F405182

General Info

Members Datasets Scaffolds Average Seq Length
319 228 319 122

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1270533|Ga0451793_1270533_216_596
Length 126
Sequence VSFTSRLILDSNRIHPAIHEELANYQRALLARVETLVDAHDVVILGMAINPFPGRARRLLDERGIRYEYLGIGSYFSQWRVRLALKLWTGWPTFPMVFVKRKLIGGFADLKRLADNGELTRLLAGD

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
59 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
60 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 1.57
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1002286 3300003771 Bacteria 13078
2 Ga0055537_1000012 3300003773 Bacteria 133761
3 Ga0055534_1000282 3300003784 Bacteria 34605
4 Ga0055528_1000073 3300003790 Bacteria 77054
5 Ga0065707_10027983 3300005295 Bacteria 1119
6 Ga0070666_11069222 3300005335 Bacteria 599
7 Ga0070680_101143257 3300005336 Bacteria 673
8 Ga0070680_101390048 3300005336 Unclassified 608
9 Ga0070680_101761269 3300005336 Bacteria 537
10 Ga0070689_100903253 3300005340 Unclassified 782
11 Ga0070691_10216228 3300005341 Bacteria 1013
12 Ga0070692_10424561 3300005345 Bacteria 845
13 Ga0070671_100391092 3300005355 Bacteria 1189
14 Ga0070674_100507210 3300005356 Bacteria 1006
15 Ga0070688_101436029 3300005365 Bacteria 560
16 Ga0070667_100035617 3300005367 Bacteria 4171
17 Ga0070667_100066324 3300005367 Bacteria 3067
18 Ga0070700_100129018 3300005441 Bacteria 1704
19 Ga0070694_100038094 3300005444 Unclassified 3193
20 Ga0070694_100366964 3300005444 Bacteria 1119
21 Ga0070678_100157499 3300005456 Bacteria 1836
22 Ga0068867_100011370 3300005459 Bacteria 6280
23 Ga0070697_100370817 3300005536 Bacteria 1239
24 Ga0068853_100037685 3300005539 Bacteria 4114
25 Ga0070695_101726901 3300005545 Bacteria 524
26 Ga0070696_100007814 3300005546 Bacteria 7140
27 Ga0070696_100602198 3300005546 Bacteria 886
28 Ga0070665_100389152 3300005548 Bacteria 1402
29 Ga0070665_102031617 3300005548 Unclassified 580
30 Ga0070704_100106973 3300005549 Bacteria 2121
31 Ga0068854_101170471 3300005578 Bacteria 688
32 Ga0068856_100452630 3300005614 Bacteria 1305
33 Ga0070702_100896313 3300005615 Bacteria 694
34 Ga0068852_100247632 3300005616 Bacteria 1706
35 Ga0068859_101659730 3300005617 Bacteria 706
36 Ga0068864_100267315 3300005618 Bacteria 1592
37 Ga0068870_10493929 3300005840 Bacteria 815
38 Ga0068858_100011569 3300005842 Bacteria 8324
39 Ga0068858_101149738 3300005842 Bacteria 763
40 Ga0068858_101908505 3300005842 Bacteria 587
41 Ga0068860_100279344 3300005843 Bacteria 1631
42 Ga0068860_101081898 3300005843 Bacteria 821
43 Ga0068862_100629970 3300005844 Bacteria 1032
44 Ga0081539_10321957 3300005985 Bacteria 657
45 Ga0070715_10415974 3300006163 Bacteria 751
46 Ga0070716_100129339 3300006173 Bacteria 1594
47 Ga0075433_10317086 3300006852 Bacteria 1379
48 Ga0075433_10335701 3300006852 Bacteria 1336
49 Ga0075429_100213890 3300006880 Bacteria 1689
50 Ga0075429_100955318 3300006880 Bacteria 749
51 Ga0068865_100718148 3300006881 Bacteria 855
52 Ga0068865_100979286 3300006881 Unclassified 739
53 Ga0075436_100123710 3300006914 Bacteria 1811
54 Ga0075436_100158181 3300006914 Unclassified 1597
55 Ga0097620_101659760 3300006931 Bacteria 706
56 Ga0075435_100047856 3300007076 Bacteria 3434
57 Ga0075435_100796907 3300007076 Bacteria 823
58 Ga0099794_10051795 3300007265 Bacteria 1978
59 Ga0099794_10109190 3300007265 Bacteria 1385
60 Ga0099794_10186616 3300007265 Bacteria 1059
61 Ga0099795_10045841 3300007788 Bacteria 1573
62 Ga0099795_10067550 3300007788 Bacteria 1342
63 Ga0105240_10004318 3300009093 Bacteria 21701
64 Ga0105240_12515006 3300009093 Bacteria 532
65 Ga0111539_13049232 3300009094 Bacteria 541
66 Ga0105247_10208716 3300009101 Bacteria 1316
67 Ga0114129_10797515 3300009147 Bacteria 1205
68 Ga0105243_11184614 3300009148 Bacteria 776
69 Ga0105241_10169799 3300009174 Bacteria 1801
70 Ga0105241_11524730 3300009174 Bacteria 644
71 Ga0105248_10940238 3300009177 Bacteria 976
72 Ga0105248_11607224 3300009177 Unclassified 736
73 Ga0105237_10000080 3300009545 Bacteria 127788
74 Ga0105238_10002573 3300009551 Bacteria 18101
75 Ga0105249_10956727 3300009553 Bacteria 924
76 Ga0099796_10126493 3300010159 Bacteria 987
77 Ga0099796_10351718 3300010159 Bacteria 635
78 Ga0105239_10000116 3300010375 Bacteria 112811
79 Ga0105239_11096654 3300010375 Bacteria 916
80 Ga0157323_1024361 3300012495 Unclassified 600
81 Ga0157313_1007977 3300012503 Bacteria 839
82 Ga0157338_1006956 3300012515 Bacteria 1060
83 Ga0157378_10705834 3300013297 Bacteria 1028
84 Ga0163162_10652458 3300013306 Bacteria 1176
85 Ga0163163_10013678 3300014325 Bacteria 7434
86 Ga0157377_10773355 3300014745 Bacteria 705
87 Ga0157379_10007873 3300014968 Bacteria 9233
88 Ga0157379_10621204 3300014968 Bacteria 1010
89 Ga0213872_10000028 3300021361 Bacteria 148766
90 Ga0213872_10031397 3300021361 Bacteria 2435
91 Ga0209436_115776 3300025208 Bacteria 1155
92 Ga0209565_1000057 3300025263 Bacteria 196908
93 Ga0209673_1000051 3300025273 Bacteria 282161
94 Ga0209130_1000268 3300025284 Bacteria 65115
95 Ga0209675_1000027 3300025291 Bacteria 282175
96 Ga0209564_1000094 3300025295 Bacteria 243176
97 Ga0209256_1000139 3300025299 Bacteria 155515
98 Ga0207642_10120916 3300025899 Bacteria 1350
99 Ga0207685_10158140 3300025905 Bacteria 1032
100 Ga0207654_10346145 3300025911 Bacteria 1022
101 Ga0207695_10004216 3300025913 Bacteria 19757
102 Ga0207671_10003680 3300025914 Bacteria 15115
103 Ga0207662_10107291 3300025918 Bacteria 1738
104 Ga0207694_10048192 3300025924 Bacteria 3296
105 Ga0207686_10524596 3300025934 Bacteria 922
106 Ga0207670_10230492 3300025936 Bacteria 1422
107 Ga0207670_10835993 3300025936 Bacteria 769
108 Ga0207669_10064364 3300025937 Bacteria 2269
109 Ga0207665_10020935 3300025939 Bacteria 4298
110 Ga0207711_10999192 3300025941 Bacteria 776
111 Ga0207689_10194841 3300025942 Bacteria 1672
112 Ga0207651_10485467 3300025960 Bacteria 1066
113 Ga0207712_10198479 3300025961 Bacteria 1589
114 Ga0207668_11151175 3300025972 Bacteria 696
115 Ga0207658_10024644 3300025986 Bacteria 4211
116 Ga0207658_10875280 3300025986 Bacteria 817
117 Ga0207677_10580406 3300026023 Bacteria 981
118 Ga0207703_10317953 3300026035 Bacteria 1425
119 Ga0207639_10031327 3300026041 Bacteria 3908
120 Ga0207639_10440314 3300026041 Bacteria 1181
121 Ga0207708_10135259 3300026075 Bacteria 1930
122 Ga0207702_10279184 3300026078 Bacteria 1578
123 Ga0207641_10509363 3300026088 Bacteria 1170
124 Ga0207648_10090816 3300026089 Unclassified 2669
125 Ga0207648_10169154 3300026089 Bacteria 1932
126 Ga0207648_10247673 3300026089 Unclassified 1588
127 Ga0207676_10377454 3300026095 Bacteria 1319
128 Ga0207676_10563799 3300026095 Bacteria 1090
129 Ga0207683_10100792 3300026121 Bacteria 2578
130 Ga0207698_10405051 3300026142 Bacteria 1305
131 Ga0209969_1046387 3300027360 Bacteria 678
132 Ga0209588_1113214 3300027671 Bacteria 871
133 Ga0207428_10480948 3300027907 Bacteria 903
134 Ga0207428_10520731 3300027907 Bacteria 862
135 Ga0268266_10215674 3300028379 Bacteria 1762
136 Ga0268266_11002408 3300028379 Unclassified 808
137 Ga0307509_10295090 3300031507 Bacteria 1373
138 Ga0307408_100218470 3300031548 Bacteria 1554
139 Ga0307508_10912012 3300031616 Bacteria 506
140 Ga0316575_10024608 3300031665 Bacteria 2332
141 Ga0307416_100257471 3300032002 Bacteria 1703
142 Ga0307507_10108601 3300033179 Bacteria 2280
143 Ga0373938_0035443 3300034957 Bacteria 1088
144 Ga0373926_0155175 3300035083 Unclassified 872
145 Ga0373929_0018480 3300035085 Bacteria 1386
146 Ga0373934_0338587 3300035086 Bacteria 626
147 Ga0373944_0070404 3300035089 Unclassified 1138
148 Ga0373923_0286773 3300035111 Unclassified 777
149 Ga0373939_0167108 3300035114 Bacteria 812
150 Ga0373941_0172549 3300035115 Bacteria 807
151 Ga0373942_0076523 3300035207 Bacteria 986
152 Ga0316574_0010763 3300035398 Bacteria 5179
153 Ga0373947_0059484 3300035725 Bacteria 2316
154 Ga0373937_0173573 3300036401 Bacteria 2023
155 Ga0373925_0184660 3300037068 Bacteria 1652
156 Ga0395900_0003329 3300037418 Bacteria 17369
157 Ga0395898_0002666 3300037466 Bacteria 20695
158 Ga0436360_0175990 3300039438 Bacteria 1033
159 Ga0436361_0139067 3300039447 Bacteria 3043
160 Ga0436361_0420505 3300039447 Bacteria 103715
161 Ga0451793_1270533 3300041452 Bacteria 619
162 Ga0451802_0570461 3300041460 Unclassified 2163
163 Ga0439446_0070662 3300042156 Bacteria 1068
164 Ga0451577_0135819 3300042876 Bacteria 2209
165 Ga0451576_0216789 3300045051 Bacteria 1998
166 Ga0451576_0438669 3300045051 Bacteria 1370
167 Ga0495617_002096 3300046452 Bacteria 8236
168 Ga0495617_077450 3300046452 Bacteria 1090
169 Ga0495617_087360 3300046452 Bacteria 1019
170 Ga0495627_000008 3300046453 Bacteria 572150
171 Ga0495592_0340020 3300046454 Bacteria 965
172 Ga0495651_0235363 3300046462 Bacteria 1259
173 Ga0495580_0221995 3300046472 Bacteria 1298
174 Ga0495605_0046623 3300046474 Bacteria 2129
175 Ga0495662_0064278 3300046476 Bacteria 1773
176 Ga0495584_0000148 3300046491 Bacteria 48720
177 Ga0495584_0000679 3300046491 Bacteria 22629
178 Ga0495584_0076068 3300046491 Bacteria 1688
179 Ga0495585_0000023 3300046492 Bacteria 149218
180 Ga0495585_0000924 3300046492 Bacteria 24870
181 Ga0495585_0006359 3300046492 Bacteria 7337
182 Ga0495585_0021885 3300046492 Bacteria 3670
183 Ga0495585_0081750 3300046492 Bacteria 1750
184 Ga0495585_0110988 3300046492 Bacteria 1458
185 Ga0495596_0008225 3300046500 Bacteria 4651
186 Ga0495607_0018708 3300046501 Bacteria 4408
187 Ga0495607_0042491 3300046501 Bacteria 2693
188 Ga0495607_0042554 3300046501 Bacteria 2691
189 Ga0495607_0045783 3300046501 Bacteria 2571
190 Ga0495583_0000035 3300046506 Bacteria 246849
191 Ga0495606_0000793 3300046507 Bacteria 48266
192 Ga0495606_0046023 3300046507 Bacteria 2886
193 Ga0495606_0290367 3300046507 Bacteria 890
194 Ga0495610_0012311 3300046512 Bacteria 5159
195 Ga0495616_0001830 3300046513 Bacteria 14406
196 Ga0495616_0003950 3300046513 Bacteria 9442
197 Ga0495616_0027534 3300046513 Bacteria 3015
198 Ga0495616_0034346 3300046513 Bacteria 2634
199 Ga0495630_0161638 3300046517 Bacteria 1705
200 Ga0495643_0024065 3300046522 Bacteria 3457
201 Ga0495644_0001693 3300046523 Bacteria 8944
202 Ga0495644_0002536 3300046523 Bacteria 7275
203 Ga0495644_0008887 3300046523 Bacteria 3864
204 Ga0495644_0161453 3300046523 Bacteria 859
205 Ga0495648_0000048 3300046524 Bacteria 164840
206 Ga0495648_0007552 3300046524 Bacteria 8690
207 Ga0495648_0212396 3300046524 Bacteria 960
208 Ga0495666_0027344 3300046526 Bacteria 2808
209 Ga0495652_0225985 3300046529 Bacteria 1403
210 Ga0495586_0013285 3300046535 Bacteria 4365
211 Ga0495587_0247952 3300046536 Bacteria 1001
212 Ga0495587_0704329 3300046536 Unclassified 553
213 Ga0495609_0000779 3300046538 Bacteria 23876
214 Ga0495609_0002881 3300046538 Bacteria 10267
215 Ga0495609_0026683 3300046538 Bacteria 2643
216 Ga0495609_0117984 3300046538 Bacteria 1142
217 Ga0495622_0067591 3300046557 Bacteria 1651
218 Ga0495633_0000464 3300046558 Bacteria 41549
219 Ga0495633_0002941 3300046558 Bacteria 11656
220 Ga0495633_0006027 3300046558 Bacteria 7274
221 Ga0495656_0090036 3300046615 Bacteria 1401
222 Ga0495668_0000048 3300046616 Bacteria 217867
223 Ga0495611_0012291 3300046648 Bacteria 3640
224 Ga0495625_0038313 3300046660 Bacteria 3510
225 Ga0495625_0130266 3300046660 Bacteria 1704
226 Ga0495659_0000713 3300046664 Bacteria 11971
227 Ga0495661_0070125 3300046665 Bacteria 2052
228 Ga0495661_0072654 3300046665 Bacteria 2006
229 Ga0495661_0265405 3300046665 Bacteria 870
230 Ga0495588_0629526 3300046674 Unclassified 562
231 Ga0495646_0319634 3300046680 Bacteria 818
232 Ga0495647_0034907 3300046681 Bacteria 1886
233 Ga0495670_0000138 3300046691 Bacteria 31679
234 Ga0495670_0009318 3300046691 Bacteria 4832
235 Ga0495670_0081070 3300046691 Bacteria 1653
236 Ga0495671_0017062 3300046692 Bacteria 3866
237 Ga0495671_0470028 3300046692 Bacteria 600
238 Ga0495589_0442340 3300046794 Unclassified 595
239 Ga0495660_0411931 3300046810 Bacteria 590
240 Ga0495604_0285203 3300047317 Bacteria 1114
241 Ga0495636_0002263 3300047318 Bacteria 7393
242 Ga0495636_0442414 3300047318 Bacteria 623
243 Ga0495674_0137856 3300047319 Bacteria 2052
244 Ga0495672_0014739 3300047320 Bacteria 5335
245 Ga0495683_0000036 3300047323 Bacteria 144974
246 Ga0495683_0000932 3300047323 Bacteria 20627
247 Ga0495683_0073654 3300047323 Bacteria 1674
248 Ga0495683_0076636 3300047323 Bacteria 1636
249 Ga0495687_003311 3300047443 Bacteria 11815
250 Ga0495677_0005761 3300047445 Bacteria 4692
251 Ga0495677_0014048 3300047445 Bacteria 2915
252 Ga0495685_000019 3300047447 Bacteria 73831
253 Ga0495673_0009679 3300047469 Bacteria 5312
254 Ga0495673_0086928 3300047469 Bacteria 1284
255 Ga0495681_0034083 3300047470 Bacteria 2540
256 Ga0495681_0261938 3300047470 Bacteria 679
257 Ga0495686_0002763 3300047472 Bacteria 16021
258 Ga0495686_0184937 3300047472 Bacteria 1205
259 Ga0496100_0179799 3300048903 Bacteria 1529
260 Ga0496101_0557428 3300048904 Bacteria 906
261 Ga0496110_1591514 3300048913 Bacteria 563
262 Ga0496122_0525868 3300048925 Bacteria 569
263 Ga0496124_0002551 3300048927 Bacteria 23634
264 Ga0496124_0271038 3300048927 Bacteria 1243
265 Ga0496125_0004595 3300048928 Bacteria 15780
266 Ga0496125_0130327 3300048928 Bacteria 1772
267 Ga0496126_1372543 3300048929 Unclassified 511
268 Ga0495678_006169 3300049459 Bacteria 6425
269 Ga0495682_0000094 3300049460 Bacteria 78278
270 Ga0495682_0003862 3300049460 Bacteria 6567
271 Ga0495682_0121729 3300049460 Bacteria 934
272 Ga0501031_0021692 3300049568 Bacteria 4186
273 Ga0501032_0146814 3300049569 Bacteria 1552
274 Ga0501033_0011398 3300049570 Bacteria 6805
275 Ga0501034_0594912 3300049571 Bacteria 1012
276 Ga0501036_0001905 3300049572 Bacteria 16237
277 Ga0501037_0021395 3300049573 Bacteria 4779
278 Ga0501038_0005646 3300049574 Bacteria 11608
279 Ga0501039_0019782 3300049575 Bacteria 5161
280 Ga0501039_0769894 3300049575 Bacteria 751
281 Ga0501040_0008422 3300049576 Bacteria 6700
282 Ga0501041_0003813 3300049577 Bacteria 8681
283 Ga0501041_0302887 3300049577 Bacteria 1007
284 Ga0501042_0014757 3300049578 Bacteria 5334
285 Ga0501043_0260276 3300049579 Bacteria 1334
286 Ga0501046_0018754 3300049580 Bacteria 5749
287 Ga0501048_0002785 3300049582 Bacteria 13353
288 Ga0501048_0534061 3300049582 Bacteria 841
289 Ga0501068_0022043 3300049584 Bacteria 3722
290 Ga0501071_0162546 3300049587 Bacteria 1669
291 Ga0501072_0010617 3300049588 Bacteria 7014
292 Ga0501073_0074774 3300049589 Bacteria 2359
293 Ga0501074_0010002 3300049590 Bacteria 6885
294 Ga0501075_0002709 3300049591 Bacteria 11846
295 Ga0501076_0018027 3300049592 Bacteria 5372
296 Ga0501076_0087288 3300049592 Bacteria 2508
297 Ga0501077_0011733 3300049593 Bacteria 5477
298 Ga0501238_009411 3300049671 Bacteria 1296
299 Ga0501079_0006336 3300049741 Bacteria 8880
300 Ga0501080_0044913 3300049742 Bacteria 4112
301 Ga0501081_0002160 3300049743 Bacteria 12334
302 Ga0501081_0144531 3300049743 Bacteria 1706
303 Ga0501035_0107021 3300049822 Bacteria 2451
304 Ga0501044_0426893 3300049823 Bacteria 1235
305 Ga0501045_0011234 3300049824 Bacteria 6282
306 Ga0501045_0605135 3300049824 Bacteria 811
307 nmdc:mga08y16_1057905_c1 3300050511 Bacteria 789
308 nmdc:mga08y16_1427406_c1 3300050511 Bacteria 655
309 nmdc:mga0rr50_293555_c1 3300050513 Bacteria 1359
310 nmdc:mga08x19_338686_c1 3300050514 Bacteria 1049
311 nmdc:mga0a205_260901_c1 3300050515 Bacteria 1610
312 nmdc:mga0a205_338302_c1 3300050515 Bacteria 1374
313 nmdc:mga0a205_813221_c1 3300050515 Bacteria 782
314 Ga0500637_0442158 3300053178 Unclassified 662
315 Ga0501084_0002024 3300054114 Bacteria 16187
316 Ga0501084_0945992 3300054114 Bacteria 724
317 Ga0501082_0005383 3300060353 Bacteria 11107
318 Ga0501082_1710847 3300060353 Bacteria 549
319 Ga0530510_0007843 3300061734 Bacteria 7444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_101436029 Ga0070688_1014360292 116
2 3300005618 Ga0068864_100267315 Ga0068864_1002673153 116
3 3300006880 Ga0075429_100213890 Ga0075429_1002138902 116
4 3300007076 Ga0075435_100796907 Ga0075435_1007969071 116
5 3300025936 Ga0207670_10835993 Ga0207670_108359932 116
6 3300027907 Ga0207428_10480948 Ga0207428_104809482 116
7 3300046476 Ga0495662_0064278 Ga0495662_0064278_734_1084 116
8 3300046517 Ga0495630_0161638 Ga0495630_0161638_712_1062 116
9 3300046535 Ga0495586_0013285 Ga0495586_0013285_2349_2699 116
10 3300046536 Ga0495587_0704329 Ga0495587_0704329_174_524 116
11 3300046680 Ga0495646_0319634 Ga0495646_0319634_412_762 116
12 3300047319 Ga0495674_0137856 Ga0495674_0137856_502_852 116
13 3300050511 nmdc:mga08y16_1427406_c1 nmdc:mga08y16_1427406_c1_204_554 116
14 3300050515 nmdc:mga0a205_813221_c1 nmdc:mga0a205_813221_c1_228_578 116
15 3300005336 Ga0070680_101143257 Ga0070680_1011432571 117
16 3300005336 Ga0070680_101761269 Ga0070680_1017612691 117
17 3300005444 Ga0070694_100366964 Ga0070694_1003669643 117
18 3300005615 Ga0070702_100896313 Ga0070702_1008963132 117
19 3300005985 Ga0081539_10321957 Ga0081539_103219571 117
20 3300009094 Ga0111539_13049232 Ga0111539_130492322 117
21 3300026095 Ga0207676_10377454 Ga0207676_103774542 117
22 3300027360 Ga0209969_1046387 Ga0209969_10463872 117
23 3300031548 Ga0307408_100218470 Ga0307408_1002184702 117
24 3300032002 Ga0307416_100257471 Ga0307416_1002574712 117
25 3300035114 Ga0373939_0167108 Ga0373939_0167108_297_650 117
26 3300042156 Ga0439446_0070662 Ga0439446_0070662_687_1040 117
27 3300045051 Ga0451576_0438669 Ga0451576_0438669_81_434 117
28 3300046616 Ga0495668_0000048 Ga0495668_0000048_28962_29315 117
29 3300047318 Ga0495636_0442414 Ga0495636_0442414_17_370 117
30 3300047472 Ga0495686_0002763 Ga0495686_0002763_15084_15437 117
31 3300005345 Ga0070692_10424561 Ga0070692_104245612 118
32 3300007788 Ga0099795_10045841 Ga0099795_100458413 118
33 3300014325 Ga0163163_10013678 Ga0163163_100136782 118
34 3300031616 Ga0307508_10912012 Ga0307508_109120122 118
35 3300035086 Ga0373934_0338587 Ga0373934_0338587_82_438 118
36 3300039438 Ga0436360_0175990 Ga0436360_0175990_655_1011 118
37 3300046454 Ga0495592_0340020 Ga0495592_0340020_465_821 118
38 3300046462 Ga0495651_0235363 Ga0495651_0235363_207_563 118
39 3300046529 Ga0495652_0225985 Ga0495652_0225985_816_1172 118
40 3300046536 Ga0495587_0247952 Ga0495587_0247952_127_483 118
41 3300047317 Ga0495604_0285203 Ga0495604_0285203_121_477 118
42 3300049568 Ga0501031_0021692 Ga0501031_0021692_2091_2447 118
43 3300049569 Ga0501032_0146814 Ga0501032_0146814_419_775 118
44 3300049570 Ga0501033_0011398 Ga0501033_0011398_314_670 118
45 3300049571 Ga0501034_0594912 Ga0501034_0594912_74_430 118
46 3300049572 Ga0501036_0001905 Ga0501036_0001905_11563_11919 118
47 3300049573 Ga0501037_0021395 Ga0501037_0021395_1279_1635 118
48 3300049574 Ga0501038_0005646 Ga0501038_0005646_3968_4324 118
49 3300049575 Ga0501039_0019782 Ga0501039_0019782_4098_4454 118
50 3300049576 Ga0501040_0008422 Ga0501040_0008422_5802_6158 118
51 3300049577 Ga0501041_0003813 Ga0501041_0003813_4411_4767 118
52 3300049578 Ga0501042_0014757 Ga0501042_0014757_4234_4590 118
53 3300049579 Ga0501043_0260276 Ga0501043_0260276_902_1258 118
54 3300049580 Ga0501046_0018754 Ga0501046_0018754_2906_3262 118
55 3300049582 Ga0501048_0002785 Ga0501048_0002785_8457_8813 118
56 3300049584 Ga0501068_0022043 Ga0501068_0022043_1056_1412 118
57 3300049587 Ga0501071_0162546 Ga0501071_0162546_1006_1362 118
58 3300049588 Ga0501072_0010617 Ga0501072_0010617_2693_3049 118
59 3300049589 Ga0501073_0074774 Ga0501073_0074774_279_635 118
60 3300049590 Ga0501074_0010002 Ga0501074_0010002_1246_1602 118
61 3300049591 Ga0501075_0002709 Ga0501075_0002709_2664_3020 118
62 3300049592 Ga0501076_0018027 Ga0501076_0018027_3130_3486 118
63 3300049593 Ga0501077_0011733 Ga0501077_0011733_556_912 118
64 3300049741 Ga0501079_0006336 Ga0501079_0006336_3214_3570 118
65 3300049742 Ga0501080_0044913 Ga0501080_0044913_3185_3541 118
66 3300049743 Ga0501081_0002160 Ga0501081_0002160_4573_4929 118
67 3300049822 Ga0501035_0107021 Ga0501035_0107021_474_830 118
68 3300049823 Ga0501044_0426893 Ga0501044_0426893_724_1080 118
69 3300049824 Ga0501045_0011234 Ga0501045_0011234_4313_4669 118
70 3300054114 Ga0501084_0002024 Ga0501084_0002024_353_709 118
71 3300060353 Ga0501082_0005383 Ga0501082_0005383_3433_3789 118
72 3300061734 Ga0530510_0007843 Ga0530510_0007843_3882_4238 118
73 3300005336 Ga0070680_101390048 Ga0070680_1013900481 119
74 3300005441 Ga0070700_100129018 Ga0070700_1001290182 119
75 3300005444 Ga0070694_100038094 Ga0070694_1000380942 119
76 3300005545 Ga0070695_101726901 Ga0070695_1017269011 119
77 3300046491 Ga0495584_0000148 Ga0495584_0000148_40083_40442 119
78 3300046492 Ga0495585_0000924 Ga0495585_0000924_20029_20388 119
79 3300046500 Ga0495596_0008225 Ga0495596_0008225_1457_1816 119
80 3300046507 Ga0495606_0290367 Ga0495606_0290367_302_661 119
81 3300046513 Ga0495616_0003950 Ga0495616_0003950_8971_9330 119
82 3300046538 Ga0495609_0117984 Ga0495609_0117984_675_1034 119
83 3300046558 Ga0495633_0000464 Ga0495633_0000464_19599_19958 119
84 3300046691 Ga0495670_0081070 Ga0495670_0081070_53_412 119
85 3300047323 Ga0495683_0000036 Ga0495683_0000036_58364_58723 119
86 3300049460 Ga0495682_0121729 Ga0495682_0121729_506_865 119
87 3300005295 Ga0065707_10027983 Ga0065707_100279831 120
88 3300005340 Ga0070689_100903253 Ga0070689_1009032531 120
89 3300005341 Ga0070691_10216228 Ga0070691_102162282 120
90 3300005355 Ga0070671_100391092 Ga0070671_1003910922 120
91 3300005536 Ga0070697_100370817 Ga0070697_1003708172 120
92 3300005546 Ga0070696_100007814 Ga0070696_1000078144 120
93 3300005546 Ga0070696_100602198 Ga0070696_1006021982 120
94 3300005549 Ga0070704_100106973 Ga0070704_1001069731 120
95 3300005578 Ga0068854_101170471 Ga0068854_1011704712 120
96 3300005614 Ga0068856_100452630 Ga0068856_1004526301 120
97 3300005840 Ga0068870_10493929 Ga0068870_104939292 120
98 3300005842 Ga0068858_101149738 Ga0068858_1011497382 120
99 3300005843 Ga0068860_100279344 Ga0068860_1002793442 120
100 3300005844 Ga0068862_100629970 Ga0068862_1006299702 120
101 3300006163 Ga0070715_10415974 Ga0070715_104159742 120
102 3300006173 Ga0070716_100129339 Ga0070716_1001293394 120
103 3300006852 Ga0075433_10317086 Ga0075433_103170862 120
104 3300006880 Ga0075429_100955318 Ga0075429_1009553182 120
105 3300006881 Ga0068865_100979286 Ga0068865_1009792861 120
106 3300006914 Ga0075436_100123710 Ga0075436_1001237102 120
107 3300006914 Ga0075436_100158181 Ga0075436_1001581813 120
108 3300007265 Ga0099794_10109190 Ga0099794_101091903 120
109 3300007265 Ga0099794_10186616 Ga0099794_101866162 120
110 3300007788 Ga0099795_10067550 Ga0099795_100675503 120
111 3300009093 Ga0105240_12515006 Ga0105240_125150062 120
112 3300009147 Ga0114129_10797515 Ga0114129_107975152 120
113 3300009148 Ga0105243_11184614 Ga0105243_111846142 120
114 3300009174 Ga0105241_11524730 Ga0105241_115247302 120
115 3300009177 Ga0105248_11607224 Ga0105248_116072242 120
116 3300009553 Ga0105249_10956727 Ga0105249_109567271 120
117 3300010159 Ga0099796_10126493 Ga0099796_101264932 120
118 3300010159 Ga0099796_10351718 Ga0099796_103517182 120
119 3300010375 Ga0105239_11096654 Ga0105239_110966542 120
120 3300012495 Ga0157323_1024361 Ga0157323_10243611 120
121 3300012503 Ga0157313_1007977 Ga0157313_10079772 120
122 3300012515 Ga0157338_1006956 Ga0157338_10069562 120
123 3300013306 Ga0163162_10652458 Ga0163162_106524582 120
124 3300014745 Ga0157377_10773355 Ga0157377_107733551 120
125 3300014968 Ga0157379_10621204 Ga0157379_106212042 120
126 3300025899 Ga0207642_10120916 Ga0207642_101209163 120
127 3300025905 Ga0207685_10158140 Ga0207685_101581402 120
128 3300025911 Ga0207654_10346145 Ga0207654_103461451 120
129 3300025918 Ga0207662_10107291 Ga0207662_101072912 120
130 3300025934 Ga0207686_10524596 Ga0207686_105245962 120
131 3300025936 Ga0207670_10230492 Ga0207670_102304922 120
132 3300025939 Ga0207665_10020935 Ga0207665_100209351 120
133 3300025942 Ga0207689_10194841 Ga0207689_101948413 120
134 3300025960 Ga0207651_10485467 Ga0207651_104854672 120
135 3300025961 Ga0207712_10198479 Ga0207712_101984793 120
136 3300026023 Ga0207677_10580406 Ga0207677_105804062 120
137 3300026041 Ga0207639_10440314 Ga0207639_104403142 120
138 3300026075 Ga0207708_10135259 Ga0207708_101352592 120
139 3300026078 Ga0207702_10279184 Ga0207702_102791842 120
140 3300026088 Ga0207641_10509363 Ga0207641_105093632 120
141 3300026089 Ga0207648_10169154 Ga0207648_101691543 120
142 3300026095 Ga0207676_10563799 Ga0207676_105637991 120
143 3300027671 Ga0209588_1113214 Ga0209588_11132142 120
144 3300027907 Ga0207428_10520731 Ga0207428_105207311 120
145 3300031665 Ga0316575_10024608 Ga0316575_100246083 120
146 3300034957 Ga0373938_0035443 Ga0373938_0035443_23_385 120
147 3300035083 Ga0373926_0155175 Ga0373926_0155175_105_467 120
148 3300035085 Ga0373929_0018480 Ga0373929_0018480_159_521 120
149 3300035089 Ga0373944_0070404 Ga0373944_0070404_519_881 120
150 3300035111 Ga0373923_0286773 Ga0373923_0286773_141_503 120
151 3300035115 Ga0373941_0172549 Ga0373941_0172549_384_746 120
152 3300035207 Ga0373942_0076523 Ga0373942_0076523_602_964 120
153 3300035398 Ga0316574_0010763 Ga0316574_0010763_1728_2090 120
154 3300035725 Ga0373947_0059484 Ga0373947_0059484_448_810 120
155 3300036401 Ga0373937_0173573 Ga0373937_0173573_1476_1838 120
156 3300037068 Ga0373925_0184660 Ga0373925_0184660_1185_1547 120
157 3300042876 Ga0451577_0135819 Ga0451577_0135819_624_986 120
158 3300045051 Ga0451576_0216789 Ga0451576_0216789_920_1282 120
159 3300046472 Ga0495580_0221995 Ga0495580_0221995_521_883 120
160 3300046526 Ga0495666_0027344 Ga0495666_0027344_1873_2235 120
161 3300046674 Ga0495588_0629526 Ga0495588_0629526_32_394 120
162 3300046681 Ga0495647_0034907 Ga0495647_0034907_1454_1816 120
163 3300049575 Ga0501039_0769894 Ga0501039_0769894_84_446 120
164 3300049577 Ga0501041_0302887 Ga0501041_0302887_271_633 120
165 3300049582 Ga0501048_0534061 Ga0501048_0534061_206_568 120
166 3300049592 Ga0501076_0087288 Ga0501076_0087288_1157_1519 120
167 3300049743 Ga0501081_0144531 Ga0501081_0144531_1271_1633 120
168 3300049824 Ga0501045_0605135 Ga0501045_0605135_366_728 120
169 3300050511 nmdc:mga08y16_1057905_c1 nmdc:mga08y16_1057905_c1_69_431 120
170 3300050514 nmdc:mga08x19_338686_c1 nmdc:mga08x19_338686_c1_446_808 120
171 3300054114 Ga0501084_0945992 Ga0501084_0945992_331_693 120
172 3300007076 Ga0075435_100047856 Ga0075435_1000478566 121
173 3300007265 Ga0099794_10051795 Ga0099794_100517954 121
174 3300021361 Ga0213872_10031397 Ga0213872_100313972 121
175 3300031507 Ga0307509_10295090 Ga0307509_102950902 121
176 3300033179 Ga0307507_10108601 Ga0307507_101086012 121
177 3300039447 Ga0436361_0139067 Ga0436361_0139067_879_1244 121
178 3300046453 Ga0495627_000008 Ga0495627_000008_487275_487640 121
179 3300046507 Ga0495606_0000793 Ga0495606_0000793_12598_12963 121
180 3300046522 Ga0495643_0024065 Ga0495643_0024065_2761_3126 121
181 3300046523 Ga0495644_0008887 Ga0495644_0008887_2457_2822 121
182 3300046538 Ga0495609_0000779 Ga0495609_0000779_22738_23103 121
183 3300047470 Ga0495681_0034083 Ga0495681_0034083_1688_2053 121
184 3300048925 Ga0496122_0525868 Ga0496122_0525868_46_411 121
185 3300048927 Ga0496124_0002551 Ga0496124_0002551_10527_10892 121
186 3300048927 Ga0496124_0271038 Ga0496124_0271038_443_808 121
187 3300048928 Ga0496125_0004595 Ga0496125_0004595_3584_3949 121
188 3300048929 Ga0496126_1372543 Ga0496126_1372543_11_376 121
189 3300050513 nmdc:mga0rr50_293555_c1 nmdc:mga0rr50_293555_c1_483_878 121
190 3300050515 nmdc:mga0a205_260901_c1 nmdc:mga0a205_260901_c1_878_1273 121
191 3300053178 Ga0500637_0442158 Ga0500637_0442158_236_601 121
192 3300060353 Ga0501082_1710847 Ga0501082_1710847_97_465 121
193 3300005356 Ga0070674_100507210 Ga0070674_1005072102 122
194 3300005456 Ga0070678_100157499 Ga0070678_1001574991 122
195 3300005539 Ga0068853_100037685 Ga0068853_1000376852 122
196 3300005548 Ga0070665_100389152 Ga0070665_1003891521 122
197 3300005548 Ga0070665_102031617 Ga0070665_1020316172 122
198 3300005616 Ga0068852_100247632 Ga0068852_1002476322 122
199 3300006852 Ga0075433_10335701 Ga0075433_103357012 122
200 3300009093 Ga0105240_10004318 Ga0105240_100043187 122
201 3300009174 Ga0105241_10169799 Ga0105241_101697991 122
202 3300009545 Ga0105237_10000080 Ga0105237_1000008066 122
203 3300009551 Ga0105238_10002573 Ga0105238_100025733 122
204 3300010375 Ga0105239_10000116 Ga0105239_1000011642 122
205 3300013297 Ga0157378_10705834 Ga0157378_107058342 122
206 3300025913 Ga0207695_10004216 Ga0207695_100042166 122
207 3300025914 Ga0207671_10003680 Ga0207671_100036802 122
208 3300025924 Ga0207694_10048192 Ga0207694_100481923 122
209 3300025937 Ga0207669_10064364 Ga0207669_100643643 122
210 3300026041 Ga0207639_10031327 Ga0207639_100313274 122
211 3300026121 Ga0207683_10100792 Ga0207683_101007921 122
212 3300026142 Ga0207698_10405051 Ga0207698_104050512 122
213 3300028379 Ga0268266_10215674 Ga0268266_102156742 122
214 3300028379 Ga0268266_11002408 Ga0268266_110024082 122
215 3300037418 Ga0395900_0003329 Ga0395900_0003329_15789_16157 122
216 3300037466 Ga0395898_0002666 Ga0395898_0002666_3609_3977 122
217 3300041452 Ga0451793_1270533 Ga0451793_1270533_216_596 122
218 3300041460 Ga0451802_0570461 Ga0451802_0570461_1095_1475 122
219 3300046452 Ga0495617_002096 Ga0495617_002096_7184_7552 122
220 3300046492 Ga0495585_0000023 Ga0495585_0000023_110108_110476 122
221 3300046507 Ga0495606_0046023 Ga0495606_0046023_1714_2082 122
222 3300046513 Ga0495616_0001830 Ga0495616_0001830_13201_13569 122
223 3300046523 Ga0495644_0161453 Ga0495644_0161453_443_811 122
224 3300046524 Ga0495648_0000048 Ga0495648_0000048_15346_15714 122
225 3300047323 Ga0495683_0000932 Ga0495683_0000932_17790_18158 122
226 3300047470 Ga0495681_0261938 Ga0495681_0261938_255_623 122
227 3300048928 Ga0496125_0130327 Ga0496125_0130327_1180_1551 122
228 3300050515 nmdc:mga0a205_338302_c1 nmdc:mga0a205_338302_c1_400_768 122
229 3300048913 Ga0496110_1591514 Ga0496110_1591514_136_519 123
230 3300049671 Ga0501238_009411 Ga0501238_009411_101_484 123
231 3300005459 Ga0068867_100011370 Ga0068867_1000113708 125
232 3300026089 Ga0207648_10090816 Ga0207648_100908163 125
233 3300046452 Ga0495617_077450 Ga0495617_077450_463_840 125
234 3300046452 Ga0495617_087360 Ga0495617_087360_486_863 125
235 3300046474 Ga0495605_0046623 Ga0495605_0046623_1491_1868 125
236 3300046491 Ga0495584_0000679 Ga0495584_0000679_17570_17947 125
237 3300046491 Ga0495584_0076068 Ga0495584_0076068_989_1366 125
238 3300046492 Ga0495585_0006359 Ga0495585_0006359_2181_2558 125
239 3300046492 Ga0495585_0021885 Ga0495585_0021885_1476_1853 125
240 3300046492 Ga0495585_0081750 Ga0495585_0081750_964_1341 125
241 3300046492 Ga0495585_0110988 Ga0495585_0110988_426_803 125
242 3300046501 Ga0495607_0018708 Ga0495607_0018708_2124_2501 125
243 3300046501 Ga0495607_0042491 Ga0495607_0042491_2009_2386 125
244 3300046501 Ga0495607_0042554 Ga0495607_0042554_1322_1699 125
245 3300046501 Ga0495607_0045783 Ga0495607_0045783_1889_2266 125
246 3300046506 Ga0495583_0000035 Ga0495583_0000035_145303_145680 125
247 3300046512 Ga0495610_0012311 Ga0495610_0012311_1887_2264 125
248 3300046513 Ga0495616_0027534 Ga0495616_0027534_867_1244 125
249 3300046513 Ga0495616_0034346 Ga0495616_0034346_1823_2200 125
250 3300046523 Ga0495644_0001693 Ga0495644_0001693_3800_4177 125
251 3300046523 Ga0495644_0002536 Ga0495644_0002536_1913_2290 125
252 3300046524 Ga0495648_0007552 Ga0495648_0007552_3264_3641 125
253 3300046538 Ga0495609_0002881 Ga0495609_0002881_552_929 125
254 3300046538 Ga0495609_0026683 Ga0495609_0026683_2221_2598 125
255 3300046557 Ga0495622_0067591 Ga0495622_0067591_622_999 125
256 3300046558 Ga0495633_0002941 Ga0495633_0002941_5171_5548 125
257 3300046558 Ga0495633_0006027 Ga0495633_0006027_6692_7069 125
258 3300046615 Ga0495656_0090036 Ga0495656_0090036_406_783 125
259 3300046648 Ga0495611_0012291 Ga0495611_0012291_1384_1761 125
260 3300046660 Ga0495625_0038313 Ga0495625_0038313_1142_1519 125
261 3300046660 Ga0495625_0130266 Ga0495625_0130266_434_811 125
262 3300046664 Ga0495659_0000713 Ga0495659_0000713_6282_6659 125
263 3300046665 Ga0495661_0070125 Ga0495661_0070125_1217_1594 125
264 3300046665 Ga0495661_0072654 Ga0495661_0072654_859_1236 125
265 3300046665 Ga0495661_0265405 Ga0495661_0265405_352_729 125
266 3300046691 Ga0495670_0000138 Ga0495670_0000138_14208_14585 125
267 3300046691 Ga0495670_0009318 Ga0495670_0009318_4112_4489 125
268 3300046692 Ga0495671_0017062 Ga0495671_0017062_314_691 125
269 3300046692 Ga0495671_0470028 Ga0495671_0470028_123_500 125
270 3300046794 Ga0495589_0442340 Ga0495589_0442340_99_476 125
271 3300046810 Ga0495660_0411931 Ga0495660_0411931_174_551 125
272 3300047318 Ga0495636_0002263 Ga0495636_0002263_3265_3642 125
273 3300047320 Ga0495672_0014739 Ga0495672_0014739_3084_3461 125
274 3300047323 Ga0495683_0073654 Ga0495683_0073654_121_498 125
275 3300047323 Ga0495683_0076636 Ga0495683_0076636_319_696 125
276 3300047443 Ga0495687_003311 Ga0495687_003311_7650_8027 125
277 3300047445 Ga0495677_0005761 Ga0495677_0005761_1077_1454 125
278 3300047445 Ga0495677_0014048 Ga0495677_0014048_75_452 125
279 3300047447 Ga0495685_000019 Ga0495685_000019_7398_7775 125
280 3300047469 Ga0495673_0009679 Ga0495673_0009679_1353_1730 125
281 3300047469 Ga0495673_0086928 Ga0495673_0086928_388_765 125
282 3300047472 Ga0495686_0184937 Ga0495686_0184937_91_468 125
283 3300049459 Ga0495678_006169 Ga0495678_006169_3260_3637 125
284 3300049460 Ga0495682_0000094 Ga0495682_0000094_62206_62583 125
285 3300049460 Ga0495682_0003862 Ga0495682_0003862_5640_6017 125
286 3300003771 Ga0055526_1002286 Ga0055526_10022866 126
287 3300003773 Ga0055537_1000012 Ga0055537_100001227 126
288 3300003784 Ga0055534_1000282 Ga0055534_10002826 126
289 3300003790 Ga0055528_1000073 Ga0055528_100007345 126
290 3300005335 Ga0070666_11069222 Ga0070666_110692221 126
291 3300005367 Ga0070667_100035617 Ga0070667_1000356173 126
292 3300005367 Ga0070667_100066324 Ga0070667_1000663242 126
293 3300005617 Ga0068859_101659730 Ga0068859_1016597302 126
294 3300005842 Ga0068858_100011569 Ga0068858_1000115697 126
295 3300005842 Ga0068858_101908505 Ga0068858_1019085052 126
296 3300005843 Ga0068860_101081898 Ga0068860_1010818982 126
297 3300006881 Ga0068865_100718148 Ga0068865_1007181482 126
298 3300006931 Ga0097620_101659760 Ga0097620_1016597602 126
299 3300009101 Ga0105247_10208716 Ga0105247_102087162 126
300 3300009177 Ga0105248_10940238 Ga0105248_109402381 126
301 3300014968 Ga0157379_10007873 Ga0157379_100078738 126
302 3300021361 Ga0213872_10000028 Ga0213872_1000002834 126
303 3300025208 Ga0209436_115776 Ga0209436_1157763 126
304 3300025263 Ga0209565_1000057 Ga0209565_100005730 126
305 3300025273 Ga0209673_1000051 Ga0209673_1000051258 126
306 3300025284 Ga0209130_1000268 Ga0209130_100026832 126
307 3300025291 Ga0209675_1000027 Ga0209675_1000027258 126
308 3300025295 Ga0209564_1000094 Ga0209564_100009429 126
309 3300025299 Ga0209256_1000139 Ga0209256_100013929 126
310 3300025941 Ga0207711_10999192 Ga0207711_109991922 126
311 3300025972 Ga0207668_11151175 Ga0207668_111511752 126
312 3300025986 Ga0207658_10024644 Ga0207658_100246442 126
313 3300025986 Ga0207658_10875280 Ga0207658_108752802 126
314 3300026035 Ga0207703_10317953 Ga0207703_103179533 126
315 3300026089 Ga0207648_10247673 Ga0207648_102476732 126
316 3300039447 Ga0436361_0420505 Ga0436361_0420505_24591_24983 126
317 3300046524 Ga0495648_0212396 Ga0495648_0212396_269_655 126
318 3300048903 Ga0496100_0179799 Ga0496100_0179799_836_1216 126
319 3300048904 Ga0496101_0557428 Ga0496101_0557428_403_783 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

50

104

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gtx-assembly2.cif.gz_B crystal structure of mutated buckwheat glutaredoxin 0.8814 20 120
5kqa-assembly1.cif.gz_A crystal structure of buckwheat glutaredoxin-glutathione complex 0.8769 26 119
1z7r-assembly1.cif.gz_A solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides 0.8727 20 119
3uiw-assembly1.cif.gz_A zebrafish grx2 (apo) 0.8712 25 125
2e7p-assembly5.cif.gz_D crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides 0.8675 26 120
ID Description Score Start End Superfamily
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9278 21 122 3.40.30.10
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9021 21 122 3.40.30.10
af_O36032_1_101_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8852 25 119 3.40.30.10
af_B6SN61_11_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8847 26 120 3.40.30.10
af_Q923X4_47_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8805 26 120 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F3ZT27-F1-model_v4 Glutaredoxin 0.9867 1 102
AF-U4UU52-F1-model_v4 Glutaredoxin-like protein 0.9846 3 115
AF-A0A2A5CMU6-F1-model_v4 Glutaredoxin 0.9805 1 112 GO:0015035
AF-A0A1J5LCK1-F1-model_v4 Glutaredoxin 0.9797 3 112
AF-A0A437RS02-F1-model_v4 Glutaredoxin 0.9778 1 121 GO:0005737
GO:0015038
GO:0034599

Feature Viewer

pLDDT pTM Quality
89.47 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map