F405182
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 228 | 319 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300041452|Ga0451793_1270533|Ga0451793_1270533_216_596 |
| Length | 126 |
| Sequence | VSFTSRLILDSNRIHPAIHEELANYQRALLARVETLVDAHDVVILGMAINPFPGRARRLLDERGIRYEYLGIGSYFSQWRVRLALKLWTGWPTFPMVFVKRKLIGGFADLKRLADNGELTRLLAGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 2 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 45 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 59 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 60 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 67 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 108 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 111 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 112 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 113 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 114 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 118 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 121 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 130 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 187 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 188 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 189 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 190 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 226 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.76 |
| Nodule | 0 |
| Rhizoplane | 1.57 |
| Rhizosphere | 91.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1002286 | 3300003771 | Bacteria | 13078 |
| 2 | Ga0055537_1000012 | 3300003773 | Bacteria | 133761 |
| 3 | Ga0055534_1000282 | 3300003784 | Bacteria | 34605 |
| 4 | Ga0055528_1000073 | 3300003790 | Bacteria | 77054 |
| 5 | Ga0065707_10027983 | 3300005295 | Bacteria | 1119 |
| 6 | Ga0070666_11069222 | 3300005335 | Bacteria | 599 |
| 7 | Ga0070680_101143257 | 3300005336 | Bacteria | 673 |
| 8 | Ga0070680_101390048 | 3300005336 | Unclassified | 608 |
| 9 | Ga0070680_101761269 | 3300005336 | Bacteria | 537 |
| 10 | Ga0070689_100903253 | 3300005340 | Unclassified | 782 |
| 11 | Ga0070691_10216228 | 3300005341 | Bacteria | 1013 |
| 12 | Ga0070692_10424561 | 3300005345 | Bacteria | 845 |
| 13 | Ga0070671_100391092 | 3300005355 | Bacteria | 1189 |
| 14 | Ga0070674_100507210 | 3300005356 | Bacteria | 1006 |
| 15 | Ga0070688_101436029 | 3300005365 | Bacteria | 560 |
| 16 | Ga0070667_100035617 | 3300005367 | Bacteria | 4171 |
| 17 | Ga0070667_100066324 | 3300005367 | Bacteria | 3067 |
| 18 | Ga0070700_100129018 | 3300005441 | Bacteria | 1704 |
| 19 | Ga0070694_100038094 | 3300005444 | Unclassified | 3193 |
| 20 | Ga0070694_100366964 | 3300005444 | Bacteria | 1119 |
| 21 | Ga0070678_100157499 | 3300005456 | Bacteria | 1836 |
| 22 | Ga0068867_100011370 | 3300005459 | Bacteria | 6280 |
| 23 | Ga0070697_100370817 | 3300005536 | Bacteria | 1239 |
| 24 | Ga0068853_100037685 | 3300005539 | Bacteria | 4114 |
| 25 | Ga0070695_101726901 | 3300005545 | Bacteria | 524 |
| 26 | Ga0070696_100007814 | 3300005546 | Bacteria | 7140 |
| 27 | Ga0070696_100602198 | 3300005546 | Bacteria | 886 |
| 28 | Ga0070665_100389152 | 3300005548 | Bacteria | 1402 |
| 29 | Ga0070665_102031617 | 3300005548 | Unclassified | 580 |
| 30 | Ga0070704_100106973 | 3300005549 | Bacteria | 2121 |
| 31 | Ga0068854_101170471 | 3300005578 | Bacteria | 688 |
| 32 | Ga0068856_100452630 | 3300005614 | Bacteria | 1305 |
| 33 | Ga0070702_100896313 | 3300005615 | Bacteria | 694 |
| 34 | Ga0068852_100247632 | 3300005616 | Bacteria | 1706 |
| 35 | Ga0068859_101659730 | 3300005617 | Bacteria | 706 |
| 36 | Ga0068864_100267315 | 3300005618 | Bacteria | 1592 |
| 37 | Ga0068870_10493929 | 3300005840 | Bacteria | 815 |
| 38 | Ga0068858_100011569 | 3300005842 | Bacteria | 8324 |
| 39 | Ga0068858_101149738 | 3300005842 | Bacteria | 763 |
| 40 | Ga0068858_101908505 | 3300005842 | Bacteria | 587 |
| 41 | Ga0068860_100279344 | 3300005843 | Bacteria | 1631 |
| 42 | Ga0068860_101081898 | 3300005843 | Bacteria | 821 |
| 43 | Ga0068862_100629970 | 3300005844 | Bacteria | 1032 |
| 44 | Ga0081539_10321957 | 3300005985 | Bacteria | 657 |
| 45 | Ga0070715_10415974 | 3300006163 | Bacteria | 751 |
| 46 | Ga0070716_100129339 | 3300006173 | Bacteria | 1594 |
| 47 | Ga0075433_10317086 | 3300006852 | Bacteria | 1379 |
| 48 | Ga0075433_10335701 | 3300006852 | Bacteria | 1336 |
| 49 | Ga0075429_100213890 | 3300006880 | Bacteria | 1689 |
| 50 | Ga0075429_100955318 | 3300006880 | Bacteria | 749 |
| 51 | Ga0068865_100718148 | 3300006881 | Bacteria | 855 |
| 52 | Ga0068865_100979286 | 3300006881 | Unclassified | 739 |
| 53 | Ga0075436_100123710 | 3300006914 | Bacteria | 1811 |
| 54 | Ga0075436_100158181 | 3300006914 | Unclassified | 1597 |
| 55 | Ga0097620_101659760 | 3300006931 | Bacteria | 706 |
| 56 | Ga0075435_100047856 | 3300007076 | Bacteria | 3434 |
| 57 | Ga0075435_100796907 | 3300007076 | Bacteria | 823 |
| 58 | Ga0099794_10051795 | 3300007265 | Bacteria | 1978 |
| 59 | Ga0099794_10109190 | 3300007265 | Bacteria | 1385 |
| 60 | Ga0099794_10186616 | 3300007265 | Bacteria | 1059 |
| 61 | Ga0099795_10045841 | 3300007788 | Bacteria | 1573 |
| 62 | Ga0099795_10067550 | 3300007788 | Bacteria | 1342 |
| 63 | Ga0105240_10004318 | 3300009093 | Bacteria | 21701 |
| 64 | Ga0105240_12515006 | 3300009093 | Bacteria | 532 |
| 65 | Ga0111539_13049232 | 3300009094 | Bacteria | 541 |
| 66 | Ga0105247_10208716 | 3300009101 | Bacteria | 1316 |
| 67 | Ga0114129_10797515 | 3300009147 | Bacteria | 1205 |
| 68 | Ga0105243_11184614 | 3300009148 | Bacteria | 776 |
| 69 | Ga0105241_10169799 | 3300009174 | Bacteria | 1801 |
| 70 | Ga0105241_11524730 | 3300009174 | Bacteria | 644 |
| 71 | Ga0105248_10940238 | 3300009177 | Bacteria | 976 |
| 72 | Ga0105248_11607224 | 3300009177 | Unclassified | 736 |
| 73 | Ga0105237_10000080 | 3300009545 | Bacteria | 127788 |
| 74 | Ga0105238_10002573 | 3300009551 | Bacteria | 18101 |
| 75 | Ga0105249_10956727 | 3300009553 | Bacteria | 924 |
| 76 | Ga0099796_10126493 | 3300010159 | Bacteria | 987 |
| 77 | Ga0099796_10351718 | 3300010159 | Bacteria | 635 |
| 78 | Ga0105239_10000116 | 3300010375 | Bacteria | 112811 |
| 79 | Ga0105239_11096654 | 3300010375 | Bacteria | 916 |
| 80 | Ga0157323_1024361 | 3300012495 | Unclassified | 600 |
| 81 | Ga0157313_1007977 | 3300012503 | Bacteria | 839 |
| 82 | Ga0157338_1006956 | 3300012515 | Bacteria | 1060 |
| 83 | Ga0157378_10705834 | 3300013297 | Bacteria | 1028 |
| 84 | Ga0163162_10652458 | 3300013306 | Bacteria | 1176 |
| 85 | Ga0163163_10013678 | 3300014325 | Bacteria | 7434 |
| 86 | Ga0157377_10773355 | 3300014745 | Bacteria | 705 |
| 87 | Ga0157379_10007873 | 3300014968 | Bacteria | 9233 |
| 88 | Ga0157379_10621204 | 3300014968 | Bacteria | 1010 |
| 89 | Ga0213872_10000028 | 3300021361 | Bacteria | 148766 |
| 90 | Ga0213872_10031397 | 3300021361 | Bacteria | 2435 |
| 91 | Ga0209436_115776 | 3300025208 | Bacteria | 1155 |
| 92 | Ga0209565_1000057 | 3300025263 | Bacteria | 196908 |
| 93 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 94 | Ga0209130_1000268 | 3300025284 | Bacteria | 65115 |
| 95 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 96 | Ga0209564_1000094 | 3300025295 | Bacteria | 243176 |
| 97 | Ga0209256_1000139 | 3300025299 | Bacteria | 155515 |
| 98 | Ga0207642_10120916 | 3300025899 | Bacteria | 1350 |
| 99 | Ga0207685_10158140 | 3300025905 | Bacteria | 1032 |
| 100 | Ga0207654_10346145 | 3300025911 | Bacteria | 1022 |
| 101 | Ga0207695_10004216 | 3300025913 | Bacteria | 19757 |
| 102 | Ga0207671_10003680 | 3300025914 | Bacteria | 15115 |
| 103 | Ga0207662_10107291 | 3300025918 | Bacteria | 1738 |
| 104 | Ga0207694_10048192 | 3300025924 | Bacteria | 3296 |
| 105 | Ga0207686_10524596 | 3300025934 | Bacteria | 922 |
| 106 | Ga0207670_10230492 | 3300025936 | Bacteria | 1422 |
| 107 | Ga0207670_10835993 | 3300025936 | Bacteria | 769 |
| 108 | Ga0207669_10064364 | 3300025937 | Bacteria | 2269 |
| 109 | Ga0207665_10020935 | 3300025939 | Bacteria | 4298 |
| 110 | Ga0207711_10999192 | 3300025941 | Bacteria | 776 |
| 111 | Ga0207689_10194841 | 3300025942 | Bacteria | 1672 |
| 112 | Ga0207651_10485467 | 3300025960 | Bacteria | 1066 |
| 113 | Ga0207712_10198479 | 3300025961 | Bacteria | 1589 |
| 114 | Ga0207668_11151175 | 3300025972 | Bacteria | 696 |
| 115 | Ga0207658_10024644 | 3300025986 | Bacteria | 4211 |
| 116 | Ga0207658_10875280 | 3300025986 | Bacteria | 817 |
| 117 | Ga0207677_10580406 | 3300026023 | Bacteria | 981 |
| 118 | Ga0207703_10317953 | 3300026035 | Bacteria | 1425 |
| 119 | Ga0207639_10031327 | 3300026041 | Bacteria | 3908 |
| 120 | Ga0207639_10440314 | 3300026041 | Bacteria | 1181 |
| 121 | Ga0207708_10135259 | 3300026075 | Bacteria | 1930 |
| 122 | Ga0207702_10279184 | 3300026078 | Bacteria | 1578 |
| 123 | Ga0207641_10509363 | 3300026088 | Bacteria | 1170 |
| 124 | Ga0207648_10090816 | 3300026089 | Unclassified | 2669 |
| 125 | Ga0207648_10169154 | 3300026089 | Bacteria | 1932 |
| 126 | Ga0207648_10247673 | 3300026089 | Unclassified | 1588 |
| 127 | Ga0207676_10377454 | 3300026095 | Bacteria | 1319 |
| 128 | Ga0207676_10563799 | 3300026095 | Bacteria | 1090 |
| 129 | Ga0207683_10100792 | 3300026121 | Bacteria | 2578 |
| 130 | Ga0207698_10405051 | 3300026142 | Bacteria | 1305 |
| 131 | Ga0209969_1046387 | 3300027360 | Bacteria | 678 |
| 132 | Ga0209588_1113214 | 3300027671 | Bacteria | 871 |
| 133 | Ga0207428_10480948 | 3300027907 | Bacteria | 903 |
| 134 | Ga0207428_10520731 | 3300027907 | Bacteria | 862 |
| 135 | Ga0268266_10215674 | 3300028379 | Bacteria | 1762 |
| 136 | Ga0268266_11002408 | 3300028379 | Unclassified | 808 |
| 137 | Ga0307509_10295090 | 3300031507 | Bacteria | 1373 |
| 138 | Ga0307408_100218470 | 3300031548 | Bacteria | 1554 |
| 139 | Ga0307508_10912012 | 3300031616 | Bacteria | 506 |
| 140 | Ga0316575_10024608 | 3300031665 | Bacteria | 2332 |
| 141 | Ga0307416_100257471 | 3300032002 | Bacteria | 1703 |
| 142 | Ga0307507_10108601 | 3300033179 | Bacteria | 2280 |
| 143 | Ga0373938_0035443 | 3300034957 | Bacteria | 1088 |
| 144 | Ga0373926_0155175 | 3300035083 | Unclassified | 872 |
| 145 | Ga0373929_0018480 | 3300035085 | Bacteria | 1386 |
| 146 | Ga0373934_0338587 | 3300035086 | Bacteria | 626 |
| 147 | Ga0373944_0070404 | 3300035089 | Unclassified | 1138 |
| 148 | Ga0373923_0286773 | 3300035111 | Unclassified | 777 |
| 149 | Ga0373939_0167108 | 3300035114 | Bacteria | 812 |
| 150 | Ga0373941_0172549 | 3300035115 | Bacteria | 807 |
| 151 | Ga0373942_0076523 | 3300035207 | Bacteria | 986 |
| 152 | Ga0316574_0010763 | 3300035398 | Bacteria | 5179 |
| 153 | Ga0373947_0059484 | 3300035725 | Bacteria | 2316 |
| 154 | Ga0373937_0173573 | 3300036401 | Bacteria | 2023 |
| 155 | Ga0373925_0184660 | 3300037068 | Bacteria | 1652 |
| 156 | Ga0395900_0003329 | 3300037418 | Bacteria | 17369 |
| 157 | Ga0395898_0002666 | 3300037466 | Bacteria | 20695 |
| 158 | Ga0436360_0175990 | 3300039438 | Bacteria | 1033 |
| 159 | Ga0436361_0139067 | 3300039447 | Bacteria | 3043 |
| 160 | Ga0436361_0420505 | 3300039447 | Bacteria | 103715 |
| 161 | Ga0451793_1270533 | 3300041452 | Bacteria | 619 |
| 162 | Ga0451802_0570461 | 3300041460 | Unclassified | 2163 |
| 163 | Ga0439446_0070662 | 3300042156 | Bacteria | 1068 |
| 164 | Ga0451577_0135819 | 3300042876 | Bacteria | 2209 |
| 165 | Ga0451576_0216789 | 3300045051 | Bacteria | 1998 |
| 166 | Ga0451576_0438669 | 3300045051 | Bacteria | 1370 |
| 167 | Ga0495617_002096 | 3300046452 | Bacteria | 8236 |
| 168 | Ga0495617_077450 | 3300046452 | Bacteria | 1090 |
| 169 | Ga0495617_087360 | 3300046452 | Bacteria | 1019 |
| 170 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 171 | Ga0495592_0340020 | 3300046454 | Bacteria | 965 |
| 172 | Ga0495651_0235363 | 3300046462 | Bacteria | 1259 |
| 173 | Ga0495580_0221995 | 3300046472 | Bacteria | 1298 |
| 174 | Ga0495605_0046623 | 3300046474 | Bacteria | 2129 |
| 175 | Ga0495662_0064278 | 3300046476 | Bacteria | 1773 |
| 176 | Ga0495584_0000148 | 3300046491 | Bacteria | 48720 |
| 177 | Ga0495584_0000679 | 3300046491 | Bacteria | 22629 |
| 178 | Ga0495584_0076068 | 3300046491 | Bacteria | 1688 |
| 179 | Ga0495585_0000023 | 3300046492 | Bacteria | 149218 |
| 180 | Ga0495585_0000924 | 3300046492 | Bacteria | 24870 |
| 181 | Ga0495585_0006359 | 3300046492 | Bacteria | 7337 |
| 182 | Ga0495585_0021885 | 3300046492 | Bacteria | 3670 |
| 183 | Ga0495585_0081750 | 3300046492 | Bacteria | 1750 |
| 184 | Ga0495585_0110988 | 3300046492 | Bacteria | 1458 |
| 185 | Ga0495596_0008225 | 3300046500 | Bacteria | 4651 |
| 186 | Ga0495607_0018708 | 3300046501 | Bacteria | 4408 |
| 187 | Ga0495607_0042491 | 3300046501 | Bacteria | 2693 |
| 188 | Ga0495607_0042554 | 3300046501 | Bacteria | 2691 |
| 189 | Ga0495607_0045783 | 3300046501 | Bacteria | 2571 |
| 190 | Ga0495583_0000035 | 3300046506 | Bacteria | 246849 |
| 191 | Ga0495606_0000793 | 3300046507 | Bacteria | 48266 |
| 192 | Ga0495606_0046023 | 3300046507 | Bacteria | 2886 |
| 193 | Ga0495606_0290367 | 3300046507 | Bacteria | 890 |
| 194 | Ga0495610_0012311 | 3300046512 | Bacteria | 5159 |
| 195 | Ga0495616_0001830 | 3300046513 | Bacteria | 14406 |
| 196 | Ga0495616_0003950 | 3300046513 | Bacteria | 9442 |
| 197 | Ga0495616_0027534 | 3300046513 | Bacteria | 3015 |
| 198 | Ga0495616_0034346 | 3300046513 | Bacteria | 2634 |
| 199 | Ga0495630_0161638 | 3300046517 | Bacteria | 1705 |
| 200 | Ga0495643_0024065 | 3300046522 | Bacteria | 3457 |
| 201 | Ga0495644_0001693 | 3300046523 | Bacteria | 8944 |
| 202 | Ga0495644_0002536 | 3300046523 | Bacteria | 7275 |
| 203 | Ga0495644_0008887 | 3300046523 | Bacteria | 3864 |
| 204 | Ga0495644_0161453 | 3300046523 | Bacteria | 859 |
| 205 | Ga0495648_0000048 | 3300046524 | Bacteria | 164840 |
| 206 | Ga0495648_0007552 | 3300046524 | Bacteria | 8690 |
| 207 | Ga0495648_0212396 | 3300046524 | Bacteria | 960 |
| 208 | Ga0495666_0027344 | 3300046526 | Bacteria | 2808 |
| 209 | Ga0495652_0225985 | 3300046529 | Bacteria | 1403 |
| 210 | Ga0495586_0013285 | 3300046535 | Bacteria | 4365 |
| 211 | Ga0495587_0247952 | 3300046536 | Bacteria | 1001 |
| 212 | Ga0495587_0704329 | 3300046536 | Unclassified | 553 |
| 213 | Ga0495609_0000779 | 3300046538 | Bacteria | 23876 |
| 214 | Ga0495609_0002881 | 3300046538 | Bacteria | 10267 |
| 215 | Ga0495609_0026683 | 3300046538 | Bacteria | 2643 |
| 216 | Ga0495609_0117984 | 3300046538 | Bacteria | 1142 |
| 217 | Ga0495622_0067591 | 3300046557 | Bacteria | 1651 |
| 218 | Ga0495633_0000464 | 3300046558 | Bacteria | 41549 |
| 219 | Ga0495633_0002941 | 3300046558 | Bacteria | 11656 |
| 220 | Ga0495633_0006027 | 3300046558 | Bacteria | 7274 |
| 221 | Ga0495656_0090036 | 3300046615 | Bacteria | 1401 |
| 222 | Ga0495668_0000048 | 3300046616 | Bacteria | 217867 |
| 223 | Ga0495611_0012291 | 3300046648 | Bacteria | 3640 |
| 224 | Ga0495625_0038313 | 3300046660 | Bacteria | 3510 |
| 225 | Ga0495625_0130266 | 3300046660 | Bacteria | 1704 |
| 226 | Ga0495659_0000713 | 3300046664 | Bacteria | 11971 |
| 227 | Ga0495661_0070125 | 3300046665 | Bacteria | 2052 |
| 228 | Ga0495661_0072654 | 3300046665 | Bacteria | 2006 |
| 229 | Ga0495661_0265405 | 3300046665 | Bacteria | 870 |
| 230 | Ga0495588_0629526 | 3300046674 | Unclassified | 562 |
| 231 | Ga0495646_0319634 | 3300046680 | Bacteria | 818 |
| 232 | Ga0495647_0034907 | 3300046681 | Bacteria | 1886 |
| 233 | Ga0495670_0000138 | 3300046691 | Bacteria | 31679 |
| 234 | Ga0495670_0009318 | 3300046691 | Bacteria | 4832 |
| 235 | Ga0495670_0081070 | 3300046691 | Bacteria | 1653 |
| 236 | Ga0495671_0017062 | 3300046692 | Bacteria | 3866 |
| 237 | Ga0495671_0470028 | 3300046692 | Bacteria | 600 |
| 238 | Ga0495589_0442340 | 3300046794 | Unclassified | 595 |
| 239 | Ga0495660_0411931 | 3300046810 | Bacteria | 590 |
| 240 | Ga0495604_0285203 | 3300047317 | Bacteria | 1114 |
| 241 | Ga0495636_0002263 | 3300047318 | Bacteria | 7393 |
| 242 | Ga0495636_0442414 | 3300047318 | Bacteria | 623 |
| 243 | Ga0495674_0137856 | 3300047319 | Bacteria | 2052 |
| 244 | Ga0495672_0014739 | 3300047320 | Bacteria | 5335 |
| 245 | Ga0495683_0000036 | 3300047323 | Bacteria | 144974 |
| 246 | Ga0495683_0000932 | 3300047323 | Bacteria | 20627 |
| 247 | Ga0495683_0073654 | 3300047323 | Bacteria | 1674 |
| 248 | Ga0495683_0076636 | 3300047323 | Bacteria | 1636 |
| 249 | Ga0495687_003311 | 3300047443 | Bacteria | 11815 |
| 250 | Ga0495677_0005761 | 3300047445 | Bacteria | 4692 |
| 251 | Ga0495677_0014048 | 3300047445 | Bacteria | 2915 |
| 252 | Ga0495685_000019 | 3300047447 | Bacteria | 73831 |
| 253 | Ga0495673_0009679 | 3300047469 | Bacteria | 5312 |
| 254 | Ga0495673_0086928 | 3300047469 | Bacteria | 1284 |
| 255 | Ga0495681_0034083 | 3300047470 | Bacteria | 2540 |
| 256 | Ga0495681_0261938 | 3300047470 | Bacteria | 679 |
| 257 | Ga0495686_0002763 | 3300047472 | Bacteria | 16021 |
| 258 | Ga0495686_0184937 | 3300047472 | Bacteria | 1205 |
| 259 | Ga0496100_0179799 | 3300048903 | Bacteria | 1529 |
| 260 | Ga0496101_0557428 | 3300048904 | Bacteria | 906 |
| 261 | Ga0496110_1591514 | 3300048913 | Bacteria | 563 |
| 262 | Ga0496122_0525868 | 3300048925 | Bacteria | 569 |
| 263 | Ga0496124_0002551 | 3300048927 | Bacteria | 23634 |
| 264 | Ga0496124_0271038 | 3300048927 | Bacteria | 1243 |
| 265 | Ga0496125_0004595 | 3300048928 | Bacteria | 15780 |
| 266 | Ga0496125_0130327 | 3300048928 | Bacteria | 1772 |
| 267 | Ga0496126_1372543 | 3300048929 | Unclassified | 511 |
| 268 | Ga0495678_006169 | 3300049459 | Bacteria | 6425 |
| 269 | Ga0495682_0000094 | 3300049460 | Bacteria | 78278 |
| 270 | Ga0495682_0003862 | 3300049460 | Bacteria | 6567 |
| 271 | Ga0495682_0121729 | 3300049460 | Bacteria | 934 |
| 272 | Ga0501031_0021692 | 3300049568 | Bacteria | 4186 |
| 273 | Ga0501032_0146814 | 3300049569 | Bacteria | 1552 |
| 274 | Ga0501033_0011398 | 3300049570 | Bacteria | 6805 |
| 275 | Ga0501034_0594912 | 3300049571 | Bacteria | 1012 |
| 276 | Ga0501036_0001905 | 3300049572 | Bacteria | 16237 |
| 277 | Ga0501037_0021395 | 3300049573 | Bacteria | 4779 |
| 278 | Ga0501038_0005646 | 3300049574 | Bacteria | 11608 |
| 279 | Ga0501039_0019782 | 3300049575 | Bacteria | 5161 |
| 280 | Ga0501039_0769894 | 3300049575 | Bacteria | 751 |
| 281 | Ga0501040_0008422 | 3300049576 | Bacteria | 6700 |
| 282 | Ga0501041_0003813 | 3300049577 | Bacteria | 8681 |
| 283 | Ga0501041_0302887 | 3300049577 | Bacteria | 1007 |
| 284 | Ga0501042_0014757 | 3300049578 | Bacteria | 5334 |
| 285 | Ga0501043_0260276 | 3300049579 | Bacteria | 1334 |
| 286 | Ga0501046_0018754 | 3300049580 | Bacteria | 5749 |
| 287 | Ga0501048_0002785 | 3300049582 | Bacteria | 13353 |
| 288 | Ga0501048_0534061 | 3300049582 | Bacteria | 841 |
| 289 | Ga0501068_0022043 | 3300049584 | Bacteria | 3722 |
| 290 | Ga0501071_0162546 | 3300049587 | Bacteria | 1669 |
| 291 | Ga0501072_0010617 | 3300049588 | Bacteria | 7014 |
| 292 | Ga0501073_0074774 | 3300049589 | Bacteria | 2359 |
| 293 | Ga0501074_0010002 | 3300049590 | Bacteria | 6885 |
| 294 | Ga0501075_0002709 | 3300049591 | Bacteria | 11846 |
| 295 | Ga0501076_0018027 | 3300049592 | Bacteria | 5372 |
| 296 | Ga0501076_0087288 | 3300049592 | Bacteria | 2508 |
| 297 | Ga0501077_0011733 | 3300049593 | Bacteria | 5477 |
| 298 | Ga0501238_009411 | 3300049671 | Bacteria | 1296 |
| 299 | Ga0501079_0006336 | 3300049741 | Bacteria | 8880 |
| 300 | Ga0501080_0044913 | 3300049742 | Bacteria | 4112 |
| 301 | Ga0501081_0002160 | 3300049743 | Bacteria | 12334 |
| 302 | Ga0501081_0144531 | 3300049743 | Bacteria | 1706 |
| 303 | Ga0501035_0107021 | 3300049822 | Bacteria | 2451 |
| 304 | Ga0501044_0426893 | 3300049823 | Bacteria | 1235 |
| 305 | Ga0501045_0011234 | 3300049824 | Bacteria | 6282 |
| 306 | Ga0501045_0605135 | 3300049824 | Bacteria | 811 |
| 307 | nmdc:mga08y16_1057905_c1 | 3300050511 | Bacteria | 789 |
| 308 | nmdc:mga08y16_1427406_c1 | 3300050511 | Bacteria | 655 |
| 309 | nmdc:mga0rr50_293555_c1 | 3300050513 | Bacteria | 1359 |
| 310 | nmdc:mga08x19_338686_c1 | 3300050514 | Bacteria | 1049 |
| 311 | nmdc:mga0a205_260901_c1 | 3300050515 | Bacteria | 1610 |
| 312 | nmdc:mga0a205_338302_c1 | 3300050515 | Bacteria | 1374 |
| 313 | nmdc:mga0a205_813221_c1 | 3300050515 | Bacteria | 782 |
| 314 | Ga0500637_0442158 | 3300053178 | Unclassified | 662 |
| 315 | Ga0501084_0002024 | 3300054114 | Bacteria | 16187 |
| 316 | Ga0501084_0945992 | 3300054114 | Bacteria | 724 |
| 317 | Ga0501082_0005383 | 3300060353 | Bacteria | 11107 |
| 318 | Ga0501082_1710847 | 3300060353 | Bacteria | 549 |
| 319 | Ga0530510_0007843 | 3300061734 | Bacteria | 7444 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005365 | Ga0070688_101436029 | Ga0070688_1014360292 | 116 |
| 2 | 3300005618 | Ga0068864_100267315 | Ga0068864_1002673153 | 116 |
| 3 | 3300006880 | Ga0075429_100213890 | Ga0075429_1002138902 | 116 |
| 4 | 3300007076 | Ga0075435_100796907 | Ga0075435_1007969071 | 116 |
| 5 | 3300025936 | Ga0207670_10835993 | Ga0207670_108359932 | 116 |
| 6 | 3300027907 | Ga0207428_10480948 | Ga0207428_104809482 | 116 |
| 7 | 3300046476 | Ga0495662_0064278 | Ga0495662_0064278_734_1084 | 116 |
| 8 | 3300046517 | Ga0495630_0161638 | Ga0495630_0161638_712_1062 | 116 |
| 9 | 3300046535 | Ga0495586_0013285 | Ga0495586_0013285_2349_2699 | 116 |
| 10 | 3300046536 | Ga0495587_0704329 | Ga0495587_0704329_174_524 | 116 |
| 11 | 3300046680 | Ga0495646_0319634 | Ga0495646_0319634_412_762 | 116 |
| 12 | 3300047319 | Ga0495674_0137856 | Ga0495674_0137856_502_852 | 116 |
| 13 | 3300050511 | nmdc:mga08y16_1427406_c1 | nmdc:mga08y16_1427406_c1_204_554 | 116 |
| 14 | 3300050515 | nmdc:mga0a205_813221_c1 | nmdc:mga0a205_813221_c1_228_578 | 116 |
| 15 | 3300005336 | Ga0070680_101143257 | Ga0070680_1011432571 | 117 |
| 16 | 3300005336 | Ga0070680_101761269 | Ga0070680_1017612691 | 117 |
| 17 | 3300005444 | Ga0070694_100366964 | Ga0070694_1003669643 | 117 |
| 18 | 3300005615 | Ga0070702_100896313 | Ga0070702_1008963132 | 117 |
| 19 | 3300005985 | Ga0081539_10321957 | Ga0081539_103219571 | 117 |
| 20 | 3300009094 | Ga0111539_13049232 | Ga0111539_130492322 | 117 |
| 21 | 3300026095 | Ga0207676_10377454 | Ga0207676_103774542 | 117 |
| 22 | 3300027360 | Ga0209969_1046387 | Ga0209969_10463872 | 117 |
| 23 | 3300031548 | Ga0307408_100218470 | Ga0307408_1002184702 | 117 |
| 24 | 3300032002 | Ga0307416_100257471 | Ga0307416_1002574712 | 117 |
| 25 | 3300035114 | Ga0373939_0167108 | Ga0373939_0167108_297_650 | 117 |
| 26 | 3300042156 | Ga0439446_0070662 | Ga0439446_0070662_687_1040 | 117 |
| 27 | 3300045051 | Ga0451576_0438669 | Ga0451576_0438669_81_434 | 117 |
| 28 | 3300046616 | Ga0495668_0000048 | Ga0495668_0000048_28962_29315 | 117 |
| 29 | 3300047318 | Ga0495636_0442414 | Ga0495636_0442414_17_370 | 117 |
| 30 | 3300047472 | Ga0495686_0002763 | Ga0495686_0002763_15084_15437 | 117 |
| 31 | 3300005345 | Ga0070692_10424561 | Ga0070692_104245612 | 118 |
| 32 | 3300007788 | Ga0099795_10045841 | Ga0099795_100458413 | 118 |
| 33 | 3300014325 | Ga0163163_10013678 | Ga0163163_100136782 | 118 |
| 34 | 3300031616 | Ga0307508_10912012 | Ga0307508_109120122 | 118 |
| 35 | 3300035086 | Ga0373934_0338587 | Ga0373934_0338587_82_438 | 118 |
| 36 | 3300039438 | Ga0436360_0175990 | Ga0436360_0175990_655_1011 | 118 |
| 37 | 3300046454 | Ga0495592_0340020 | Ga0495592_0340020_465_821 | 118 |
| 38 | 3300046462 | Ga0495651_0235363 | Ga0495651_0235363_207_563 | 118 |
| 39 | 3300046529 | Ga0495652_0225985 | Ga0495652_0225985_816_1172 | 118 |
| 40 | 3300046536 | Ga0495587_0247952 | Ga0495587_0247952_127_483 | 118 |
| 41 | 3300047317 | Ga0495604_0285203 | Ga0495604_0285203_121_477 | 118 |
| 42 | 3300049568 | Ga0501031_0021692 | Ga0501031_0021692_2091_2447 | 118 |
| 43 | 3300049569 | Ga0501032_0146814 | Ga0501032_0146814_419_775 | 118 |
| 44 | 3300049570 | Ga0501033_0011398 | Ga0501033_0011398_314_670 | 118 |
| 45 | 3300049571 | Ga0501034_0594912 | Ga0501034_0594912_74_430 | 118 |
| 46 | 3300049572 | Ga0501036_0001905 | Ga0501036_0001905_11563_11919 | 118 |
| 47 | 3300049573 | Ga0501037_0021395 | Ga0501037_0021395_1279_1635 | 118 |
| 48 | 3300049574 | Ga0501038_0005646 | Ga0501038_0005646_3968_4324 | 118 |
| 49 | 3300049575 | Ga0501039_0019782 | Ga0501039_0019782_4098_4454 | 118 |
| 50 | 3300049576 | Ga0501040_0008422 | Ga0501040_0008422_5802_6158 | 118 |
| 51 | 3300049577 | Ga0501041_0003813 | Ga0501041_0003813_4411_4767 | 118 |
| 52 | 3300049578 | Ga0501042_0014757 | Ga0501042_0014757_4234_4590 | 118 |
| 53 | 3300049579 | Ga0501043_0260276 | Ga0501043_0260276_902_1258 | 118 |
| 54 | 3300049580 | Ga0501046_0018754 | Ga0501046_0018754_2906_3262 | 118 |
| 55 | 3300049582 | Ga0501048_0002785 | Ga0501048_0002785_8457_8813 | 118 |
| 56 | 3300049584 | Ga0501068_0022043 | Ga0501068_0022043_1056_1412 | 118 |
| 57 | 3300049587 | Ga0501071_0162546 | Ga0501071_0162546_1006_1362 | 118 |
| 58 | 3300049588 | Ga0501072_0010617 | Ga0501072_0010617_2693_3049 | 118 |
| 59 | 3300049589 | Ga0501073_0074774 | Ga0501073_0074774_279_635 | 118 |
| 60 | 3300049590 | Ga0501074_0010002 | Ga0501074_0010002_1246_1602 | 118 |
| 61 | 3300049591 | Ga0501075_0002709 | Ga0501075_0002709_2664_3020 | 118 |
| 62 | 3300049592 | Ga0501076_0018027 | Ga0501076_0018027_3130_3486 | 118 |
| 63 | 3300049593 | Ga0501077_0011733 | Ga0501077_0011733_556_912 | 118 |
| 64 | 3300049741 | Ga0501079_0006336 | Ga0501079_0006336_3214_3570 | 118 |
| 65 | 3300049742 | Ga0501080_0044913 | Ga0501080_0044913_3185_3541 | 118 |
| 66 | 3300049743 | Ga0501081_0002160 | Ga0501081_0002160_4573_4929 | 118 |
| 67 | 3300049822 | Ga0501035_0107021 | Ga0501035_0107021_474_830 | 118 |
| 68 | 3300049823 | Ga0501044_0426893 | Ga0501044_0426893_724_1080 | 118 |
| 69 | 3300049824 | Ga0501045_0011234 | Ga0501045_0011234_4313_4669 | 118 |
| 70 | 3300054114 | Ga0501084_0002024 | Ga0501084_0002024_353_709 | 118 |
| 71 | 3300060353 | Ga0501082_0005383 | Ga0501082_0005383_3433_3789 | 118 |
| 72 | 3300061734 | Ga0530510_0007843 | Ga0530510_0007843_3882_4238 | 118 |
| 73 | 3300005336 | Ga0070680_101390048 | Ga0070680_1013900481 | 119 |
| 74 | 3300005441 | Ga0070700_100129018 | Ga0070700_1001290182 | 119 |
| 75 | 3300005444 | Ga0070694_100038094 | Ga0070694_1000380942 | 119 |
| 76 | 3300005545 | Ga0070695_101726901 | Ga0070695_1017269011 | 119 |
| 77 | 3300046491 | Ga0495584_0000148 | Ga0495584_0000148_40083_40442 | 119 |
| 78 | 3300046492 | Ga0495585_0000924 | Ga0495585_0000924_20029_20388 | 119 |
| 79 | 3300046500 | Ga0495596_0008225 | Ga0495596_0008225_1457_1816 | 119 |
| 80 | 3300046507 | Ga0495606_0290367 | Ga0495606_0290367_302_661 | 119 |
| 81 | 3300046513 | Ga0495616_0003950 | Ga0495616_0003950_8971_9330 | 119 |
| 82 | 3300046538 | Ga0495609_0117984 | Ga0495609_0117984_675_1034 | 119 |
| 83 | 3300046558 | Ga0495633_0000464 | Ga0495633_0000464_19599_19958 | 119 |
| 84 | 3300046691 | Ga0495670_0081070 | Ga0495670_0081070_53_412 | 119 |
| 85 | 3300047323 | Ga0495683_0000036 | Ga0495683_0000036_58364_58723 | 119 |
| 86 | 3300049460 | Ga0495682_0121729 | Ga0495682_0121729_506_865 | 119 |
| 87 | 3300005295 | Ga0065707_10027983 | Ga0065707_100279831 | 120 |
| 88 | 3300005340 | Ga0070689_100903253 | Ga0070689_1009032531 | 120 |
| 89 | 3300005341 | Ga0070691_10216228 | Ga0070691_102162282 | 120 |
| 90 | 3300005355 | Ga0070671_100391092 | Ga0070671_1003910922 | 120 |
| 91 | 3300005536 | Ga0070697_100370817 | Ga0070697_1003708172 | 120 |
| 92 | 3300005546 | Ga0070696_100007814 | Ga0070696_1000078144 | 120 |
| 93 | 3300005546 | Ga0070696_100602198 | Ga0070696_1006021982 | 120 |
| 94 | 3300005549 | Ga0070704_100106973 | Ga0070704_1001069731 | 120 |
| 95 | 3300005578 | Ga0068854_101170471 | Ga0068854_1011704712 | 120 |
| 96 | 3300005614 | Ga0068856_100452630 | Ga0068856_1004526301 | 120 |
| 97 | 3300005840 | Ga0068870_10493929 | Ga0068870_104939292 | 120 |
| 98 | 3300005842 | Ga0068858_101149738 | Ga0068858_1011497382 | 120 |
| 99 | 3300005843 | Ga0068860_100279344 | Ga0068860_1002793442 | 120 |
| 100 | 3300005844 | Ga0068862_100629970 | Ga0068862_1006299702 | 120 |
| 101 | 3300006163 | Ga0070715_10415974 | Ga0070715_104159742 | 120 |
| 102 | 3300006173 | Ga0070716_100129339 | Ga0070716_1001293394 | 120 |
| 103 | 3300006852 | Ga0075433_10317086 | Ga0075433_103170862 | 120 |
| 104 | 3300006880 | Ga0075429_100955318 | Ga0075429_1009553182 | 120 |
| 105 | 3300006881 | Ga0068865_100979286 | Ga0068865_1009792861 | 120 |
| 106 | 3300006914 | Ga0075436_100123710 | Ga0075436_1001237102 | 120 |
| 107 | 3300006914 | Ga0075436_100158181 | Ga0075436_1001581813 | 120 |
| 108 | 3300007265 | Ga0099794_10109190 | Ga0099794_101091903 | 120 |
| 109 | 3300007265 | Ga0099794_10186616 | Ga0099794_101866162 | 120 |
| 110 | 3300007788 | Ga0099795_10067550 | Ga0099795_100675503 | 120 |
| 111 | 3300009093 | Ga0105240_12515006 | Ga0105240_125150062 | 120 |
| 112 | 3300009147 | Ga0114129_10797515 | Ga0114129_107975152 | 120 |
| 113 | 3300009148 | Ga0105243_11184614 | Ga0105243_111846142 | 120 |
| 114 | 3300009174 | Ga0105241_11524730 | Ga0105241_115247302 | 120 |
| 115 | 3300009177 | Ga0105248_11607224 | Ga0105248_116072242 | 120 |
| 116 | 3300009553 | Ga0105249_10956727 | Ga0105249_109567271 | 120 |
| 117 | 3300010159 | Ga0099796_10126493 | Ga0099796_101264932 | 120 |
| 118 | 3300010159 | Ga0099796_10351718 | Ga0099796_103517182 | 120 |
| 119 | 3300010375 | Ga0105239_11096654 | Ga0105239_110966542 | 120 |
| 120 | 3300012495 | Ga0157323_1024361 | Ga0157323_10243611 | 120 |
| 121 | 3300012503 | Ga0157313_1007977 | Ga0157313_10079772 | 120 |
| 122 | 3300012515 | Ga0157338_1006956 | Ga0157338_10069562 | 120 |
| 123 | 3300013306 | Ga0163162_10652458 | Ga0163162_106524582 | 120 |
| 124 | 3300014745 | Ga0157377_10773355 | Ga0157377_107733551 | 120 |
| 125 | 3300014968 | Ga0157379_10621204 | Ga0157379_106212042 | 120 |
| 126 | 3300025899 | Ga0207642_10120916 | Ga0207642_101209163 | 120 |
| 127 | 3300025905 | Ga0207685_10158140 | Ga0207685_101581402 | 120 |
| 128 | 3300025911 | Ga0207654_10346145 | Ga0207654_103461451 | 120 |
| 129 | 3300025918 | Ga0207662_10107291 | Ga0207662_101072912 | 120 |
| 130 | 3300025934 | Ga0207686_10524596 | Ga0207686_105245962 | 120 |
| 131 | 3300025936 | Ga0207670_10230492 | Ga0207670_102304922 | 120 |
| 132 | 3300025939 | Ga0207665_10020935 | Ga0207665_100209351 | 120 |
| 133 | 3300025942 | Ga0207689_10194841 | Ga0207689_101948413 | 120 |
| 134 | 3300025960 | Ga0207651_10485467 | Ga0207651_104854672 | 120 |
| 135 | 3300025961 | Ga0207712_10198479 | Ga0207712_101984793 | 120 |
| 136 | 3300026023 | Ga0207677_10580406 | Ga0207677_105804062 | 120 |
| 137 | 3300026041 | Ga0207639_10440314 | Ga0207639_104403142 | 120 |
| 138 | 3300026075 | Ga0207708_10135259 | Ga0207708_101352592 | 120 |
| 139 | 3300026078 | Ga0207702_10279184 | Ga0207702_102791842 | 120 |
| 140 | 3300026088 | Ga0207641_10509363 | Ga0207641_105093632 | 120 |
| 141 | 3300026089 | Ga0207648_10169154 | Ga0207648_101691543 | 120 |
| 142 | 3300026095 | Ga0207676_10563799 | Ga0207676_105637991 | 120 |
| 143 | 3300027671 | Ga0209588_1113214 | Ga0209588_11132142 | 120 |
| 144 | 3300027907 | Ga0207428_10520731 | Ga0207428_105207311 | 120 |
| 145 | 3300031665 | Ga0316575_10024608 | Ga0316575_100246083 | 120 |
| 146 | 3300034957 | Ga0373938_0035443 | Ga0373938_0035443_23_385 | 120 |
| 147 | 3300035083 | Ga0373926_0155175 | Ga0373926_0155175_105_467 | 120 |
| 148 | 3300035085 | Ga0373929_0018480 | Ga0373929_0018480_159_521 | 120 |
| 149 | 3300035089 | Ga0373944_0070404 | Ga0373944_0070404_519_881 | 120 |
| 150 | 3300035111 | Ga0373923_0286773 | Ga0373923_0286773_141_503 | 120 |
| 151 | 3300035115 | Ga0373941_0172549 | Ga0373941_0172549_384_746 | 120 |
| 152 | 3300035207 | Ga0373942_0076523 | Ga0373942_0076523_602_964 | 120 |
| 153 | 3300035398 | Ga0316574_0010763 | Ga0316574_0010763_1728_2090 | 120 |
| 154 | 3300035725 | Ga0373947_0059484 | Ga0373947_0059484_448_810 | 120 |
| 155 | 3300036401 | Ga0373937_0173573 | Ga0373937_0173573_1476_1838 | 120 |
| 156 | 3300037068 | Ga0373925_0184660 | Ga0373925_0184660_1185_1547 | 120 |
| 157 | 3300042876 | Ga0451577_0135819 | Ga0451577_0135819_624_986 | 120 |
| 158 | 3300045051 | Ga0451576_0216789 | Ga0451576_0216789_920_1282 | 120 |
| 159 | 3300046472 | Ga0495580_0221995 | Ga0495580_0221995_521_883 | 120 |
| 160 | 3300046526 | Ga0495666_0027344 | Ga0495666_0027344_1873_2235 | 120 |
| 161 | 3300046674 | Ga0495588_0629526 | Ga0495588_0629526_32_394 | 120 |
| 162 | 3300046681 | Ga0495647_0034907 | Ga0495647_0034907_1454_1816 | 120 |
| 163 | 3300049575 | Ga0501039_0769894 | Ga0501039_0769894_84_446 | 120 |
| 164 | 3300049577 | Ga0501041_0302887 | Ga0501041_0302887_271_633 | 120 |
| 165 | 3300049582 | Ga0501048_0534061 | Ga0501048_0534061_206_568 | 120 |
| 166 | 3300049592 | Ga0501076_0087288 | Ga0501076_0087288_1157_1519 | 120 |
| 167 | 3300049743 | Ga0501081_0144531 | Ga0501081_0144531_1271_1633 | 120 |
| 168 | 3300049824 | Ga0501045_0605135 | Ga0501045_0605135_366_728 | 120 |
| 169 | 3300050511 | nmdc:mga08y16_1057905_c1 | nmdc:mga08y16_1057905_c1_69_431 | 120 |
| 170 | 3300050514 | nmdc:mga08x19_338686_c1 | nmdc:mga08x19_338686_c1_446_808 | 120 |
| 171 | 3300054114 | Ga0501084_0945992 | Ga0501084_0945992_331_693 | 120 |
| 172 | 3300007076 | Ga0075435_100047856 | Ga0075435_1000478566 | 121 |
| 173 | 3300007265 | Ga0099794_10051795 | Ga0099794_100517954 | 121 |
| 174 | 3300021361 | Ga0213872_10031397 | Ga0213872_100313972 | 121 |
| 175 | 3300031507 | Ga0307509_10295090 | Ga0307509_102950902 | 121 |
| 176 | 3300033179 | Ga0307507_10108601 | Ga0307507_101086012 | 121 |
| 177 | 3300039447 | Ga0436361_0139067 | Ga0436361_0139067_879_1244 | 121 |
| 178 | 3300046453 | Ga0495627_000008 | Ga0495627_000008_487275_487640 | 121 |
| 179 | 3300046507 | Ga0495606_0000793 | Ga0495606_0000793_12598_12963 | 121 |
| 180 | 3300046522 | Ga0495643_0024065 | Ga0495643_0024065_2761_3126 | 121 |
| 181 | 3300046523 | Ga0495644_0008887 | Ga0495644_0008887_2457_2822 | 121 |
| 182 | 3300046538 | Ga0495609_0000779 | Ga0495609_0000779_22738_23103 | 121 |
| 183 | 3300047470 | Ga0495681_0034083 | Ga0495681_0034083_1688_2053 | 121 |
| 184 | 3300048925 | Ga0496122_0525868 | Ga0496122_0525868_46_411 | 121 |
| 185 | 3300048927 | Ga0496124_0002551 | Ga0496124_0002551_10527_10892 | 121 |
| 186 | 3300048927 | Ga0496124_0271038 | Ga0496124_0271038_443_808 | 121 |
| 187 | 3300048928 | Ga0496125_0004595 | Ga0496125_0004595_3584_3949 | 121 |
| 188 | 3300048929 | Ga0496126_1372543 | Ga0496126_1372543_11_376 | 121 |
| 189 | 3300050513 | nmdc:mga0rr50_293555_c1 | nmdc:mga0rr50_293555_c1_483_878 | 121 |
| 190 | 3300050515 | nmdc:mga0a205_260901_c1 | nmdc:mga0a205_260901_c1_878_1273 | 121 |
| 191 | 3300053178 | Ga0500637_0442158 | Ga0500637_0442158_236_601 | 121 |
| 192 | 3300060353 | Ga0501082_1710847 | Ga0501082_1710847_97_465 | 121 |
| 193 | 3300005356 | Ga0070674_100507210 | Ga0070674_1005072102 | 122 |
| 194 | 3300005456 | Ga0070678_100157499 | Ga0070678_1001574991 | 122 |
| 195 | 3300005539 | Ga0068853_100037685 | Ga0068853_1000376852 | 122 |
| 196 | 3300005548 | Ga0070665_100389152 | Ga0070665_1003891521 | 122 |
| 197 | 3300005548 | Ga0070665_102031617 | Ga0070665_1020316172 | 122 |
| 198 | 3300005616 | Ga0068852_100247632 | Ga0068852_1002476322 | 122 |
| 199 | 3300006852 | Ga0075433_10335701 | Ga0075433_103357012 | 122 |
| 200 | 3300009093 | Ga0105240_10004318 | Ga0105240_100043187 | 122 |
| 201 | 3300009174 | Ga0105241_10169799 | Ga0105241_101697991 | 122 |
| 202 | 3300009545 | Ga0105237_10000080 | Ga0105237_1000008066 | 122 |
| 203 | 3300009551 | Ga0105238_10002573 | Ga0105238_100025733 | 122 |
| 204 | 3300010375 | Ga0105239_10000116 | Ga0105239_1000011642 | 122 |
| 205 | 3300013297 | Ga0157378_10705834 | Ga0157378_107058342 | 122 |
| 206 | 3300025913 | Ga0207695_10004216 | Ga0207695_100042166 | 122 |
| 207 | 3300025914 | Ga0207671_10003680 | Ga0207671_100036802 | 122 |
| 208 | 3300025924 | Ga0207694_10048192 | Ga0207694_100481923 | 122 |
| 209 | 3300025937 | Ga0207669_10064364 | Ga0207669_100643643 | 122 |
| 210 | 3300026041 | Ga0207639_10031327 | Ga0207639_100313274 | 122 |
| 211 | 3300026121 | Ga0207683_10100792 | Ga0207683_101007921 | 122 |
| 212 | 3300026142 | Ga0207698_10405051 | Ga0207698_104050512 | 122 |
| 213 | 3300028379 | Ga0268266_10215674 | Ga0268266_102156742 | 122 |
| 214 | 3300028379 | Ga0268266_11002408 | Ga0268266_110024082 | 122 |
| 215 | 3300037418 | Ga0395900_0003329 | Ga0395900_0003329_15789_16157 | 122 |
| 216 | 3300037466 | Ga0395898_0002666 | Ga0395898_0002666_3609_3977 | 122 |
| 217 | 3300041452 | Ga0451793_1270533 | Ga0451793_1270533_216_596 | 122 |
| 218 | 3300041460 | Ga0451802_0570461 | Ga0451802_0570461_1095_1475 | 122 |
| 219 | 3300046452 | Ga0495617_002096 | Ga0495617_002096_7184_7552 | 122 |
| 220 | 3300046492 | Ga0495585_0000023 | Ga0495585_0000023_110108_110476 | 122 |
| 221 | 3300046507 | Ga0495606_0046023 | Ga0495606_0046023_1714_2082 | 122 |
| 222 | 3300046513 | Ga0495616_0001830 | Ga0495616_0001830_13201_13569 | 122 |
| 223 | 3300046523 | Ga0495644_0161453 | Ga0495644_0161453_443_811 | 122 |
| 224 | 3300046524 | Ga0495648_0000048 | Ga0495648_0000048_15346_15714 | 122 |
| 225 | 3300047323 | Ga0495683_0000932 | Ga0495683_0000932_17790_18158 | 122 |
| 226 | 3300047470 | Ga0495681_0261938 | Ga0495681_0261938_255_623 | 122 |
| 227 | 3300048928 | Ga0496125_0130327 | Ga0496125_0130327_1180_1551 | 122 |
| 228 | 3300050515 | nmdc:mga0a205_338302_c1 | nmdc:mga0a205_338302_c1_400_768 | 122 |
| 229 | 3300048913 | Ga0496110_1591514 | Ga0496110_1591514_136_519 | 123 |
| 230 | 3300049671 | Ga0501238_009411 | Ga0501238_009411_101_484 | 123 |
| 231 | 3300005459 | Ga0068867_100011370 | Ga0068867_1000113708 | 125 |
| 232 | 3300026089 | Ga0207648_10090816 | Ga0207648_100908163 | 125 |
| 233 | 3300046452 | Ga0495617_077450 | Ga0495617_077450_463_840 | 125 |
| 234 | 3300046452 | Ga0495617_087360 | Ga0495617_087360_486_863 | 125 |
| 235 | 3300046474 | Ga0495605_0046623 | Ga0495605_0046623_1491_1868 | 125 |
| 236 | 3300046491 | Ga0495584_0000679 | Ga0495584_0000679_17570_17947 | 125 |
| 237 | 3300046491 | Ga0495584_0076068 | Ga0495584_0076068_989_1366 | 125 |
| 238 | 3300046492 | Ga0495585_0006359 | Ga0495585_0006359_2181_2558 | 125 |
| 239 | 3300046492 | Ga0495585_0021885 | Ga0495585_0021885_1476_1853 | 125 |
| 240 | 3300046492 | Ga0495585_0081750 | Ga0495585_0081750_964_1341 | 125 |
| 241 | 3300046492 | Ga0495585_0110988 | Ga0495585_0110988_426_803 | 125 |
| 242 | 3300046501 | Ga0495607_0018708 | Ga0495607_0018708_2124_2501 | 125 |
| 243 | 3300046501 | Ga0495607_0042491 | Ga0495607_0042491_2009_2386 | 125 |
| 244 | 3300046501 | Ga0495607_0042554 | Ga0495607_0042554_1322_1699 | 125 |
| 245 | 3300046501 | Ga0495607_0045783 | Ga0495607_0045783_1889_2266 | 125 |
| 246 | 3300046506 | Ga0495583_0000035 | Ga0495583_0000035_145303_145680 | 125 |
| 247 | 3300046512 | Ga0495610_0012311 | Ga0495610_0012311_1887_2264 | 125 |
| 248 | 3300046513 | Ga0495616_0027534 | Ga0495616_0027534_867_1244 | 125 |
| 249 | 3300046513 | Ga0495616_0034346 | Ga0495616_0034346_1823_2200 | 125 |
| 250 | 3300046523 | Ga0495644_0001693 | Ga0495644_0001693_3800_4177 | 125 |
| 251 | 3300046523 | Ga0495644_0002536 | Ga0495644_0002536_1913_2290 | 125 |
| 252 | 3300046524 | Ga0495648_0007552 | Ga0495648_0007552_3264_3641 | 125 |
| 253 | 3300046538 | Ga0495609_0002881 | Ga0495609_0002881_552_929 | 125 |
| 254 | 3300046538 | Ga0495609_0026683 | Ga0495609_0026683_2221_2598 | 125 |
| 255 | 3300046557 | Ga0495622_0067591 | Ga0495622_0067591_622_999 | 125 |
| 256 | 3300046558 | Ga0495633_0002941 | Ga0495633_0002941_5171_5548 | 125 |
| 257 | 3300046558 | Ga0495633_0006027 | Ga0495633_0006027_6692_7069 | 125 |
| 258 | 3300046615 | Ga0495656_0090036 | Ga0495656_0090036_406_783 | 125 |
| 259 | 3300046648 | Ga0495611_0012291 | Ga0495611_0012291_1384_1761 | 125 |
| 260 | 3300046660 | Ga0495625_0038313 | Ga0495625_0038313_1142_1519 | 125 |
| 261 | 3300046660 | Ga0495625_0130266 | Ga0495625_0130266_434_811 | 125 |
| 262 | 3300046664 | Ga0495659_0000713 | Ga0495659_0000713_6282_6659 | 125 |
| 263 | 3300046665 | Ga0495661_0070125 | Ga0495661_0070125_1217_1594 | 125 |
| 264 | 3300046665 | Ga0495661_0072654 | Ga0495661_0072654_859_1236 | 125 |
| 265 | 3300046665 | Ga0495661_0265405 | Ga0495661_0265405_352_729 | 125 |
| 266 | 3300046691 | Ga0495670_0000138 | Ga0495670_0000138_14208_14585 | 125 |
| 267 | 3300046691 | Ga0495670_0009318 | Ga0495670_0009318_4112_4489 | 125 |
| 268 | 3300046692 | Ga0495671_0017062 | Ga0495671_0017062_314_691 | 125 |
| 269 | 3300046692 | Ga0495671_0470028 | Ga0495671_0470028_123_500 | 125 |
| 270 | 3300046794 | Ga0495589_0442340 | Ga0495589_0442340_99_476 | 125 |
| 271 | 3300046810 | Ga0495660_0411931 | Ga0495660_0411931_174_551 | 125 |
| 272 | 3300047318 | Ga0495636_0002263 | Ga0495636_0002263_3265_3642 | 125 |
| 273 | 3300047320 | Ga0495672_0014739 | Ga0495672_0014739_3084_3461 | 125 |
| 274 | 3300047323 | Ga0495683_0073654 | Ga0495683_0073654_121_498 | 125 |
| 275 | 3300047323 | Ga0495683_0076636 | Ga0495683_0076636_319_696 | 125 |
| 276 | 3300047443 | Ga0495687_003311 | Ga0495687_003311_7650_8027 | 125 |
| 277 | 3300047445 | Ga0495677_0005761 | Ga0495677_0005761_1077_1454 | 125 |
| 278 | 3300047445 | Ga0495677_0014048 | Ga0495677_0014048_75_452 | 125 |
| 279 | 3300047447 | Ga0495685_000019 | Ga0495685_000019_7398_7775 | 125 |
| 280 | 3300047469 | Ga0495673_0009679 | Ga0495673_0009679_1353_1730 | 125 |
| 281 | 3300047469 | Ga0495673_0086928 | Ga0495673_0086928_388_765 | 125 |
| 282 | 3300047472 | Ga0495686_0184937 | Ga0495686_0184937_91_468 | 125 |
| 283 | 3300049459 | Ga0495678_006169 | Ga0495678_006169_3260_3637 | 125 |
| 284 | 3300049460 | Ga0495682_0000094 | Ga0495682_0000094_62206_62583 | 125 |
| 285 | 3300049460 | Ga0495682_0003862 | Ga0495682_0003862_5640_6017 | 125 |
| 286 | 3300003771 | Ga0055526_1002286 | Ga0055526_10022866 | 126 |
| 287 | 3300003773 | Ga0055537_1000012 | Ga0055537_100001227 | 126 |
| 288 | 3300003784 | Ga0055534_1000282 | Ga0055534_10002826 | 126 |
| 289 | 3300003790 | Ga0055528_1000073 | Ga0055528_100007345 | 126 |
| 290 | 3300005335 | Ga0070666_11069222 | Ga0070666_110692221 | 126 |
| 291 | 3300005367 | Ga0070667_100035617 | Ga0070667_1000356173 | 126 |
| 292 | 3300005367 | Ga0070667_100066324 | Ga0070667_1000663242 | 126 |
| 293 | 3300005617 | Ga0068859_101659730 | Ga0068859_1016597302 | 126 |
| 294 | 3300005842 | Ga0068858_100011569 | Ga0068858_1000115697 | 126 |
| 295 | 3300005842 | Ga0068858_101908505 | Ga0068858_1019085052 | 126 |
| 296 | 3300005843 | Ga0068860_101081898 | Ga0068860_1010818982 | 126 |
| 297 | 3300006881 | Ga0068865_100718148 | Ga0068865_1007181482 | 126 |
| 298 | 3300006931 | Ga0097620_101659760 | Ga0097620_1016597602 | 126 |
| 299 | 3300009101 | Ga0105247_10208716 | Ga0105247_102087162 | 126 |
| 300 | 3300009177 | Ga0105248_10940238 | Ga0105248_109402381 | 126 |
| 301 | 3300014968 | Ga0157379_10007873 | Ga0157379_100078738 | 126 |
| 302 | 3300021361 | Ga0213872_10000028 | Ga0213872_1000002834 | 126 |
| 303 | 3300025208 | Ga0209436_115776 | Ga0209436_1157763 | 126 |
| 304 | 3300025263 | Ga0209565_1000057 | Ga0209565_100005730 | 126 |
| 305 | 3300025273 | Ga0209673_1000051 | Ga0209673_1000051258 | 126 |
| 306 | 3300025284 | Ga0209130_1000268 | Ga0209130_100026832 | 126 |
| 307 | 3300025291 | Ga0209675_1000027 | Ga0209675_1000027258 | 126 |
| 308 | 3300025295 | Ga0209564_1000094 | Ga0209564_100009429 | 126 |
| 309 | 3300025299 | Ga0209256_1000139 | Ga0209256_100013929 | 126 |
| 310 | 3300025941 | Ga0207711_10999192 | Ga0207711_109991922 | 126 |
| 311 | 3300025972 | Ga0207668_11151175 | Ga0207668_111511752 | 126 |
| 312 | 3300025986 | Ga0207658_10024644 | Ga0207658_100246442 | 126 |
| 313 | 3300025986 | Ga0207658_10875280 | Ga0207658_108752802 | 126 |
| 314 | 3300026035 | Ga0207703_10317953 | Ga0207703_103179533 | 126 |
| 315 | 3300026089 | Ga0207648_10247673 | Ga0207648_102476732 | 126 |
| 316 | 3300039447 | Ga0436361_0420505 | Ga0436361_0420505_24591_24983 | 126 |
| 317 | 3300046524 | Ga0495648_0212396 | Ga0495648_0212396_269_655 | 126 |
| 318 | 3300048903 | Ga0496100_0179799 | Ga0496100_0179799_836_1216 | 126 |
| 319 | 3300048904 | Ga0496101_0557428 | Ga0496101_0557428_403_783 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gtx-assembly2.cif.gz_B | crystal structure of mutated buckwheat glutaredoxin | 0.8814 | 20 | 120 |
| 5kqa-assembly1.cif.gz_A | crystal structure of buckwheat glutaredoxin-glutathione complex | 0.8769 | 26 | 119 |
| 1z7r-assembly1.cif.gz_A | solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides | 0.8727 | 20 | 119 |
| 3uiw-assembly1.cif.gz_A | zebrafish grx2 (apo) | 0.8712 | 25 | 125 |
| 2e7p-assembly5.cif.gz_D | crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides | 0.8675 | 26 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54EX7_20_123_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9278 | 21 | 122 | 3.40.30.10 |
| af_Q54EX7_20_123_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9021 | 21 | 122 | 3.40.30.10 |
| af_O36032_1_101_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8852 | 25 | 119 | 3.40.30.10 |
| af_B6SN61_11_124_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8847 | 26 | 120 | 3.40.30.10 |
| af_Q923X4_47_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8805 | 26 | 120 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3ZT27-F1-model_v4 | Glutaredoxin | 0.9867 | 1 | 102 |
|
| AF-U4UU52-F1-model_v4 | Glutaredoxin-like protein | 0.9846 | 3 | 115 |
|
| AF-A0A2A5CMU6-F1-model_v4 | Glutaredoxin | 0.9805 | 1 | 112 |
GO:0015035
|
| AF-A0A1J5LCK1-F1-model_v4 | Glutaredoxin | 0.9797 | 3 | 112 |
|
| AF-A0A437RS02-F1-model_v4 | Glutaredoxin | 0.9778 | 1 | 121 |
GO:0005737
GO:0015038 GO:0034599 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar