F405104

General Info

Members Datasets Scaffolds Average Seq Length
319 229 319 124

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10016769|Ga0207710_100167692
Length 136
Sequence LTRLTRPLLDPARVAPAAASRIADFHRGVLDDVRKAVERDAVVVVGMAQNPHVRNVRRALTAAGVQFTYLEYGSYFSKWRERLAIKMWTGWPTFPQVFLRGTLLGGEDLTKAALADGTIQARVHANGTNGAARAVS

Samples

Sample ID Description Type Environment
1 2044078004 Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.36
Nodule 0
Rhizoplane 2.19
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 PVR_F548DK201DV3T5 2044078004 Unclassified 502
2 JGI25158J39367_1001447 3300002739 Bacteria 4160
3 JGI25158J39367_1005889 3300002739 Bacteria 1775
4 JGI25150J39212_1002406 3300002774 Bacteria 4681
5 JGI25159J45721_1010116 3300002987 Bacteria 2432
6 JGI25161J50226_1000322 3300003374 Bacteria 26179
7 Ga0055526_1011550 3300003771 Bacteria 3961
8 Ga0055537_1008210 3300003773 Bacteria 2433
9 Ga0055528_1006841 3300003790 Bacteria 5121
10 Ga0055531_10032036 3300003794 Bacteria 1726
11 Ga0055543_1000538 3300004625 Bacteria 21337
12 Ga0065165_1001776 3300005262 Bacteria 21337
13 Ga0065707_10083556 3300005295 Bacteria 8787
14 Ga0070683_100015141 3300005329 Bacteria 6769
15 Ga0070683_101320176 3300005329 Bacteria 693
16 Ga0068869_100164208 3300005334 Bacteria 1731
17 Ga0070666_10451483 3300005335 Bacteria 928
18 Ga0070689_100003790 3300005340 Bacteria 10127
19 Ga0070688_101703676 3300005365 Archaea 516
20 Ga0070701_10730167 3300005438 Bacteria 669
21 Ga0070700_100055245 3300005441 Bacteria 2485
22 Ga0070694_100807279 3300005444 Bacteria 770
23 Ga0070694_101613234 3300005444 Bacteria 551
24 Ga0070708_100503832 3300005445 Bacteria 1142
25 Ga0070663_100386467 3300005455 Bacteria 1141
26 Ga0068867_100099638 3300005459 Bacteria 2217
27 Ga0068867_100446667 3300005459 Bacteria 1101
28 Ga0068867_101456839 3300005459 Bacteria 636
29 Ga0068867_102124099 3300005459 Bacteria 532
30 Ga0070698_101828441 3300005471 Unclassified 560
31 Ga0070699_100588904 3300005518 Bacteria 1014
32 Ga0070684_100010917 3300005535 Bacteria 7218
33 Ga0070684_100583529 3300005535 Bacteria 1039
34 Ga0070672_100002864 3300005543 Bacteria 11080
35 Ga0070686_100955872 3300005544 Bacteria 700
36 Ga0070695_101746057 3300005545 Bacteria 521
37 Ga0070696_100281643 3300005546 Bacteria 1268
38 Ga0070665_100161630 3300005548 Bacteria 2242
39 Ga0070704_100018736 3300005549 Bacteria 4434
40 Ga0070704_101203649 3300005549 Bacteria 691
41 Ga0068852_100678262 3300005616 Bacteria 1040
42 Ga0068859_100072587 3300005617 Bacteria 3478
43 Ga0068859_100238925 3300005617 Bacteria 1905
44 Ga0068859_101024240 3300005617 Bacteria 907
45 Ga0068859_101753926 3300005617 Bacteria 686
46 Ga0068866_11344166 3300005718 Bacteria 520
47 Ga0068861_100044771 3300005719 Bacteria 3329
48 Ga0068861_101494528 3300005719 Bacteria 663
49 Ga0068851_10390680 3300005834 Bacteria 817
50 Ga0068863_101559686 3300005841 Bacteria 669
51 Ga0068858_100832541 3300005842 Bacteria 901
52 Ga0068858_101083018 3300005842 Bacteria 786
53 Ga0068860_100405999 3300005843 Bacteria 1348
54 Ga0068862_100182370 3300005844 Bacteria 1885
55 Ga0075365_10830333 3300006038 Bacteria 652
56 Ga0075364_10006450 3300006051 Bacteria 6892
57 Ga0075364_10181053 3300006051 Bacteria 1426
58 Ga0075432_10553158 3300006058 Bacteria 520
59 Ga0075362_10167323 3300006177 Bacteria 1061
60 Ga0075369_10006691 3300006186 Bacteria 4370
61 Ga0075369_10251264 3300006186 Bacteria 821
62 Ga0075366_10012339 3300006195 Bacteria 4845
63 Ga0075366_10095694 3300006195 Bacteria 1780
64 Ga0097621_101196730 3300006237 Unclassified 716
65 Ga0075370_10056112 3300006353 Bacteria 2238
66 Ga0068871_100838457 3300006358 Bacteria 849
67 Ga0068871_101358318 3300006358 Bacteria 669
68 Ga0075428_100093629 3300006844 Bacteria 3276
69 Ga0075428_100179840 3300006844 Bacteria 2290
70 Ga0075430_100045954 3300006846 Bacteria 3688
71 Ga0075431_100200730 3300006847 Bacteria 2040
72 Ga0075434_100568216 3300006871 Bacteria 1153
73 Ga0075429_100051509 3300006880 Bacteria 3582
74 Ga0075429_100751535 3300006880 Bacteria 854
75 Ga0068865_100798588 3300006881 Bacteria 814
76 Ga0068865_101692202 3300006881 Bacteria 570
77 Ga0097620_100072585 3300006931 Bacteria 3478
78 Ga0097620_100238924 3300006931 Bacteria 1905
79 Ga0097620_101024477 3300006931 Bacteria 907
80 Ga0097620_101754169 3300006931 Bacteria 686
81 Ga0111539_10028293 3300009094 Bacteria 6841
82 Ga0105247_10013295 3300009101 Bacteria 4941
83 Ga0114129_10032809 3300009147 Bacteria 7337
84 Ga0114129_10222011 3300009147 Bacteria 2549
85 Ga0105243_10079367 3300009148 Bacteria 2675
86 Ga0105243_10200622 3300009148 Bacteria 1749
87 Ga0105242_10486756 3300009176 Bacteria 1170
88 Ga0105248_10073772 3300009177 Bacteria 3835
89 Ga0105249_10047621 3300009553 Bacteria 3907
90 Ga0105249_10188223 3300009553 Bacteria 2013
91 Ga0105239_10060140 3300010375 Unclassified 4169
92 Ga0157371_10721218 3300013102 Bacteria 747
93 Ga0157378_10964025 3300013297 Bacteria 886
94 Ga0163162_10079878 3300013306 Bacteria 3337
95 Ga0163162_10229716 3300013306 Bacteria 1986
96 Ga0163162_10548166 3300013306 Bacteria 1285
97 Ga0157375_10007071 3300013308 Bacteria 9798
98 Ga0157375_10525474 3300013308 Bacteria 1346
99 Ga0163163_10304465 3300014325 Bacteria 1646
100 Ga0157380_10062489 3300014326 Bacteria 2983
101 Ga0157380_11480609 3300014326 Bacteria 731
102 Ga0157376_10001256 3300014969 Bacteria 16697
103 Ga0157376_11080121 3300014969 Bacteria 828
104 Ga0157376_11364186 3300014969 Bacteria 740
105 Ga0163161_10035645 3300017792 Bacteria 3562
106 Ga0163161_10107400 3300017792 Bacteria 2083
107 Ga0163161_10309434 3300017792 Bacteria 1246
108 Ga0163161_10815078 3300017792 Bacteria 785
109 Ga0163161_12093903 3300017792 Archaea 503
110 Ga0209436_100103 3300025208 Bacteria 42000
111 Ga0209436_100420 3300025208 Bacteria 19033
112 Ga0207425_1000059 3300025245 Bacteria 146258
113 Ga0209129_1004006 3300025258 Bacteria 6043
114 Ga0209565_1000650 3300025263 Bacteria 22352
115 Ga0209673_1037070 3300025273 Bacteria 1437
116 Ga0209130_1001032 3300025284 Bacteria 21351
117 Ga0209130_1001339 3300025284 Bacteria 16659
118 Ga0209675_1001646 3300025291 Bacteria 12453
119 Ga0209564_1001700 3300025295 Bacteria 20834
120 Ga0209050_1000046 3300025298 Bacteria 386466
121 Ga0209256_1002548 3300025299 Bacteria 14583
122 Ga0207426_1003798 3300025302 Bacteria 7838
123 Ga0209257_1000068 3300025304 Bacteria 341291
124 Ga0207710_10016769 3300025900 Bacteria 3101
125 Ga0207680_10759667 3300025903 Bacteria 695
126 Ga0207646_10278080 3300025922 Unclassified 1513
127 Ga0207700_11510144 3300025928 Bacteria 596
128 Ga0207709_10207511 3300025935 Bacteria 1404
129 Ga0207709_11322936 3300025935 Bacteria 596
130 Ga0207670_10002876 3300025936 Bacteria 9081
131 Ga0207670_10786353 3300025936 Bacteria 792
132 Ga0207669_11185556 3300025937 Bacteria 647
133 Ga0207704_10088455 3300025938 Bacteria 2026
134 Ga0207691_10037610 3300025940 Bacteria 4481
135 Ga0207691_10110334 3300025940 Bacteria 2447
136 Ga0207711_10266759 3300025941 Bacteria 1575
137 Ga0207661_10052501 3300025944 Bacteria 3257
138 Ga0207667_11093769 3300025949 Unclassified 781
139 Ga0207651_10768772 3300025960 Bacteria 852
140 Ga0207712_10063462 3300025961 Bacteria 2630
141 Ga0207712_11232245 3300025961 Bacteria 668
142 Ga0207668_10428884 3300025972 Bacteria 1124
143 Ga0207677_10864677 3300026023 Bacteria 813
144 Ga0207703_10143124 3300026035 Bacteria 2077
145 Ga0207703_10346836 3300026035 Bacteria 1366
146 Ga0207708_10023713 3300026075 Bacteria 4638
147 Ga0207708_10570734 3300026075 Bacteria 956
148 Ga0207648_10004572 3300026089 Bacteria 14186
149 Ga0207676_10394345 3300026095 Bacteria 1292
150 Ga0207676_11418283 3300026095 Bacteria 691
151 Ga0207674_10602315 3300026116 Bacteria 1061
152 Ga0207675_100005538 3300026118 Bacteria 12078
153 Ga0207675_101334247 3300026118 Bacteria 738
154 Ga0207683_10503425 3300026121 Bacteria 1119
155 Ga0207698_10027260 3300026142 Bacteria 4054
156 Ga0268266_10631048 3300028379 Bacteria 1030
157 Ga0268266_10989112 3300028379 Bacteria 814
158 Ga0268265_10022190 3300028380 Bacteria 4457
159 Ga0265319_1000821 3300028563 Bacteria 19821
160 Ga0265334_10003041 3300028573 Bacteria 7661
161 Ga0265318_10000638 3300028577 Bacteria 24155
162 Ga0265318_10001669 3300028577 Bacteria 12768
163 Ga0265318_10113531 3300028577 Unclassified 996
164 Ga0265338_10146604 3300028800 Bacteria 1840
165 Ga0307511_10003441 3300030521 Bacteria 16271
166 Ga0265760_10152488 3300031090 Bacteria 759
167 Ga0265760_10380862 3300031090 Unclassified 507
168 Ga0265330_10001474 3300031235 Bacteria 13695
169 Ga0265330_10229363 3300031235 Bacteria 783
170 Ga0265332_10000768 3300031238 Bacteria 19741
171 Ga0265328_10001686 3300031239 Bacteria 10110
172 Ga0265328_10135343 3300031239 Unclassified 923
173 Ga0265320_10000965 3300031240 Bacteria 21395
174 Ga0265320_10023142 3300031240 Bacteria 3312
175 Ga0265320_10444585 3300031240 Bacteria 572
176 Ga0265325_10000303 3300031241 Bacteria 34616
177 Ga0265325_10085158 3300031241 Bacteria 1566
178 Ga0265329_10000778 3300031242 Bacteria 16200
179 Ga0265340_10001239 3300031247 Bacteria 14631
180 Ga0265340_10002870 3300031247 Bacteria 9812
181 Ga0265339_10006508 3300031249 Bacteria 7656
182 Ga0265331_10000965 3300031250 Bacteria 22854
183 Ga0265316_10002832 3300031344 Bacteria 17752
184 Ga0265316_10010099 3300031344 Bacteria 8628
185 Ga0307408_101367928 3300031548 Bacteria 665
186 Ga0265313_10001154 3300031595 Bacteria 25235
187 Ga0265313_10001214 3300031595 Bacteria 24621
188 Ga0307514_10343104 3300031649 Bacteria 802
189 Ga0316575_10046836 3300031665 Bacteria 1718
190 Ga0265314_10001836 3300031711 Bacteria 22820
191 Ga0265342_10001171 3300031712 Bacteria 24940
192 Ga0307406_11353575 3300031901 Bacteria 623
193 Ga0307412_11617165 3300031911 Bacteria 592
194 Ga0307409_100306942 3300031995 Bacteria 1479
195 Ga0307409_100666907 3300031995 Bacteria 1036
196 Ga0307416_100836816 3300032002 Bacteria 1018
197 Ga0307416_100889786 3300032002 Bacteria 990
198 Ga0307411_10300677 3300032005 Unclassified 1287
199 Ga0307507_10143777 3300033179 Bacteria 1819
200 Ga0307507_10268043 3300033179 Unclassified 1082
201 Ga0373938_0103018 3300034957 Bacteria 719
202 Ga0373934_0076208 3300035086 Bacteria 1345
203 Ga0373936_0098832 3300035113 Bacteria 1230
204 Ga0373939_0394755 3300035114 Bacteria 572
205 Ga0373960_0035071 3300035121 Bacteria 1422
206 Ga0373943_0407410 3300035170 Bacteria 786
207 Ga0373955_0268497 3300035172 Bacteria 1025
208 Ga0316574_0540083 3300035398 Unclassified 724
209 Ga0373927_0087706 3300035695 Bacteria 2020
210 Ga0373927_0785594 3300035695 Bacteria 629
211 Ga0373937_0394922 3300036401 Bacteria 1312
212 Ga0373937_1144712 3300036401 Bacteria 727
213 Ga0373925_0055718 3300037068 Bacteria 2960
214 Ga0373925_0087353 3300037068 Bacteria 2380
215 Ga0395905_0485498 3300037471 Bacteria 1135
216 Ga0436364_1181603 3300037853 Unclassified 553
217 Ga0436365_0232429 3300039437 Bacteria 3838
218 Ga0436365_1660039 3300039437 Bacteria 1263
219 Ga0436365_1927314 3300039437 Unclassified 556
220 Ga0436363_1674972 3300039450 Bacteria 843
221 Ga0451791_1632274 3300041451 Bacteria 505
222 Ga0451837_0005296 3300041494 Bacteria 657
223 Ga0451837_0971213 3300041494 Unclassified 1598
224 Ga0451577_0003669 3300042876 Bacteria 16820
225 Ga0466969_0025616 3300044656 Bacteria 3031
226 Ga0466969_0091535 3300044656 Bacteria 1441
227 Ga0466965_0322157 3300044683 Unclassified 842
228 Ga0466965_0421968 3300044683 Bacteria 739
229 Ga0466966_0059291 3300044684 Bacteria 2417
230 Ga0453684_0369124 3300044712 Bacteria 1614
231 Ga0453684_1093506 3300044712 Bacteria 843
232 Ga0466971_0469117 3300044719 Bacteria 619
233 Ga0466970_0154408 3300044765 Bacteria 1268
234 Ga0466959_1044576 3300045049 Bacteria 544
235 Ga0451576_2712465 3300045051 Bacteria 504
236 Ga0495650_0002369 3300046471 Bacteria 15468
237 Ga0495639_0563130 3300046475 Bacteria 584
238 Ga0495664_0114003 3300046477 Bacteria 1633
239 Ga0495594_0135978 3300046499 Bacteria 1393
240 Ga0495606_0231999 3300046507 Bacteria 1034
241 Ga0495652_0379329 3300046529 Bacteria 1006
242 Ga0495640_0144756 3300046533 Bacteria 1530
243 Ga0495586_0026793 3300046535 Bacteria 3085
244 Ga0495598_0182296 3300046537 Bacteria 750
245 Ga0495621_0157735 3300046539 Bacteria 896
246 Ga0495667_0317921 3300046559 Bacteria 985
247 Ga0495635_0420542 3300046663 Bacteria 886
248 Ga0495635_0824941 3300046663 Bacteria 597
249 Ga0495659_0007149 3300046664 Bacteria 3535
250 Ga0495657_0418196 3300046675 Bacteria 787
251 Ga0495599_0361722 3300046678 Bacteria 869
252 Ga0495623_0636357 3300046679 Bacteria 551
253 Ga0495604_0091180 3300047317 Bacteria 2261
254 Ga0495604_0962331 3300047317 Bacteria 530
255 Ga0495636_0025128 3300047318 Bacteria 2417
256 Ga0495636_0135794 3300047318 Bacteria 1096
257 Ga0495680_0447186 3300047322 Bacteria 885
258 Ga0495680_0485789 3300047322 Bacteria 840
259 Ga0495680_0833537 3300047322 Bacteria 600
260 Ga0495675_0233572 3300047444 Bacteria 1109
261 Ga0495615_0017406 3300048090 Bacteria 1565
262 Ga0495615_0038333 3300048090 Bacteria 1184
263 Ga0495615_0051214 3300048090 Bacteria 1063
264 Ga0496100_0585732 3300048903 Bacteria 865
265 Ga0496100_1125780 3300048903 Bacteria 619
266 Ga0496102_1471044 3300048905 Bacteria 600
267 Ga0496104_0017267 3300048907 Bacteria 6567
268 Ga0496105_0053350 3300048908 Bacteria 3339
269 Ga0496115_0258278 3300048918 Bacteria 1433
270 Ga0496121_0104908 3300048924 Bacteria 2170
271 Ga0501034_0081028 3300049571 Bacteria 3249
272 Ga0501037_0307364 3300049573 Bacteria 1100
273 Ga0501039_0599474 3300049575 Bacteria 863
274 Ga0501041_0126291 3300049577 Bacteria 1592
275 Ga0501046_0457876 3300049580 Bacteria 917
276 Ga0501047_0018090 3300049581 Bacteria 6754
277 Ga0501048_0110831 3300049582 Bacteria 1938
278 Ga0501068_0106493 3300049584 Bacteria 1741
279 Ga0501071_0139864 3300049587 Bacteria 1802
280 Ga0501072_0091440 3300049588 Bacteria 2416
281 Ga0501073_1010221 3300049589 Bacteria 572
282 Ga0501075_0114275 3300049591 Bacteria 2052
283 Ga0501076_0215858 3300049592 Bacteria 1568
284 Ga0501079_0005393 3300049741 Bacteria 9525
285 Ga0501080_0004686 3300049742 Bacteria 12197
286 Ga0501081_0095026 3300049743 Bacteria 2101
287 Ga0501083_0002809 3300049744 Bacteria 12017
288 Ga0501263_016796 3300049760 Unclassified 956
289 Ga0501045_0486302 3300049824 Bacteria 917
290 nmdc:mga00v17_109401_c1 3300050491 Bacteria 1752
291 nmdc:mga00v17_215293_c1 3300050491 Bacteria 1243
292 nmdc:mga0k408_135712_c1 3300050493 Bacteria 1462
293 nmdc:mga0k408_150430_c1 3300050493 Bacteria 1386
294 nmdc:mga0k408_370350_c1 3300050493 Bacteria 854
295 nmdc:mga0k408_97739_c1 3300050493 Bacteria 1729
296 nmdc:mga06z11_260282_c1 3300050494 Bacteria 1023
297 nmdc:mga07m45_307731_c1 3300050496 Bacteria 921
298 nmdc:mga07m45_36503_c1 3300050496 Bacteria 2737
299 nmdc:mga05p37_18781_c1 3300050507 Bacteria 8355
300 nmdc:mga05p37_1959457_c1 3300050507 Bacteria 556
301 nmdc:mga09592_36795_c1 3300050508 Bacteria 4102
302 nmdc:mga09592_472144_c1 3300050508 Bacteria 1081
303 nmdc:mga0qj67_319769_c1 3300050509 Bacteria 1256
304 nmdc:mga06r32_126271_c1 3300050510 Bacteria 2527
305 nmdc:mga06r32_367435_c1 3300050510 Bacteria 1422
306 nmdc:mga08y16_410232_c1 3300050511 Bacteria 1385
307 nmdc:mga08y16_94688_c1 3300050511 Bacteria 3111
308 nmdc:mga0sz30_37135_c1 3300050516 Bacteria 2038
309 Ga0495601_0433353 3300053077 Bacteria 851
310 Ga0495619_0183398 3300053085 Bacteria 1448
311 Ga0495619_0319986 3300053085 Bacteria 1074
312 Ga0500583_0038178 3300053092 Bacteria 2161
313 Ga0500641_0038922 3300053096 Bacteria 1913
314 Ga0500637_0093400 3300053178 Bacteria 1743
315 Ga0500637_0170123 3300053178 Bacteria 1253
316 Ga0500637_0175556 3300053178 Bacteria 1230
317 Ga0501084_0014632 3300054114 Bacteria 6504
318 Ga0501082_0268487 3300060353 Bacteria 1485
319 Ga0530510_0027953 3300061734 Bacteria 4043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0007149 Ga0495659_0007149_290_628 102
2 3300005329 Ga0070683_101320176 Ga0070683_1013201761 106
3 3300005535 Ga0070684_100583529 Ga0070684_1005835291 106
4 3300006871 Ga0075434_100568216 Ga0075434_1005682162 106
5 3300033179 Ga0307507_10268043 Ga0307507_102680432 106
6 3300035086 Ga0373934_0076208 Ga0373934_0076208_110_451 106
7 3300039437 Ga0436365_1660039 Ga0436365_1660039_909_1253 106
8 3300045051 Ga0451576_2712465 Ga0451576_2712465_113_442 106
9 3300048090 Ga0495615_0051214 Ga0495615_0051214_579_932 107
10 3300005459 Ga0068867_102124099 Ga0068867_1021240991 108
11 3300046507 Ga0495606_0231999 Ga0495606_0231999_100_456 108
12 3300048924 Ga0496121_0104908 Ga0496121_0104908_871_1227 108
13 3300006051 Ga0075364_10181053 Ga0075364_101810532 109
14 3300006177 Ga0075362_10167323 Ga0075362_101673232 109
15 3300006195 Ga0075366_10095694 Ga0075366_100956943 109
16 3300009176 Ga0105242_10486756 Ga0105242_104867562 109
17 3300046678 Ga0495599_0361722 Ga0495599_0361722_240_596 109
18 3300048903 Ga0496100_0585732 Ga0496100_0585732_261_620 109
19 3300050491 nmdc:mga00v17_215293_c1 nmdc:mga00v17_215293_c1_306_662 109
20 3300050493 nmdc:mga0k408_135712_c1 nmdc:mga0k408_135712_c1_21_377 109
21 3300050494 nmdc:mga06z11_260282_c1 nmdc:mga06z11_260282_c1_619_975 109
22 3300050496 nmdc:mga07m45_307731_c1 nmdc:mga07m45_307731_c1_121_477 109
23 3300035695 Ga0373927_0785594 Ga0373927_0785594_139_501 110
24 3300041494 Ga0451837_0971213 Ga0451837_0971213_360_701 110
25 3300044712 Ga0453684_0369124 Ga0453684_0369124_866_1228 110
26 3300005295 Ga0065707_10083556 Ga0065707_100835569 111
27 3300005329 Ga0070683_100015141 Ga0070683_1000151415 111
28 3300005334 Ga0068869_100164208 Ga0068869_1001642081 111
29 3300005335 Ga0070666_10451483 Ga0070666_104514831 111
30 3300005365 Ga0070688_101703676 Ga0070688_1017036761 111
31 3300005438 Ga0070701_10730167 Ga0070701_107301671 111
32 3300005441 Ga0070700_100055245 Ga0070700_1000552452 111
33 3300005444 Ga0070694_100807279 Ga0070694_1008072792 111
34 3300005455 Ga0070663_100386467 Ga0070663_1003864672 111
35 3300005459 Ga0068867_100446667 Ga0068867_1004466672 111
36 3300005471 Ga0070698_101828441 Ga0070698_1018284411 111
37 3300005535 Ga0070684_100010917 Ga0070684_1000109173 111
38 3300005543 Ga0070672_100002864 Ga0070672_1000028642 111
39 3300005544 Ga0070686_100955872 Ga0070686_1009558721 111
40 3300005545 Ga0070695_101746057 Ga0070695_1017460572 111
41 3300005546 Ga0070696_100281643 Ga0070696_1002816431 111
42 3300005549 Ga0070704_100018736 Ga0070704_1000187363 111
43 3300005549 Ga0070704_101203649 Ga0070704_1012036492 111
44 3300005617 Ga0068859_100072587 Ga0068859_1000725875 111
45 3300005617 Ga0068859_101024240 Ga0068859_1010242401 111
46 3300005617 Ga0068859_101753926 Ga0068859_1017539262 111
47 3300005718 Ga0068866_11344166 Ga0068866_113441662 111
48 3300005719 Ga0068861_100044771 Ga0068861_1000447713 111
49 3300005844 Ga0068862_100182370 Ga0068862_1001823703 111
50 3300006058 Ga0075432_10553158 Ga0075432_105531581 111
51 3300006844 Ga0075428_100179840 Ga0075428_1001798404 111
52 3300006846 Ga0075430_100045954 Ga0075430_1000459542 111
53 3300006847 Ga0075431_100200730 Ga0075431_1002007304 111
54 3300006880 Ga0075429_100051509 Ga0075429_1000515096 111
55 3300006881 Ga0068865_101692202 Ga0068865_1016922022 111
56 3300006931 Ga0097620_100072585 Ga0097620_1000725855 111
57 3300006931 Ga0097620_101024477 Ga0097620_1010244772 111
58 3300006931 Ga0097620_101754169 Ga0097620_1017541692 111
59 3300009147 Ga0114129_10032809 Ga0114129_100328094 111
60 3300009148 Ga0105243_10079367 Ga0105243_100793673 111
61 3300009148 Ga0105243_10200622 Ga0105243_102006221 111
62 3300009553 Ga0105249_10047621 Ga0105249_100476214 111
63 3300009553 Ga0105249_10188223 Ga0105249_101882231 111
64 3300013297 Ga0157378_10964025 Ga0157378_109640252 111
65 3300013306 Ga0163162_10079878 Ga0163162_100798781 111
66 3300013308 Ga0157375_10525474 Ga0157375_105254743 111
67 3300014326 Ga0157380_10062489 Ga0157380_100624892 111
68 3300014326 Ga0157380_11480609 Ga0157380_114806091 111
69 3300014969 Ga0157376_11364186 Ga0157376_113641861 111
70 3300017792 Ga0163161_10035645 Ga0163161_100356454 111
71 3300017792 Ga0163161_12093903 Ga0163161_120939031 111
72 3300025903 Ga0207680_10759667 Ga0207680_107596672 111
73 3300025922 Ga0207646_10278080 Ga0207646_102780803 111
74 3300025935 Ga0207709_10207511 Ga0207709_102075112 111
75 3300025937 Ga0207669_11185556 Ga0207669_111855561 111
76 3300025938 Ga0207704_10088455 Ga0207704_100884551 111
77 3300025940 Ga0207691_10110334 Ga0207691_101103343 111
78 3300025944 Ga0207661_10052501 Ga0207661_100525013 111
79 3300025961 Ga0207712_10063462 Ga0207712_100634623 111
80 3300025961 Ga0207712_11232245 Ga0207712_112322451 111
81 3300025972 Ga0207668_10428884 Ga0207668_104288841 111
82 3300026023 Ga0207677_10864677 Ga0207677_108646772 111
83 3300026075 Ga0207708_10023713 Ga0207708_100237132 111
84 3300026075 Ga0207708_10570734 Ga0207708_105707342 111
85 3300026089 Ga0207648_10004572 Ga0207648_100045724 111
86 3300026095 Ga0207676_11418283 Ga0207676_114182831 111
87 3300026116 Ga0207674_10602315 Ga0207674_106023153 111
88 3300026118 Ga0207675_100005538 Ga0207675_10000553812 111
89 3300028380 Ga0268265_10022190 Ga0268265_100221903 111
90 3300031240 Ga0265320_10023142 Ga0265320_100231424 111
91 3300031995 Ga0307409_100666907 Ga0307409_1006669072 111
92 3300034957 Ga0373938_0103018 Ga0373938_0103018_29_394 111
93 3300035113 Ga0373936_0098832 Ga0373936_0098832_810_1175 111
94 3300035114 Ga0373939_0394755 Ga0373939_0394755_114_479 111
95 3300035121 Ga0373960_0035071 Ga0373960_0035071_751_1116 111
96 3300035170 Ga0373943_0407410 Ga0373943_0407410_297_662 111
97 3300035695 Ga0373927_0087706 Ga0373927_0087706_1344_1709 111
98 3300036401 Ga0373937_1144712 Ga0373937_1144712_340_705 111
99 3300037068 Ga0373925_0087353 Ga0373925_0087353_726_1091 111
100 3300041451 Ga0451791_1632274 Ga0451791_1632274_86_454 111
101 3300042876 Ga0451577_0003669 Ga0451577_0003669_933_1298 111
102 3300044683 Ga0466965_0421968 Ga0466965_0421968_271_636 111
103 3300044765 Ga0466970_0154408 Ga0466970_0154408_419_784 111
104 3300046471 Ga0495650_0002369 Ga0495650_0002369_3980_4345 111
105 3300046475 Ga0495639_0563130 Ga0495639_0563130_37_402 111
106 3300046539 Ga0495621_0157735 Ga0495621_0157735_462_827 111
107 3300048090 Ga0495615_0017406 Ga0495615_0017406_250_603 111
108 3300050493 nmdc:mga0k408_97739_c1 nmdc:mga0k408_97739_c1_37_402 111
109 3300050507 nmdc:mga05p37_18781_c1 nmdc:mga05p37_18781_c1_7401_7763 111
110 3300050508 nmdc:mga09592_36795_c1 nmdc:mga09592_36795_c1_2426_2788 111
111 3300050509 nmdc:mga0qj67_319769_c1 nmdc:mga0qj67_319769_c1_443_808 111
112 3300050510 nmdc:mga06r32_126271_c1 nmdc:mga06r32_126271_c1_1187_1549 111
113 3300050510 nmdc:mga06r32_367435_c1 nmdc:mga06r32_367435_c1_742_1107 111
114 3300050511 nmdc:mga08y16_410232_c1 nmdc:mga08y16_410232_c1_396_761 111
115 3300005445 Ga0070708_100503832 Ga0070708_1005038322 112
116 3300005459 Ga0068867_100099638 Ga0068867_1000996382 112
117 3300005518 Ga0070699_100588904 Ga0070699_1005889042 112
118 3300005616 Ga0068852_100678262 Ga0068852_1006782622 112
119 3300005617 Ga0068859_100238925 Ga0068859_1002389252 112
120 3300005719 Ga0068861_101494528 Ga0068861_1014945282 112
121 3300005834 Ga0068851_10390680 Ga0068851_103906801 112
122 3300005842 Ga0068858_100832541 Ga0068858_1008325412 112
123 3300005842 Ga0068858_101083018 Ga0068858_1010830182 112
124 3300006186 Ga0075369_10006691 Ga0075369_100066914 112
125 3300006237 Ga0097621_101196730 Ga0097621_1011967301 112
126 3300006353 Ga0075370_10056112 Ga0075370_100561122 112
127 3300006844 Ga0075428_100093629 Ga0075428_1000936292 112
128 3300006880 Ga0075429_100751535 Ga0075429_1007515352 112
129 3300006881 Ga0068865_100798588 Ga0068865_1007985882 112
130 3300006931 Ga0097620_100238924 Ga0097620_1002389242 112
131 3300009094 Ga0111539_10028293 Ga0111539_100282935 112
132 3300009177 Ga0105248_10073772 Ga0105248_100737722 112
133 3300013306 Ga0163162_10548166 Ga0163162_105481662 112
134 3300013308 Ga0157375_10007071 Ga0157375_100070712 112
135 3300014325 Ga0163163_10304465 Ga0163163_103044652 112
136 3300014969 Ga0157376_10001256 Ga0157376_1000125611 112
137 3300017792 Ga0163161_10107400 Ga0163161_101074002 112
138 3300017792 Ga0163161_10815078 Ga0163161_108150781 112
139 3300025928 Ga0207700_11510144 Ga0207700_115101441 112
140 3300025935 Ga0207709_11322936 Ga0207709_113229362 112
141 3300025936 Ga0207670_10786353 Ga0207670_107863532 112
142 3300025940 Ga0207691_10037610 Ga0207691_100376104 112
143 3300025941 Ga0207711_10266759 Ga0207711_102667592 112
144 3300025960 Ga0207651_10768772 Ga0207651_107687721 112
145 3300026035 Ga0207703_10143124 Ga0207703_101431243 112
146 3300026035 Ga0207703_10346836 Ga0207703_103468362 112
147 3300026095 Ga0207676_10394345 Ga0207676_103943452 112
148 3300026118 Ga0207675_101334247 Ga0207675_1013342472 112
149 3300026121 Ga0207683_10503425 Ga0207683_105034252 112
150 3300026142 Ga0207698_10027260 Ga0207698_100272602 112
151 3300028563 Ga0265319_1000821 Ga0265319_10008219 112
152 3300028577 Ga0265318_10000638 Ga0265318_1000063812 112
153 3300030521 Ga0307511_10003441 Ga0307511_100034417 112
154 3300031235 Ga0265330_10001474 Ga0265330_100014749 112
155 3300031238 Ga0265332_10000768 Ga0265332_100007689 112
156 3300031239 Ga0265328_10001686 Ga0265328_1000168612 112
157 3300031240 Ga0265320_10000965 Ga0265320_1000096512 112
158 3300031241 Ga0265325_10085158 Ga0265325_100851582 112
159 3300031242 Ga0265329_10000778 Ga0265329_1000077815 112
160 3300031247 Ga0265340_10002870 Ga0265340_100028707 112
161 3300031249 Ga0265339_10006508 Ga0265339_100065083 112
162 3300031250 Ga0265331_10000965 Ga0265331_1000096512 112
163 3300031344 Ga0265316_10002832 Ga0265316_100028329 112
164 3300031595 Ga0265313_10001214 Ga0265313_1000121414 112
165 3300031649 Ga0307514_10343104 Ga0307514_103431042 112
166 3300031711 Ga0265314_10001836 Ga0265314_1000183614 112
167 3300031712 Ga0265342_10001171 Ga0265342_1000117114 112
168 3300031901 Ga0307406_11353575 Ga0307406_113535751 112
169 3300031911 Ga0307412_11617165 Ga0307412_116171652 112
170 3300031995 Ga0307409_100306942 Ga0307409_1003069422 112
171 3300032002 Ga0307416_100836816 Ga0307416_1008368162 112
172 3300033179 Ga0307507_10143777 Ga0307507_101437772 112
173 3300037068 Ga0373925_0055718 Ga0373925_0055718_1862_2230 112
174 3300044656 Ga0466969_0091535 Ga0466969_0091535_968_1336 112
175 3300044683 Ga0466965_0322157 Ga0466965_0322157_102_470 112
176 3300044684 Ga0466966_0059291 Ga0466966_0059291_1119_1487 112
177 3300044719 Ga0466971_0469117 Ga0466971_0469117_118_489 112
178 3300046477 Ga0495664_0114003 Ga0495664_0114003_44_412 112
179 3300046529 Ga0495652_0379329 Ga0495652_0379329_582_947 112
180 3300046535 Ga0495586_0026793 Ga0495586_0026793_1486_1854 112
181 3300046537 Ga0495598_0182296 Ga0495598_0182296_54_428 112
182 3300046559 Ga0495667_0317921 Ga0495667_0317921_39_404 112
183 3300046663 Ga0495635_0824941 Ga0495635_0824941_157_525 112
184 3300046679 Ga0495623_0636357 Ga0495623_0636357_95_460 112
185 3300047317 Ga0495604_0091180 Ga0495604_0091180_1199_1564 112
186 3300047317 Ga0495604_0962331 Ga0495604_0962331_151_519 112
187 3300047318 Ga0495636_0025128 Ga0495636_0025128_1385_1741 112
188 3300047318 Ga0495636_0135794 Ga0495636_0135794_477_851 112
189 3300047322 Ga0495680_0447186 Ga0495680_0447186_14_379 112
190 3300047322 Ga0495680_0833537 Ga0495680_0833537_26_391 112
191 3300047444 Ga0495675_0233572 Ga0495675_0233572_157_522 112
192 3300048090 Ga0495615_0038333 Ga0495615_0038333_43_417 112
193 3300048903 Ga0496100_1125780 Ga0496100_1125780_79_444 112
194 3300048905 Ga0496102_1471044 Ga0496102_1471044_126_491 112
195 3300048918 Ga0496115_0258278 Ga0496115_0258278_929_1294 112
196 3300049571 Ga0501034_0081028 Ga0501034_0081028_2491_2859 112
197 3300050493 nmdc:mga0k408_150430_c1 nmdc:mga0k408_150430_c1_276_644 112
198 3300050496 nmdc:mga07m45_36503_c1 nmdc:mga07m45_36503_c1_1180_1548 112
199 3300050507 nmdc:mga05p37_1959457_c1 nmdc:mga05p37_1959457_c1_54_422 112
200 3300050508 nmdc:mga09592_472144_c1 nmdc:mga09592_472144_c1_272_640 112
201 3300050511 nmdc:mga08y16_94688_c1 nmdc:mga08y16_94688_c1_64_432 112
202 3300050516 nmdc:mga0sz30_37135_c1 nmdc:mga0sz30_37135_c1_279_647 112
203 3300053077 Ga0495601_0433353 Ga0495601_0433353_54_419 112
204 3300053085 Ga0495619_0183398 Ga0495619_0183398_1009_1374 112
205 3300053085 Ga0495619_0319986 Ga0495619_0319986_207_572 112
206 3300053092 Ga0500583_0038178 Ga0500583_0038178_563_931 112
207 3300053096 Ga0500641_0038922 Ga0500641_0038922_650_1018 112
208 3300053178 Ga0500637_0093400 Ga0500637_0093400_24_392 112
209 3300053178 Ga0500637_0170123 Ga0500637_0170123_154_522 112
210 3300053178 Ga0500637_0175556 Ga0500637_0175556_846_1214 112
211 3300005843 Ga0068860_100405999 Ga0068860_1004059992 113
212 3300006358 Ga0068871_100838457 Ga0068871_1008384572 113
213 3300028577 Ga0265318_10001669 Ga0265318_1000166913 113
214 3300028800 Ga0265338_10146604 Ga0265338_101466042 113
215 3300031235 Ga0265330_10229363 Ga0265330_102293632 113
216 3300031241 Ga0265325_10000303 Ga0265325_1000030324 113
217 3300031247 Ga0265340_10001239 Ga0265340_100012392 113
218 3300031344 Ga0265316_10010099 Ga0265316_100100992 113
219 3300031595 Ga0265313_10001154 Ga0265313_100011542 113
220 3300035172 Ga0373955_0268497 Ga0373955_0268497_202_561 113
221 3300046499 Ga0495594_0135978 Ga0495594_0135978_525_896 113
222 3300046533 Ga0495640_0144756 Ga0495640_0144756_728_1087 113
223 3300046663 Ga0495635_0420542 Ga0495635_0420542_309_668 113
224 3300046675 Ga0495657_0418196 Ga0495657_0418196_220_579 113
225 3300047322 Ga0495680_0485789 Ga0495680_0485789_203_562 113
226 3300048907 Ga0496104_0017267 Ga0496104_0017267_2667_3050 113
227 3300048908 Ga0496105_0053350 Ga0496105_0053350_1648_2031 113
228 3300002739 JGI25158J39367_1001447 JGI25158J39367_10014477 114
229 3300002739 JGI25158J39367_1005889 JGI25158J39367_10058893 114
230 3300002774 JGI25150J39212_1002406 JGI25150J39212_10024062 114
231 3300002987 JGI25159J45721_1010116 JGI25159J45721_10101164 114
232 3300003374 JGI25161J50226_1000322 JGI25161J50226_100032224 114
233 3300003771 Ga0055526_1011550 Ga0055526_10115506 114
234 3300003773 Ga0055537_1008210 Ga0055537_10082102 114
235 3300003790 Ga0055528_1006841 Ga0055528_10068417 114
236 3300003794 Ga0055531_10032036 Ga0055531_100320363 114
237 3300004625 Ga0055543_1000538 Ga0055543_10005383 114
238 3300005262 Ga0065165_1001776 Ga0065165_100177624 114
239 3300005340 Ga0070689_100003790 Ga0070689_1000037904 114
240 3300005444 Ga0070694_101613234 Ga0070694_1016132341 114
241 3300005459 Ga0068867_101456839 Ga0068867_1014568391 114
242 3300005548 Ga0070665_100161630 Ga0070665_1001616302 114
243 3300005841 Ga0068863_101559686 Ga0068863_1015596861 114
244 3300006038 Ga0075365_10830333 Ga0075365_108303331 114
245 3300006051 Ga0075364_10006450 Ga0075364_100064508 114
246 3300006186 Ga0075369_10251264 Ga0075369_102512641 114
247 3300006195 Ga0075366_10012339 Ga0075366_100123396 114
248 3300006358 Ga0068871_101358318 Ga0068871_1013583182 114
249 3300009101 Ga0105247_10013295 Ga0105247_100132954 114
250 3300009147 Ga0114129_10222011 Ga0114129_102220113 114
251 3300010375 Ga0105239_10060140 Ga0105239_100601403 114
252 3300013102 Ga0157371_10721218 Ga0157371_107212182 114
253 3300013306 Ga0163162_10229716 Ga0163162_102297162 114
254 3300014969 Ga0157376_11080121 Ga0157376_110801211 114
255 3300017792 Ga0163161_10309434 Ga0163161_103094342 114
256 3300025208 Ga0209436_100103 Ga0209436_10010316 114
257 3300025208 Ga0209436_100420 Ga0209436_10042014 114
258 3300025245 Ga0207425_1000059 Ga0207425_100005924 114
259 3300025258 Ga0209129_1004006 Ga0209129_10040064 114
260 3300025263 Ga0209565_1000650 Ga0209565_100065018 114
261 3300025273 Ga0209673_1037070 Ga0209673_10370702 114
262 3300025284 Ga0209130_1001032 Ga0209130_100103224 114
263 3300025284 Ga0209130_1001339 Ga0209130_10013398 114
264 3300025291 Ga0209675_1001646 Ga0209675_10016463 114
265 3300025295 Ga0209564_1001700 Ga0209564_100170016 114
266 3300025298 Ga0209050_1000046 Ga0209050_1000046322 114
267 3300025299 Ga0209256_1002548 Ga0209256_100254810 114
268 3300025302 Ga0207426_1003798 Ga0207426_10037982 114
269 3300025304 Ga0209257_1000068 Ga0209257_10000688 114
270 3300025900 Ga0207710_10016769 Ga0207710_100167692 114
271 3300025936 Ga0207670_10002876 Ga0207670_100028766 114
272 3300025949 Ga0207667_11093769 Ga0207667_110937692 114
273 3300028379 Ga0268266_10631048 Ga0268266_106310482 114
274 3300028379 Ga0268266_10989112 Ga0268266_109891122 114
275 3300028573 Ga0265334_10003041 Ga0265334_100030414 114
276 3300028577 Ga0265318_10113531 Ga0265318_101135311 114
277 3300031090 Ga0265760_10152488 Ga0265760_101524881 114
278 3300031090 Ga0265760_10380862 Ga0265760_103808621 114
279 3300031239 Ga0265328_10135343 Ga0265328_101353432 114
280 3300031240 Ga0265320_10444585 Ga0265320_104445851 114
281 3300031548 Ga0307408_101367928 Ga0307408_1013679281 114
282 3300031665 Ga0316575_10046836 Ga0316575_100468363 114
283 3300032002 Ga0307416_100889786 Ga0307416_1008897862 114
284 3300032005 Ga0307411_10300677 Ga0307411_103006772 114
285 3300035398 Ga0316574_0540083 Ga0316574_0540083_159_554 114
286 3300036401 Ga0373937_0394922 Ga0373937_0394922_747_1142 114
287 3300037471 Ga0395905_0485498 Ga0395905_0485498_218_595 114
288 3300037853 Ga0436364_1181603 Ga0436364_1181603_114_524 114
289 3300039437 Ga0436365_0232429 Ga0436365_0232429_1496_1888 114
290 3300039437 Ga0436365_1927314 Ga0436365_1927314_80_463 114
291 3300039450 Ga0436363_1674972 Ga0436363_1674972_245_637 114
292 3300041494 Ga0451837_0005296 Ga0451837_0005296_83_481 114
293 3300044656 Ga0466969_0025616 Ga0466969_0025616_1243_1623 114
294 3300044712 Ga0453684_1093506 Ga0453684_1093506_43_405 114
295 3300045049 Ga0466959_1044576 Ga0466959_1044576_138_518 114
296 3300049573 Ga0501037_0307364 Ga0501037_0307364_279_656 114
297 3300049575 Ga0501039_0599474 Ga0501039_0599474_225_602 114
298 3300049577 Ga0501041_0126291 Ga0501041_0126291_40_417 114
299 3300049580 Ga0501046_0457876 Ga0501046_0457876_201_578 114
300 3300049581 Ga0501047_0018090 Ga0501047_0018090_2086_2493 114
301 3300049582 Ga0501048_0110831 Ga0501048_0110831_949_1326 114
302 3300049584 Ga0501068_0106493 Ga0501068_0106493_390_767 114
303 3300049587 Ga0501071_0139864 Ga0501071_0139864_567_944 114
304 3300049588 Ga0501072_0091440 Ga0501072_0091440_473_850 114
305 3300049589 Ga0501073_1010221 Ga0501073_1010221_22_399 114
306 3300049591 Ga0501075_0114275 Ga0501075_0114275_511_888 114
307 3300049592 Ga0501076_0215858 Ga0501076_0215858_743_1120 114
308 3300049741 Ga0501079_0005393 Ga0501079_0005393_7167_7544 114
309 3300049742 Ga0501080_0004686 Ga0501080_0004686_3176_3553 114
310 3300049743 Ga0501081_0095026 Ga0501081_0095026_300_677 114
311 3300049744 Ga0501083_0002809 Ga0501083_0002809_4298_4705 114
312 3300049760 Ga0501263_016796 Ga0501263_016796_441_848 114
313 3300049824 Ga0501045_0486302 Ga0501045_0486302_178_555 114
314 3300050491 nmdc:mga00v17_109401_c1 nmdc:mga00v17_109401_c1_463_840 114
315 3300050493 nmdc:mga0k408_370350_c1 nmdc:mga0k408_370350_c1_332_709 114
316 3300054114 Ga0501084_0014632 Ga0501084_0014632_2449_2856 114
317 3300060353 Ga0501082_0268487 Ga0501082_0268487_961_1338 114
318 3300061734 Ga0530510_0027953 Ga0530510_0027953_2523_2900 114
319 2044078004 PVR_F548DK201DV3T5 PVR_1215040 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

42

104

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gho-assembly1.cif.gz_A crystal structure of spx in complex with yjbh 0.9518 34 63
2kok-assembly1.cif.gz_A solution structure of an arsenate reductase (arsc) related protein from brucella melitensis. seattle structural genomics center for infectious disease target braba.00007.a. 0.9154 34 64
7zzn-assembly1.cif.gz_A-2 crystal structure of poplar glutathione transferase u20 0.8996 34 109
3gkx-assembly3.cif.gz_B crystal structure of putative arsc family related protein from bacteroides fragilis 0.8973 33 63
3n5o-assembly1.cif.gz_B crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione 0.8944 32 65
ID Description Score Start End Superfamily
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9789 34 64 3.40.30.10
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9644 16 115 3.40.30.10
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9193 16 115 3.40.30.10
4pxoB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9039 37 65 3.40.30.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9032 35 67 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7S4MYB7-F1-model_v4 Glutaredoxin domain-containing protein 0.9903 20 115 GO:0005739
GO:0015035
AF-A0A1F3TT58-F1-model_v4 Glutaredoxin domain-containing protein 0.9843 10 106
AF-A0A1Y5DGA2-F1-model_v4 Glutaredoxin domain-containing protein 0.9816 19 119 GO:0015035
AF-A0A3D0UWH2-F1-model_v4 deleted 0.9791 32 110
AF-U4UU52-F1-model_v4 Glutaredoxin-like protein 0.976 12 110

Feature Viewer

pLDDT pTM Quality
92.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map