_674_1045 | 117 |
| 69 | 3300050495 | nmdc:mga04h51_64738_c1 | nmdc:mga04h51_64738_c1_192_563 | 117 |
| 70 | 3300005333 | Ga0070677_10391927 | Ga0070677_103919271 | 118 |
| 71 | 3300005354 | Ga0070675_101657351 | Ga0070675_1016573511 | 118 |
| 72 | 3300005364 | Ga0070673_101020380 | Ga0070673_1010203802 | 118 |
| 73 | 3300005548 | Ga0070665_100666040 | Ga0070665_1006660402 | 118 |
| 74 | 3300005981 | Ga0081538_10312751 | Ga0081538_103127511 | 118 |
| 75 | 3300006038 | Ga0075365_10240428 | Ga0075365_102404283 | 118 |
| 76 | 3300006042 | Ga0075368_10137360 | Ga0075368_101373602 | 118 |
| 77 | 3300006048 | Ga0075363_100253988 | Ga0075363_1002539882 | 118 |
| 78 | 3300006048 | Ga0075363_100275087 | Ga0075363_1002750872 | 118 |
| 79 | 3300006051 | Ga0075364_10111585 | Ga0075364_101115853 | 118 |
| 80 | 3300006051 | Ga0075364_10527923 | Ga0075364_105279232 | 118 |
| 81 | 3300006177 | Ga0075362_10007130 | Ga0075362_100071303 | 118 |
| 82 | 3300006177 | Ga0075362_10037583 | Ga0075362_100375834 | 118 |
| 83 | 3300006177 | Ga0075362_10270761 | Ga0075362_102707611 | 118 |
| 84 | 3300006177 | Ga0075362_10309811 | Ga0075362_103098112 | 118 |
| 85 | 3300006178 | Ga0075367_10226110 | Ga0075367_102261102 | 118 |
| 86 | 3300006178 | Ga0075367_10272685 | Ga0075367_102726852 | 118 |
| 87 | 3300006186 | Ga0075369_10000423 | Ga0075369_1000042313 | 118 |
| 88 | 3300006195 | Ga0075366_10077138 | Ga0075366_100771382 | 118 |
| 89 | 3300006353 | Ga0075370_10234325 | Ga0075370_102343251 | 118 |
| 90 | 3300006353 | Ga0075370_10337086 | Ga0075370_103370862 | 118 |
| 91 | 3300006844 | Ga0075428_100863482 | Ga0075428_1008634822 | 118 |
| 92 | 3300009094 | Ga0111539_11054930 | Ga0111539_110549302 | 118 |
| 93 | 3300009176 | Ga0105242_12307433 | Ga0105242_123074331 | 118 |
| 94 | 3300009551 | Ga0105238_11375215 | Ga0105238_113752152 | 118 |
| 95 | 3300013297 | Ga0157378_10473071 | Ga0157378_104730712 | 118 |
| 96 | 3300013306 | Ga0163162_12789581 | Ga0163162_127895812 | 118 |
| 97 | 3300013308 | Ga0157375_11257416 | Ga0157375_112574162 | 118 |
| 98 | 3300014326 | Ga0157380_10483148 | Ga0157380_104831482 | 118 |
| 99 | 3300025901 | Ga0207688_10559429 | Ga0207688_105594292 | 118 |
| 100 | 3300025960 | Ga0207651_10658248 | Ga0207651_106582482 | 118 |
| 101 | 3300026023 | Ga0207677_10545394 | Ga0207677_105453942 | 118 |
| 102 | 3300027866 | Ga0209813_10322071 | Ga0209813_103220712 | 118 |
| 103 | 3300028786 | Ga0307517_10574809 | Ga0307517_105748091 | 118 |
| 104 | 3300031995 | Ga0307409_101275839 | Ga0307409_1012758392 | 118 |
| 105 | 3300034817 | Ga0373948_0139344 | Ga0373948_0139344_141_518 | 118 |
| 106 | 3300042157 | Ga0439458_0051369 | Ga0439458_0051369_328_705 | 118 |
| 107 | 3300042438 | Ga0439459_0181057 | Ga0439459_0181057_36_413 | 118 |
| 108 | 3300049743 | Ga0501081_1003987 | Ga0501081_1003987_183_572 | 118 |
| 109 | 3300050489 | nmdc:mga03683_158301_c1 | nmdc:mga03683_158301_c1_460_837 | 118 |
| 110 | 3300050489 | nmdc:mga03683_2186_c1 | nmdc:mga03683_2186_c1_3011_3388 | 118 |
| 111 | 3300050489 | nmdc:mga03683_231369_c1 | nmdc:mga03683_231369_c1_377_754 | 118 |
| 112 | 3300050489 | nmdc:mga03683_240019_c1 | nmdc:mga03683_240019_c1_29_406 | 118 |
| 113 | 3300050489 | nmdc:mga03683_356786_c1 | nmdc:mga03683_356786_c1_201_578 | 118 |
| 114 | 3300050490 | nmdc:mga03n38_181634_c1 | nmdc:mga03n38_181634_c1_534_911 | 118 |
| 115 | 3300050490 | nmdc:mga03n38_267963_c1 | nmdc:mga03n38_267963_c1_109_519 | 118 |
| 116 | 3300050490 | nmdc:mga03n38_916745_c1 | nmdc:mga03n38_916745_c1_119_496 | 118 |
| 117 | 3300050491 | nmdc:mga00v17_395791_c1 | nmdc:mga00v17_395791_c1_397_774 | 118 |
| 118 | 3300050492 | nmdc:mga0yw44_162002_c1 | nmdc:mga0yw44_162002_c1_80_457 | 118 |
| 119 | 3300050492 | nmdc:mga0yw44_303944_c1 | nmdc:mga0yw44_303944_c1_70_447 | 118 |
| 120 | 3300050492 | nmdc:mga0yw44_587162_c1 | nmdc:mga0yw44_587162_c1_351_728 | 118 |
| 121 | 3300050493 | nmdc:mga0k408_652210_c1 | nmdc:mga0k408_652210_c1_67_444 | 118 |
| 122 | 3300050493 | nmdc:mga0k408_95983_c1 | nmdc:mga0k408_95983_c1_855_1232 | 118 |
| 123 | 3300050494 | nmdc:mga06z11_776919_c1 | nmdc:mga06z11_776919_c1_159_536 | 118 |
| 124 | 3300050496 | nmdc:mga07m45_168394_c1 | nmdc:mga07m45_168394_c1_801_1178 | 118 |
| 125 | 3300050496 | nmdc:mga07m45_338092_c1 | nmdc:mga07m45_338092_c1_183_560 | 118 |
| 126 | 3300050511 | nmdc:mga08y16_147152_c1 | nmdc:mga08y16_147152_c1_1034_1411 | 118 |
| 127 | 3300050514 | nmdc:mga08x19_536496_c1 | nmdc:mga08x19_536496_c1_137_508 | 118 |
| 128 | 3300050514 | nmdc:mga08x19_969668_c1 | nmdc:mga08x19_969668_c1_123_515 | 118 |
| 129 | 3300050516 | nmdc:mga0sz30_3309_c1 | nmdc:mga0sz30_3309_c1_2033_2410 | 118 |
| 130 | 3300053096 | Ga0500641_0002888 | Ga0500641_0002888_996_1391 | 118 |
| 131 | 3300060353 | Ga0501082_0908779 | Ga0501082_0908779_136_513 | 118 |
| 132 | 3300005438 | Ga0070701_10527928 | Ga0070701_105279281 | 119 |
| 133 | 3300005468 | Ga0070707_102186834 | Ga0070707_1021868341 | 119 |
| 134 | 3300005985 | Ga0081539_10000830 | Ga0081539_100008302 | 119 |
| 135 | 3300006038 | Ga0075365_10147594 | Ga0075365_101475942 | 119 |
| 136 | 3300006038 | Ga0075365_10158498 | Ga0075365_101584983 | 119 |
| 137 | 3300006038 | Ga0075365_10162911 | Ga0075365_101629112 | 119 |
| 138 | 3300006038 | Ga0075365_10338446 | Ga0075365_103384462 | 119 |
| 139 | 3300006042 | Ga0075368_10195582 | Ga0075368_101955822 | 119 |
| 140 | 3300006048 | Ga0075363_100032895 | Ga0075363_1000328953 | 119 |
| 141 | 3300006048 | Ga0075363_100253988 | Ga0075363_1002539881 | 119 |
| 142 | 3300006051 | Ga0075364_10379657 | Ga0075364_103796572 | 119 |
| 143 | 3300006058 | Ga0075432_10395108 | Ga0075432_103951081 | 119 |
| 144 | 3300006177 | Ga0075362_10007130 | Ga0075362_100071302 | 119 |
| 145 | 3300006177 | Ga0075362_10028004 | Ga0075362_100280042 | 119 |
| 146 | 3300006177 | Ga0075362_10037583 | Ga0075362_100375833 | 119 |
| 147 | 3300006177 | Ga0075362_10433040 | Ga0075362_104330401 | 119 |
| 148 | 3300006178 | Ga0075367_10029788 | Ga0075367_100297883 | 119 |
| 149 | 3300006178 | Ga0075367_10226110 | Ga0075367_102261101 | 119 |
| 150 | 3300006186 | Ga0075369_10000423 | Ga0075369_1000042312 | 119 |
| 151 | 3300006186 | Ga0075369_10248566 | Ga0075369_102485661 | 119 |
| 152 | 3300006195 | Ga0075366_10055951 | Ga0075366_100559512 | 119 |
| 153 | 3300006195 | Ga0075366_10077138 | Ga0075366_100771383 | 119 |
| 154 | 3300006353 | Ga0075370_10234325 | Ga0075370_102343252 | 119 |
| 155 | 3300009148 | Ga0105243_12590536 | Ga0105243_125905362 | 119 |
| 156 | 3300009551 | Ga0105238_11188764 | Ga0105238_111887642 | 119 |
| 157 | 3300011119 | Ga0105246_10921292 | Ga0105246_109212922 | 119 |
| 158 | 3300027866 | Ga0209813_10196839 | Ga0209813_101968392 | 119 |
| 159 | 3300027866 | Ga0209813_10225063 | Ga0209813_102250631 | 119 |
| 160 | 3300027907 | Ga0207428_10517747 | Ga0207428_105177471 | 119 |
| 161 | 3300032126 | Ga0307415_100496763 | Ga0307415_1004967632 | 119 |
| 162 | 3300035691 | Ga0373931_0676858 | Ga0373931_0676858_66_473 | 119 |
| 163 | 3300050491 | nmdc:mga00v17_387644_c1 | nmdc:mga00v17_387644_c1_368_754 | 119 |
| 164 | 3300050492 | nmdc:mga0yw44_162002_c1 | nmdc:mga0yw44_162002_c1_511_897 | 119 |
| 165 | 3300050492 | nmdc:mga0yw44_335995_c1 | nmdc:mga0yw44_335995_c1_365_763 | 119 |
| 166 | 3300050492 | nmdc:mga0yw44_509182_c1 | nmdc:mga0yw44_509182_c1_287_673 | 119 |
| 167 | 3300050493 | nmdc:mga0k408_343377_c1 | nmdc:mga0k408_343377_c1_396_794 | 119 |
| 168 | 3300050493 | nmdc:mga0k408_62687_c1 | nmdc:mga0k408_62687_c1_1245_1631 | 119 |
| 169 | 3300050495 | nmdc:mga04h51_294433_c1 | nmdc:mga04h51_294433_c1_40_438 | 119 |
| 170 | 3300050511 | nmdc:mga08y16_147152_c1 | nmdc:mga08y16_147152_c1_594_980 | 119 |
| 171 | 3300050516 | nmdc:mga0sz30_462271_c1 | nmdc:mga0sz30_462271_c1_111_497 | 119 |
| 172 | 3300053093 | Ga0500651_0451994 | Ga0500651_0451994_252_638 | 119 |
| 173 | 3300053130 | Ga0500642_0298463 | Ga0500642_0298463_255_641 | 119 |
| 174 | 3300053160 | Ga0500633_0319907 | Ga0500633_0319907_138_524 | 119 |
| 175 | 3300053731 | Ga0500609_013688 | Ga0500609_013688_618_983 | 119 |
| 176 | 3300002067 | JGI24735J21928_10036561 | JGI24735J21928_100365611 | 120 |
| 177 | 3300003203 | JGI25406J46586_10072433 | JGI25406J46586_100724332 | 120 |
| 178 | 3300005327 | Ga0070658_10261094 | Ga0070658_102610942 | 120 |
| 179 | 3300005328 | Ga0070676_10137648 | Ga0070676_101376483 | 120 |
| 180 | 3300005329 | Ga0070683_100024620 | Ga0070683_1000246206 | 120 |
| 181 | 3300005336 | Ga0070680_100311772 | Ga0070680_1003117722 | 120 |
| 182 | 3300005337 | Ga0070682_101250520 | Ga0070682_1012505202 | 120 |
| 183 | 3300005339 | Ga0070660_100184557 | Ga0070660_1001845571 | 120 |
| 184 | 3300005341 | Ga0070691_10932214 | Ga0070691_109322141 | 120 |
| 185 | 3300005344 | Ga0070661_100142741 | Ga0070661_1001427411 | 120 |
| 186 | 3300005347 | Ga0070668_101381122 | Ga0070668_1013811221 | 120 |
| 187 | 3300005353 | Ga0070669_100277957 | Ga0070669_1002779572 | 120 |
| 188 | 3300005356 | Ga0070674_100242866 | Ga0070674_1002428662 | 120 |
| 189 | 3300005364 | Ga0070673_100714410 | Ga0070673_1007144102 | 120 |
| 190 | 3300005365 | Ga0070688_100568651 | Ga0070688_1005686512 | 120 |
| 191 | 3300005366 | Ga0070659_100663687 | Ga0070659_1006636871 | 120 |
| 192 | 3300005367 | Ga0070667_100832159 | Ga0070667_1008321592 | 120 |
| 193 | 3300005438 | Ga0070701_11025897 | Ga0070701_110258971 | 120 |
| 194 | 3300005444 | Ga0070694_100787092 | Ga0070694_1007870921 | 120 |
| 195 | 3300005445 | Ga0070708_101306740 | Ga0070708_1013067402 | 120 |
| 196 | 3300005456 | Ga0070678_100027981 | Ga0070678_1000279815 | 120 |
| 197 | 3300005466 | Ga0070685_11180781 | Ga0070685_111807811 | 120 |
| 198 | 3300005467 | Ga0070706_100239926 | Ga0070706_1002399262 | 120 |
| 199 | 3300005471 | Ga0070698_100001169 | Ga0070698_10000116912 | 120 |
| 200 | 3300005530 | Ga0070679_100934778 | Ga0070679_1009347782 | 120 |
| 201 | 3300005535 | Ga0070684_100067050 | Ga0070684_1000670503 | 120 |
| 202 | 3300005539 | Ga0068853_100205219 | Ga0068853_1002052191 | 120 |
| 203 | 3300005544 | Ga0070686_100161552 | Ga0070686_1001615523 | 120 |
| 204 | 3300005548 | Ga0070665_100263747 | Ga0070665_1002637472 | 120 |
| 205 | 3300005548 | Ga0070665_100397754 | Ga0070665_1003977542 | 120 |
| 206 | 3300005563 | Ga0068855_100450551 | Ga0068855_1004505511 | 120 |
| 207 | 3300005578 | Ga0068854_100653825 | Ga0068854_1006538251 | 120 |
| 208 | 3300005614 | Ga0068856_100032108 | Ga0068856_1000321083 | 120 |
| 209 | 3300005616 | Ga0068852_100017035 | Ga0068852_1000170357 | 120 |
| 210 | 3300005618 | Ga0068864_100411505 | Ga0068864_1004115052 | 120 |
| 211 | 3300005618 | Ga0068864_101800205 | Ga0068864_1018002051 | 120 |
| 212 | 3300005834 | Ga0068851_10531158 | Ga0068851_105311582 | 120 |
| 213 | 3300005844 | Ga0068862_101276709 | Ga0068862_1012767092 | 120 |
| 214 | 3300005985 | Ga0081539_10007269 | Ga0081539_100072698 | 120 |
| 215 | 3300005985 | Ga0081539_10007269 | Ga0081539_100072699 | 120 |
| 216 | 3300006195 | Ga0075366_10033102 | Ga0075366_100331023 | 120 |
| 217 | 3300006237 | Ga0097621_100250700 | Ga0097621_1002507003 | 120 |
| 218 | 3300006237 | Ga0097621_101251275 | Ga0097621_1012512752 | 120 |
| 219 | 3300006881 | Ga0068865_100514312 | Ga0068865_1005143121 | 120 |
| 220 | 3300006931 | Ga0097620_101768376 | Ga0097620_1017683762 | 120 |
| 221 | 3300007265 | Ga0099794_10038729 | Ga0099794_100387293 | 120 |
| 222 | 3300007788 | Ga0099795_10135974 | Ga0099795_101359742 | 120 |
| 223 | 3300009094 | Ga0111539_13370067 | Ga0111539_133700671 | 120 |
| 224 | 3300009098 | Ga0105245_11009185 | Ga0105245_110091852 | 120 |
| 225 | 3300009148 | Ga0105243_11071102 | Ga0105243_110711021 | 120 |
| 226 | 3300009148 | Ga0105243_12344002 | Ga0105243_123440021 | 120 |
| 227 | 3300009174 | Ga0105241_10197162 | Ga0105241_101971622 | 120 |
| 228 | 3300009176 | Ga0105242_11135267 | Ga0105242_111352671 | 120 |
| 229 | 3300009177 | Ga0105248_11315389 | Ga0105248_113153892 | 120 |
| 230 | 3300009545 | Ga0105237_10291541 | Ga0105237_102915412 | 120 |
| 231 | 3300009551 | Ga0105238_10075159 | Ga0105238_100751596 | 120 |
| 232 | 3300010375 | Ga0105239_10131632 | Ga0105239_101316321 | 120 |
| 233 | 3300013100 | Ga0157373_10084305 | Ga0157373_100843053 | 120 |
| 234 | 3300013102 | Ga0157371_10097578 | Ga0157371_100975782 | 120 |
| 235 | 3300013104 | Ga0157370_11610066 | Ga0157370_116100661 | 120 |
| 236 | 3300013105 | Ga0157369_10403074 | Ga0157369_104030742 | 120 |
| 237 | 3300013105 | Ga0157369_10716424 | Ga0157369_107164242 | 120 |
| 238 | 3300013296 | Ga0157374_11394295 | Ga0157374_113942952 | 120 |
| 239 | 3300013306 | Ga0163162_11382211 | Ga0163162_113822112 | 120 |
| 240 | 3300013307 | Ga0157372_10208373 | Ga0157372_102083733 | 120 |
| 241 | 3300013308 | Ga0157375_12055316 | Ga0157375_120553162 | 120 |
| 242 | 3300014497 | Ga0182008_10194541 | Ga0182008_101945412 | 120 |
| 243 | 3300014969 | Ga0157376_11365448 | Ga0157376_113654482 | 120 |
| 244 | 3300017792 | Ga0163161_10549189 | Ga0163161_105491892 | 120 |
| 245 | 3300017792 | Ga0163161_11798935 | Ga0163161_117989351 | 120 |
| 246 | 3300020070 | Ga0206356_11699585 | Ga0206356_116995852 | 120 |
| 247 | 3300025302 | Ga0207426_1018368 | Ga0207426_10183682 | 120 |
| 248 | 3300025302 | Ga0207426_1025300 | Ga0207426_10253003 | 120 |
| 249 | 3300025907 | Ga0207645_10438886 | Ga0207645_104388862 | 120 |
| 250 | 3300025909 | Ga0207705_10280205 | Ga0207705_102802053 | 120 |
| 251 | 3300025910 | Ga0207684_10074149 | Ga0207684_100741495 | 120 |
| 252 | 3300025910 | Ga0207684_10757812 | Ga0207684_107578121 | 120 |
| 253 | 3300025911 | Ga0207654_10115880 | Ga0207654_101158802 | 120 |
| 254 | 3300025912 | Ga0207707_10412585 | Ga0207707_104125852 | 120 |
| 255 | 3300025919 | Ga0207657_10032528 | Ga0207657_100325283 | 120 |
| 256 | 3300025920 | Ga0207649_10074013 | Ga0207649_100740133 | 120 |
| 257 | 3300025921 | Ga0207652_10799580 | Ga0207652_107995801 | 120 |
| 258 | 3300025922 | Ga0207646_10118969 | Ga0207646_101189693 | 120 |
| 259 | 3300025923 | Ga0207681_10965915 | Ga0207681_109659152 | 120 |
| 260 | 3300025924 | Ga0207694_10077736 | Ga0207694_100777364 | 120 |
| 261 | 3300025925 | Ga0207650_10496410 | Ga0207650_104964102 | 120 |
| 262 | 3300025926 | Ga0207659_10448608 | Ga0207659_104486081 | 120 |
| 263 | 3300025926 | Ga0207659_11917187 | Ga0207659_119171871 | 120 |
| 264 | 3300025927 | Ga0207687_10614125 | Ga0207687_106141251 | 120 |
| 265 | 3300025933 | Ga0207706_10495666 | Ga0207706_104956662 | 120 |
| 266 | 3300025937 | Ga0207669_10564968 | Ga0207669_105649682 | 120 |
| 267 | 3300025940 | Ga0207691_10516666 | Ga0207691_105166661 | 120 |
| 268 | 3300025944 | Ga0207661_10156987 | Ga0207661_101569872 | 120 |
| 269 | 3300025945 | Ga0207679_10004810 | Ga0207679_100048106 | 120 |
| 270 | 3300025949 | Ga0207667_10013050 | Ga0207667_100130503 | 120 |
| 271 | 3300025949 | Ga0207667_10215935 | Ga0207667_102159352 | 120 |
| 272 | 3300025960 | Ga0207651_10260975 | Ga0207651_102609752 | 120 |
| 273 | 3300025960 | Ga0207651_11403049 | Ga0207651_114030491 | 120 |
| 274 | 3300025961 | Ga0207712_10565792 | Ga0207712_105657922 | 120 |
| 275 | 3300025981 | Ga0207640_10030671 | Ga0207640_100306712 | 120 |
| 276 | 3300026041 | Ga0207639_10087155 | Ga0207639_100871552 | 120 |
| 277 | 3300026095 | Ga0207676_10945446 | Ga0207676_109454462 | 120 |
| 278 | 3300026116 | Ga0207674_10444399 | Ga0207674_104443991 | 120 |
| 279 | 3300026116 | Ga0207674_11606903 | Ga0207674_116069031 | 120 |
| 280 | 3300026121 | Ga0207683_10032445 | Ga0207683_100324455 | 120 |
| 281 | 3300026142 | Ga0207698_10020207 | Ga0207698_100202076 | 120 |
| 282 | 3300028379 | Ga0268266_10046276 | Ga0268266_100462764 | 120 |
| 283 | 3300028379 | Ga0268266_10062021 | Ga0268266_100620211 | 120 |
| 284 | 3300031344 | Ga0265316_11038050 | Ga0265316_110380502 | 120 |
| 285 | 3300035116 | Ga0373945_0183848 | Ga0373945_0183848_254_646 | 120 |
| 286 | 3300035724 | Ga0373933_0037220 | Ga0373933_0037220_513_881 | 120 |
| 287 | 3300037312 | Ga0395899_0012179 | Ga0395899_0012179_3107_3493 | 120 |
| 288 | 3300037312 | Ga0395899_0052178 | Ga0395899_0052178_491_859 | 120 |
| 289 | 3300037418 | Ga0395900_0008391 | Ga0395900_0008391_6292_6678 | 120 |
| 290 | 3300037418 | Ga0395900_0065930 | Ga0395900_0065930_2209_2601 | 120 |
| 291 | 3300037418 | Ga0395900_0430601 | Ga0395900_0430601_420_788 | 120 |
| 292 | 3300037466 | Ga0395898_0274270 | Ga0395898_0274270_789_1157 | 120 |
| 293 | 3300037466 | Ga0395898_0438366 | Ga0395898_0438366_704_1090 | 120 |
| 294 | 3300037466 | Ga0395898_1109199 | Ga0395898_1109199_175_573 | 120 |
| 295 | 3300038443 | Ga0395901_0009503 | Ga0395901_0009503_4479_4871 | 120 |
| 296 | 3300038443 | Ga0395901_0023444 | Ga0395901_0023444_921_1307 | 120 |
| 297 | 3300038443 | Ga0395901_0119637 | Ga0395901_0119637_2347_2715 | 120 |
| 298 | 3300039438 | Ga0436360_0975466 | Ga0436360_0975466_2388_2759 | 120 |
| 299 | 3300039447 | Ga0436361_0014907 | Ga0436361_0014907_262_654 | 120 |
| 300 | 3300041413 | Ga0439465_0060951 | Ga0439465_0060951_25_414 | 120 |
| 301 | 3300041512 | Ga0451853_2895774 | Ga0451853_2895774_155_544 | 120 |
| 302 | 3300042005 | Ga0439448_0154950 | Ga0439448_0154950_136_528 | 120 |
| 303 | 3300044694 | Ga0466963_0074175 | Ga0466963_0074175_777_1145 | 120 |
| 304 | 3300044706 | Ga0466964_0146518 | Ga0466964_0146518_667_1035 | 120 |
| 305 | 3300044842 | Ga0466957_0037751 | Ga0466957_0037751_1539_1907 | 120 |
| 306 | 3300045049 | Ga0466959_1091208 | Ga0466959_1091208_127_495 | 120 |
| 307 | 3300045976 | Ga0466967_0004686 | Ga0466967_0004686_8664_9032 | 120 |
| 308 | 3300046455 | Ga0495603_0651368 | Ga0495603_0651368_34_405 | 120 |
| 309 | 3300048915 | Ga0496112_0811236 | Ga0496112_0811236_237_629 | 120 |
| 310 | 3300048916 | Ga0496113_1275714 | Ga0496113_1275714_145_537 | 120 |
| 311 | 3300048929 | Ga0496126_0108897 | Ga0496126_0108897_711_1082 | 120 |
| 312 | 3300049571 | Ga0501034_0002101 | Ga0501034_0002101_19531_19899 | 120 |
| 313 | 3300049573 | Ga0501037_0256152 | Ga0501037_0256152_49_441 | 120 |
| 314 | 3300049586 | Ga0501070_0768577 | Ga0501070_0768577_46_414 | 120 |
| 315 | 3300049823 | Ga0501044_0052459 | Ga0501044_0052459_3491_3859 | 120 |
| 316 | 3300050489 | nmdc:mga03683_90122_c1 | nmdc:mga03683_90122_c1_566_955 | 120 |
| 317 | 3300050493 | nmdc:mga0k408_13238_c1 | nmdc:mga0k408_13238_c1_884_1273 | 120 |
| 318 | 3300050511 | nmdc:mga08y16_226094_c1 | nmdc:mga08y16_226094_c1_340_708 | 120 |
| 319 | 3300053096 | Ga0500641_0002888 | Ga0500641_0002888_1466_1855 | 120 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar