F405097
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 258 | 639 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300025225|Ga0209566_100368|Ga0209566_10036816 |
| Length | 319 |
| Sequence | MPELPEVETVRRTLSELIVGKQIKSVTVRLPRILQKPDDPDVFGAMLEGRTFTSVERRGKFLRLVLDGLVLVSHLRMEGRYGLFADDAPLDKHTHVIFHFTDGTALRYTDVRQFGTMHLFPAGEELDSPPLMKLGLEPLEAGFTVEAFRTSLGRRNTKIKPLLLNQEWIVGLGNIYVDEALHLAGIHPERNAGELKPKDWQRLHEAIVTTLTAAVEAGGSSVKSYVNGQGEMGMFQHRLRVYGRTGEACPACGHPIAKSVVGGRGTHVCAKCQKPPKGAAGPASGVSAAASRRYREGGNAVKRRLDGAADASGRDGGEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 18 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 30 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 34 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 35 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 48 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 49 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 50 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 51 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 52 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 53 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 54 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 55 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 56 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 57 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 58 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 59 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 60 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 61 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 62 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 63 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 64 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 65 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 66 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 67 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 68 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 69 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 70 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 71 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 72 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 82 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 83 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 84 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 85 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 86 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 87 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 88 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 89 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 91 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 92 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 93 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 94 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 95 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 96 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 97 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 98 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 99 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 100 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 101 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 102 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 103 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 104 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 113 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 115 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 118 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 119 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 120 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 121 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 122 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 123 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 124 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 125 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 126 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 127 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 128 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 129 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 130 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 131 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 132 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 133 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 134 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 135 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 136 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 137 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 138 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 139 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 140 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 141 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 142 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 143 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 144 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 145 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 146 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 147 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 148 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 149 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 150 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 151 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 152 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 153 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 154 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 155 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 156 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 157 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 158 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 159 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 160 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 161 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 162 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 163 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 164 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 165 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 166 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 167 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 168 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 169 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 170 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 171 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 172 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 173 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 174 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 175 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 176 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 177 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 178 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 179 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 180 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 181 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 182 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 183 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 184 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 185 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 186 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 187 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 188 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 189 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 190 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 191 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 192 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 193 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 194 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 195 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 196 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 197 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 198 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 199 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 200 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 201 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 202 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 203 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 204 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 205 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 206 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 207 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 208 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 209 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 210 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 211 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 212 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 213 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 214 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 215 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 216 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 217 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 218 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 219 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 220 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 221 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 222 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 223 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 224 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 225 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 226 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 227 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 228 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 229 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 230 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 231 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 232 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 233 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 234 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 235 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 236 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 237 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 238 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 239 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 240 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 241 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 242 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 243 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 244 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 245 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 246 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 247 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 248 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 249 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 250 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 251 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 252 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 253 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 254 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 255 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 256 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 257 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 258 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 55.17 |
| Metatranscriptomes | 0.31 |
| Isolates | 44.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.63 |
| Bulb | 0 |
| Endosphere | 7.52 |
| Nodule | 0.63 |
| Rhizoplane | 4.7 |
| Rhizosphere | 52.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209566_100368 | 3300025225 | Bacteria | 37595 |
| 2 | JGI25151J46595_10008591 | 3300003187 | Bacteria | 4896 |
| 3 | JGI25151J46595_10012958 | 3300003187 | Bacteria | 3768 |
| 4 | JGI25151J46595_10035448 | 3300003187 | Bacteria | 1895 |
| 5 | rootH1_10005765 | 3300003316 | Bacteria | 19570 |
| 6 | rootH1_10005765 | 3300003323 | Bacteria | 6456 |
| 7 | rootH2_10221815 | 3300003320 | Bacteria | 6650 |
| 8 | rootL2_10013974 | 3300003322 | Bacteria | 148551 |
| 9 | rootL2_10330782 | 3300003322 | Unclassified | 1355 |
| 10 | Ga0006562J51391_1000483 | 3300003578 | Bacteria | 10540 |
| 11 | Ga0055538_1001041 | 3300003751 | Bacteria | 6242 |
| 12 | Ga0055532_1003864 | 3300003758 | Bacteria | 2417 |
| 13 | Ga0055528_1001594 | 3300003790 | Bacteria | 13452 |
| 14 | Ga0070666_10000203 | 3300005335 | Bacteria | 40659 |
| 15 | Ga0070666_10041087 | 3300005335 | Unclassified | 3089 |
| 16 | Ga0070674_100020971 | 3300005356 | Unclassified | 4187 |
| 17 | Ga0070673_100157994 | 3300005364 | Bacteria | 1926 |
| 18 | Ga0070672_100105876 | 3300005543 | Unclassified | 2287 |
| 19 | Ga0070665_100097481 | 3300005548 | Unclassified | 2945 |
| 20 | Ga0070704_100397016 | 3300005549 | Bacteria | 1176 |
| 21 | Ga0070715_10137571 | 3300006163 | Bacteria | 1182 |
| 22 | Ga0075367_10141770 | 3300006178 | Bacteria | 1489 |
| 23 | Ga0105251_10019433 | 3300009011 | Bacteria | 3589 |
| 24 | Ga0105244_10027793 | 3300009036 | Bacteria | 3044 |
| 25 | Ga0105244_10042849 | 3300009036 | Bacteria | 2338 |
| 26 | Ga0111539_10034131 | 3300009094 | Bacteria | 6172 |
| 27 | Ga0105247_10019618 | 3300009101 | Bacteria | 4059 |
| 28 | Ga0105243_10005852 | 3300009148 | Bacteria | 9531 |
| 29 | Ga0105242_10000303 | 3300009176 | Bacteria | 39278 |
| 30 | Ga0105246_10001062 | 3300011119 | Bacteria | 15875 |
| 31 | Ga0105246_10023145 | 3300011119 | Bacteria | 4017 |
| 32 | Ga0157378_10001003 | 3300013297 | Bacteria | 25863 |
| 33 | Ga0157378_10001592 | 3300013297 | Bacteria | 20530 |
| 34 | Ga0163162_10600031 | 3300013306 | Bacteria | 1227 |
| 35 | Ga0157372_10156227 | 3300013307 | Bacteria | 2635 |
| 36 | Ga0157376_10073948 | 3300014969 | Bacteria | 2904 |
| 37 | Ga0209784_100134 | 3300025224 | Bacteria | 71273 |
| 38 | Ga0209566_100183 | 3300025225 | Bacteria | 66605 |
| 39 | Ga0209147_100190 | 3300025229 | Bacteria | 71748 |
| 40 | Ga0209147_100262 | 3300025229 | Bacteria | 48219 |
| 41 | Ga0209437_100357 | 3300025233 | Bacteria | 51450 |
| 42 | Ga0209258_101293 | 3300025242 | Bacteria | 9314 |
| 43 | Ga0209673_1001689 | 3300025273 | Bacteria | 18811 |
| 44 | Ga0209675_1018048 | 3300025291 | Bacteria | 1987 |
| 45 | Ga0209025_1005341 | 3300025294 | Bacteria | 10536 |
| 46 | Ga0209025_1005797 | 3300025294 | Bacteria | 9907 |
| 47 | Ga0209025_1005842 | 3300025294 | Bacteria | 9851 |
| 48 | Ga0209025_1019388 | 3300025294 | Bacteria | 3784 |
| 49 | Ga0209025_1024679 | 3300025294 | Bacteria | 3093 |
| 50 | Ga0207426_1007297 | 3300025302 | Bacteria | 4646 |
| 51 | Ga0207696_1003513 | 3300025711 | Bacteria | 7090 |
| 52 | Ga0207655_1006187 | 3300025728 | Bacteria | 7976 |
| 53 | Ga0207655_1052373 | 3300025728 | Bacteria | 1642 |
| 54 | Ga0207713_1000242 | 3300025735 | Bacteria | 72255 |
| 55 | Ga0207713_1018092 | 3300025735 | Bacteria | 3500 |
| 56 | Ga0207710_10100630 | 3300025900 | Bacteria | 1363 |
| 57 | Ga0207680_10000121 | 3300025903 | Bacteria | 36291 |
| 58 | Ga0207680_10010888 | 3300025903 | Bacteria | 4571 |
| 59 | Ga0207647_10000003 | 3300025904 | Bacteria | 321014 |
| 60 | Ga0207686_10041740 | 3300025934 | Bacteria | 2800 |
| 61 | Ga0207709_10020459 | 3300025935 | Bacteria | 3733 |
| 62 | Ga0207691_10155161 | 3300025940 | Unclassified | 2011 |
| 63 | Ga0207708_10212258 | 3300026075 | Bacteria | 1548 |
| 64 | Ga0207428_10120225 | 3300027907 | Bacteria | 2015 |
| 65 | Ga0307408_100041873 | 3300031548 | Bacteria | 3249 |
| 66 | Ga0316575_10025881 | 3300031665 | Bacteria | 2278 |
| 67 | Ga0316575_10077509 | 3300031665 | Bacteria | 1339 |
| 68 | Ga0316579_10009147 | 3300031691 | Bacteria | 4160 |
| 69 | Ga0316579_10011896 | 3300031691 | Bacteria | 3713 |
| 70 | Ga0316579_10014370 | 3300031691 | Bacteria | 3422 |
| 71 | Ga0316578_10006106 | 3300031728 | Bacteria | 5913 |
| 72 | Ga0316578_10138109 | 3300031728 | Bacteria | 1468 |
| 73 | Ga0307405_10327996 | 3300031731 | Bacteria | 1172 |
| 74 | Ga0316577_10035376 | 3300031733 | Bacteria | 2791 |
| 75 | Ga0316577_10036646 | 3300031733 | Bacteria | 2743 |
| 76 | Ga0316577_10080413 | 3300031733 | Bacteria | 1822 |
| 77 | Ga0307406_10326844 | 3300031901 | Bacteria | 1189 |
| 78 | Ga0307412_10517135 | 3300031911 | Bacteria | 997 |
| 79 | Ga0307409_100210193 | 3300031995 | Bacteria | 1748 |
| 80 | Ga0307416_100353919 | 3300032002 | Bacteria | 1487 |
| 81 | Ga0316580_10004096 | 3300032139 | Bacteria | 4201 |
| 82 | Ga0373962_0045781 | 3300035242 | Unclassified | 1247 |
| 83 | Ga0316574_0079625 | 3300035398 | Bacteria | 2078 |
| 84 | Ga0316574_0102384 | 3300035398 | Bacteria | 1833 |
| 85 | Ga0373947_0225231 | 3300035725 | Bacteria | 1234 |
| 86 | Ga0316584_0024827 | 3300036712 | Bacteria | 4390 |
| 87 | Ga0400488_06052 | 3300038741 | Bacteria | 2483 |
| 88 | Ga0439436_0010349 | 3300041404 | Bacteria | 2847 |
| 89 | Ga0439439_0002310 | 3300041406 | Bacteria | 4030 |
| 90 | Ga0439433_0000416 | 3300041999 | Bacteria | 7734 |
| 91 | Ga0439449_0000197 | 3300042007 | Bacteria | 21037 |
| 92 | Ga0439462_0000518 | 3300042015 | Bacteria | 7619 |
| 93 | Ga0453684_0199010 | 3300044712 | Bacteria | 2337 |
| 94 | Ga0453684_0233355 | 3300044712 | Unclassified | 2123 |
| 95 | Ga0453684_0879789 | 3300044712 | Unclassified | 961 |
| 96 | Ga0466959_0236345 | 3300045049 | Bacteria | 1263 |
| 97 | Ga0451576_0013781 | 3300045051 | Bacteria | 9032 |
| 98 | Ga0495603_0120135 | 3300046455 | Bacteria | 1531 |
| 99 | Ga0495585_0047305 | 3300046492 | Bacteria | 2396 |
| 100 | Ga0495622_0054128 | 3300046557 | Bacteria | 1862 |
| 101 | Ga0495622_0189190 | 3300046557 | Bacteria | 921 |
| 102 | Ga0495661_0032877 | 3300046665 | Bacteria | 3276 |
| 103 | Ga0495661_0084959 | 3300046665 | Bacteria | 1815 |
| 104 | Ga0495670_0232422 | 3300046691 | Bacteria | 981 |
| 105 | Ga0495649_0066473 | 3300046694 | Bacteria | 1935 |
| 106 | Ga0495660_0044066 | 3300046810 | Bacteria | 2457 |
| 107 | Ga0495660_0066562 | 3300046810 | Bacteria | 1921 |
| 108 | Ga0495676_0177677 | 3300047321 | Bacteria | 1494 |
| 109 | Ga0495683_0006210 | 3300047323 | Bacteria | 6541 |
| 110 | Ga0496100_0001656 | 3300048903 | Bacteria | 11045 |
| 111 | Ga0496100_0097225 | 3300048903 | Bacteria | 2022 |
| 112 | Ga0496101_0002804 | 3300048904 | Bacteria | 10696 |
| 113 | Ga0496102_0030507 | 3300048905 | Bacteria | 4826 |
| 114 | Ga0496103_0027585 | 3300048906 | Bacteria | 3441 |
| 115 | Ga0496104_0003934 | 3300048907 | Bacteria | 12850 |
| 116 | Ga0496105_0012839 | 3300048908 | Bacteria | 6638 |
| 117 | Ga0496106_0000224 | 3300048909 | Bacteria | 39551 |
| 118 | Ga0496107_0003741 | 3300048910 | Bacteria | 10218 |
| 119 | Ga0496108_0028043 | 3300048911 | Bacteria | 4657 |
| 120 | Ga0496110_0004762 | 3300048913 | Bacteria | 10569 |
| 121 | Ga0496110_0114697 | 3300048913 | Bacteria | 2425 |
| 122 | Ga0496111_0012436 | 3300048914 | Bacteria | 5762 |
| 123 | Ga0496113_0019042 | 3300048916 | Bacteria | 4795 |
| 124 | Ga0496116_0005178 | 3300048919 | Bacteria | 12235 |
| 125 | Ga0496116_0006945 | 3300048919 | Bacteria | 10149 |
| 126 | Ga0496116_0048629 | 3300048919 | Bacteria | 2844 |
| 127 | Ga0496116_0056290 | 3300048919 | Bacteria | 2578 |
| 128 | Ga0496116_0069184 | 3300048919 | Bacteria | 2245 |
| 129 | Ga0496116_0072831 | 3300048919 | Bacteria | 2169 |
| 130 | Ga0496116_0103107 | 3300048919 | Bacteria | 1698 |
| 131 | Ga0496117_0008853 | 3300048920 | Bacteria | 9499 |
| 132 | Ga0496117_0087075 | 3300048920 | Bacteria | 2026 |
| 133 | Ga0496118_0005682 | 3300048921 | Bacteria | 14052 |
| 134 | Ga0496118_0061118 | 3300048921 | Bacteria | 2792 |
| 135 | Ga0496119_0005766 | 3300048922 | Bacteria | 11729 |
| 136 | Ga0496119_0008471 | 3300048922 | Bacteria | 9027 |
| 137 | Ga0496119_0009285 | 3300048922 | Bacteria | 8467 |
| 138 | Ga0496120_0002515 | 3300048923 | Bacteria | 18341 |
| 139 | Ga0496120_0006991 | 3300048923 | Bacteria | 8488 |
| 140 | Ga0496120_0027741 | 3300048923 | Bacteria | 3478 |
| 141 | Ga0496120_0030992 | 3300048923 | Bacteria | 3244 |
| 142 | Ga0496121_0041254 | 3300048924 | Bacteria | 4036 |
| 143 | Ga0496122_0009411 | 3300048925 | Bacteria | 10304 |
| 144 | Ga0496122_0011678 | 3300048925 | Bacteria | 8851 |
| 145 | Ga0496122_0022837 | 3300048925 | Bacteria | 5542 |
| 146 | Ga0496122_0023292 | 3300048925 | Bacteria | 5466 |
| 147 | Ga0496122_0028747 | 3300048925 | Bacteria | 4706 |
| 148 | Ga0496122_0069980 | 3300048925 | Bacteria | 2510 |
| 149 | Ga0496122_0155783 | 3300048925 | Bacteria | 1402 |
| 150 | Ga0496123_0030628 | 3300048926 | Bacteria | 3935 |
| 151 | Ga0496123_0049507 | 3300048926 | Bacteria | 2816 |
| 152 | Ga0496123_0082326 | 3300048926 | Bacteria | 1952 |
| 153 | Ga0496124_0000183 | 3300048927 | Bacteria | 124048 |
| 154 | Ga0496124_0000335 | 3300048927 | Bacteria | 86882 |
| 155 | Ga0496124_0066518 | 3300048927 | Bacteria | 3001 |
| 156 | Ga0496124_0100974 | 3300048927 | Bacteria | 2338 |
| 157 | Ga0496124_0336848 | 3300048927 | Bacteria | 1073 |
| 158 | Ga0496125_0000535 | 3300048928 | Bacteria | 65395 |
| 159 | Ga0496125_0001459 | 3300048928 | Bacteria | 34240 |
| 160 | Ga0496125_0015306 | 3300048928 | Bacteria | 7424 |
| 161 | Ga0496125_0016268 | 3300048928 | Bacteria | 7149 |
| 162 | Ga0496126_0002544 | 3300048929 | Bacteria | 24393 |
| 163 | Ga0496126_0002731 | 3300048929 | Bacteria | 23325 |
| 164 | Ga0496126_0003379 | 3300048929 | Bacteria | 20223 |
| 165 | Ga0496126_0027546 | 3300048929 | Bacteria | 5426 |
| 166 | Ga0501039_0125297 | 3300049575 | Bacteria | 2015 |
| 167 | Ga0501041_0014783 | 3300049577 | Bacteria | 4636 |
| 168 | Ga0501042_0341087 | 3300049578 | Unclassified | 1083 |
| 169 | Ga0501046_0070473 | 3300049580 | Bacteria | 2718 |
| 170 | Ga0501072_0038811 | 3300049588 | Bacteria | 3738 |
| 171 | Ga0501076_0012809 | 3300049592 | Bacteria | 6280 |
| 172 | Ga0501079_0043009 | 3300049741 | Bacteria | 3487 |
| 173 | Ga0501045_0011905 | 3300049824 | Bacteria | 6114 |
| 174 | nmdc:mga06z11_115720_c1 | 3300050494 | Bacteria | 1490 |
| 175 | nmdc:mga08y16_417000_c1 | 3300050511 | Bacteria | 1373 |
| 176 | Ga0500628_001217 | 3300053129 | Unclassified | 4467 |
| 177 | Ga0501084_0039790 | 3300054114 | Bacteria | 3932 |
| 178 | Ga0501082_0218283 | 3300060353 | Bacteria | 1659 |
| 179 | 2511179517 | 2510917027 | Bacteria | 5287437 |
| 180 | 2511700579 | 2511231119 | Bacteria | 4019861 |
| 181 | 2512636154 | 2512564013 | Bacteria | 6286191 |
| 182 | 2524187246 | 2524023129 | Bacteria | 6762600 |
| 183 | 2540607793 | 2540341094 | Bacteria | 4061186 |
| 184 | 2545557277 | 2545555800 | Bacteria | 4222588 |
| 185 | 2556062966 | 2554235469 | Bacteria | 3590176 |
| 186 | 2563926227 | 2563366752 | Bacteria | 4961801 |
| 187 | 2571527426 | 2571042143 | Bacteria | 6986194 |
| 188 | 2573040045 | 2571042588 | Bacteria | 5045676 |
| 189 | 2578336289 | 2576861424 | Bacteria | 5270569 |
| 190 | 2578931540 | 2576861599 | Bacteria | 4217202 |
| 191 | 2580931725 | 2579778775 | Bacteria | 5360914 |
| 192 | 2587739164 | 2585428059 | Bacteria | 8696589 |
| 193 | 2601637206 | 2600255286 | Bacteria | 5390125 |
| 194 | 2621274470 | 2619619294 | Bacteria | 5575484 |
| 195 | 2631984523 | 2630968484 | Bacteria | 3876276 |
| 196 | 2643737700 | 2643221543 | Bacteria | 6628015 |
| 197 | 2644428027 | 2643221676 | Bacteria | 8119172 |
| 198 | 2644715553 | 2643221731 | Bacteria | 5623886 |
| 199 | 2644726857 | 2643221732 | Bacteria | 5756404 |
| 200 | 2651532700 | 2648501850 | Bacteria | 3975476 |
| 201 | 2673818871 | 2671180694 | Bacteria | 7506943 |
| 202 | 2674418594 | 2671180844 | Bacteria | 4164150 |
| 203 | 2695628573 | 2695420354 | Bacteria | 3922431 |
| 204 | 2712198216 | 2711768088 | Bacteria | 3195027 |
| 205 | 2717915734 | 2716884898 | Bacteria | 3928789 |
| 206 | 2723603156 | 2721755693 | Bacteria | 6126117 |
| 207 | 2728533842 | 2728368933 | Bacteria | 7044283 |
| 208 | 2730139185 | 2728369359 | Bacteria | 5621728 |
| 209 | 2738815477 | 2738541295 | Bacteria | 5730091 |
| 210 | 2739229904 | 2738543010 | Bacteria | 5583595 |
| 211 | 2745167790 | 2744054657 | Bacteria | 5016802 |
| 212 | 2753808505 | 2751185905 | Bacteria | 6142767 |
| 213 | 2793183298 | 2791355222 | Bacteria | 5898266 |
| 214 | 2802436291 | 2802428803 | Bacteria | 5806948 |
| 215 | 2808869712 | 2808606364 | Bacteria | 4465927 |
| 216 | 2809056170 | 2808606399 | Bacteria | 4021018 |
| 217 | 2817481169 | 2816332295 | Bacteria | 4352468 |
| 218 | 2817617197 | 2816332336 | Bacteria | 5207640 |
| 219 | 2819671954 | 2818991459 | Bacteria | 8736032 |
| 220 | 2819709021 | 2818991465 | Bacteria | 5388835 |
| 221 | 2821113892 | 2821111986 | Bacteria | 6894338 |
| 222 | 2831906532 | 2831905167 | Bacteria | 3319172 |
| 223 | 2842884739 | 2842882022 | Bacteria | 6158489 |
| 224 | 2857460718 | 2857460504 | Bacteria | 5194327 |
| 225 | 2857465935 | 2857465823 | Bacteria | 6772595 |
| 226 | 2857477134 | 2857472729 | Bacteria | 6568124 |
| 227 | 2857593898 | 2857591370 | Bacteria | 6569758 |
| 228 | 2860840568 | 2860837431 | Bacteria | 4202080 |
| 229 | 2864733830 | 2864733723 | Bacteria | 6770668 |
| 230 | 2865001089 | 2864997549 | Bacteria | 5139696 |
| 231 | 2865002862 | 2865002811 | Bacteria | 6333767 |
| 232 | 2877771481 | 2877768649 | Bacteria | 3957164 |
| 233 | 2880172339 | 2880169592 | Bacteria | 3900066 |
| 234 | 2881639247 | 2881636855 | Bacteria | 5205297 |
| 235 | 2885530248 | 2885526491 | Bacteria | 7164189 |
| 236 | 2888583186 | 2888578766 | Bacteria | 6743310 |
| 237 | 2889044502 | 2889042446 | Bacteria | 7618936 |
| 238 | 2889054597 | 2889049205 | Bacteria | 7524325 |
| 239 | 2889279119 | 2889276214 | Bacteria | 5979355 |
| 240 | 2889297816 | 2889295896 | Bacteria | 4704906 |
| 241 | 2897112615 | 2897109615 | Bacteria | 4009619 |
| 242 | 2904118500 | 2904113452 | Bacteria | 7796941 |
| 243 | 2904165809 | 2904162308 | Bacteria | 7086713 |
| 244 | 2904491380 | 2904490793 | Bacteria | 7046938 |
| 245 | 2904524231 | 2904524088 | Bacteria | 5887454 |
| 246 | 2904564381 | 2904560550 | Bacteria | 4029838 |
| 247 | 2904599423 | 2904595352 | Bacteria | 6124848 |
| 248 | 2904758854 | 2904755435 | Bacteria | 7986759 |
| 249 | 2907204300 | 2907202186 | Bacteria | 6632024 |
| 250 | 2915599940 | 2915597211 | Bacteria | 6475886 |
| 251 | 2915609513 | 2915606848 | Bacteria | 6032732 |
| 252 | 2916975034 | 2916971899 | Bacteria | 4250608 |
| 253 | 2919147192 | 2919143609 | Bacteria | 6219228 |
| 254 | 2919160654 | 2919160200 | Bacteria | 6929020 |
| 255 | 2919417648 | 2919414237 | Bacteria | 5429133 |
| 256 | 2919426055 | 2919425241 | Bacteria | 8055701 |
| 257 | 2919519096 | 2919517244 | Bacteria | 5858162 |
| 258 | 2919723465 | 2919720352 | Bacteria | 5986006 |
| 259 | 2925333338 | 2925326138 | Bacteria | 9652120 |
| 260 | 2928096009 | 2928093941 | Bacteria | 5965005 |
| 261 | 2929006620 | 2929004312 | Bacteria | 5678476 |
| 262 | 2929185121 | 2929183550 | Bacteria | 6377511 |
| 263 | 2929208297 | 2929206907 | Bacteria | 5918291 |
| 264 | 2931387936 | 2931384279 | Bacteria | 7299545 |
| 265 | 2936362080 | 2936361878 | Bacteria | 5632809 |
| 266 | 2938651451 | 2938649242 | Bacteria | 7118381 |
| 267 | 2939681708 | 2939679117 | Bacteria | 6921672 |
| 268 | 2939706068 | 2939702853 | Bacteria | 5139229 |
| 269 | 2945993460 | 2945991243 | Bacteria | 7008369 |
| 270 | 2946056211 | 2946053406 | Bacteria | 6978655 |
| 271 | 2960319628 | 2960319331 | Bacteria | 5502575 |
| 272 | 2960381161 | 2960375949 | Bacteria | 5361395 |
| 273 | 2962293779 | 2962290636 | Bacteria | 4072939 |
| 274 | 2964379323 | 2964375228 | Bacteria | 4909004 |
| 275 | 2968562729 | 2968558590 | Bacteria | 6956864 |
| 276 | 2969139773 | 2969136845 | Bacteria | 3923176 |
| 277 | 2969143929 | 2969141011 | Bacteria | 4118468 |
| 278 | 2969769746 | 2969765954 | Bacteria | 4216713 |
| 279 | 2969772822 | 2969770375 | Bacteria | 4271280 |
| 280 | 2971406671 | 2971403814 | Bacteria | 7370929 |
| 281 | 2971411822 | 2971410472 | Bacteria | 8311090 |
| 282 | 2971515346 | 2971511577 | Bacteria | 5404012 |
| 283 | 2971896145 | 2971893375 | Bacteria | 3929648 |
| 284 | 2977256331 | 2977254563 | Bacteria | 4828420 |
| 285 | 2980181442 | 2980176882 | Bacteria | 5397533 |
| 286 | 2980185401 | 2980182181 | Bacteria | 9454109 |
| 287 | 2980495562 | 2980492589 | Bacteria | 4072961 |
| 288 | 2981286296 | 2981284811 | Bacteria | 4641497 |
| 289 | 2981291246 | 2981289755 | Bacteria | 4641509 |
| 290 | 2981981941 | 2981980479 | Bacteria | 4641628 |
| 291 | 2981986840 | 2981985349 | Bacteria | 4641497 |
| 292 | 2984528699 | 2984527788 | Bacteria | 5288478 |
| 293 | 2984534800 | 2984532647 | Bacteria | 5288506 |
| 294 | 2988227701 | 2988225383 | Bacteria | 7221625 |
| 295 | 2990277209 | 2990275345 | Bacteria | 4887158 |
| 296 | 2996634203 | 2996632988 | Bacteria | 6921523 |
| 297 | 2996711748 | 2996706504 | Bacteria | 5757485 |
| 298 | 3001897516 | 3001892409 | Bacteria | 6328293 |
| 299 | 3006829255 | 3006826541 | Bacteria | 4678913 |
| 300 | 3006861583 | 3006858327 | Bacteria | 4317835 |
| 301 | 3006982130 | 3006978542 | Bacteria | 5328100 |
| 302 | 648169523 | 648028048 | Bacteria | 5394884 |
| 303 | 8002322222 | 8002317523 | Bacteria | 8051857 |
| 304 | 8022632212 | 8022630665 | Bacteria | 3886130 |
| 305 | 8022654739 | 8022653035 | Bacteria | 4035078 |
| 306 | 8022898443 | 8022893055 | Bacteria | 5300455 |
| 307 | 8022917593 | 8022914991 | Bacteria | 5584517 |
| 308 | 8022950098 | 8022948649 | Bacteria | 5366783 |
| 309 | 8046991685 | 8046991243 | Bacteria | 8497463 |
| 310 | 8051954884 | 8051952484 | Bacteria | 3926774 |
| 311 | 8052176398 | 8052174270 | Bacteria | 3881265 |
| 312 | 8054280886 | 8054280661 | Bacteria | 4232245 |
| 313 | 8054467500 | 8054465665 | Bacteria | 7323556 |
| 314 | 8054797447 | 8054795415 | Bacteria | 9785225 |
| 315 | 8055637179 | 8055632911 | Bacteria | 5283357 |
| 316 | 8056538069 | 8056533031 | Bacteria | 8964429 |
| 317 | 8057476951 | 8057473075 | Bacteria | 5892720 |
| 318 | 8057635718 | 8057632132 | Bacteria | 4726859 |
| 319 | 8057734158 | 8057733483 | Bacteria | 6578323 |
| 320 | 8057978090 | 8057977335 | Bacteria | 5694872 |
| 321 | Ga0209566_100368 | |||
| 322 | JGI25151J46595_10008591 | |||
| 323 | JGI25151J46595_10012958 | |||
| 324 | JGI25151J46595_10035448 | |||
| 325 | rootH1_10005765 | |||
| 326 | rootH2_10221815 | |||
| 327 | rootL2_10013974 | |||
| 328 | rootL2_10330782 | |||
| 329 | Ga0006562J51391_1000483 | |||
| 330 | Ga0055538_1001041 | |||
| 331 | Ga0055532_1003864 | |||
| 332 | Ga0055528_1001594 | |||
| 333 | Ga0070666_10000203 | |||
| 334 | Ga0070666_10041087 | |||
| 335 | Ga0070674_100020971 | |||
| 336 | Ga0070673_100157994 | |||
| 337 | Ga0070672_100105876 | |||
| 338 | Ga0070665_100097481 | |||
| 339 | Ga0070704_100397016 | |||
| 340 | Ga0070715_10137571 | |||
| 341 | Ga0075367_10141770 | |||
| 342 | Ga0105251_10019433 | |||
| 343 | Ga0105244_10027793 | |||
| 344 | Ga0105244_10042849 | |||
| 345 | Ga0111539_10034131 | |||
| 346 | Ga0105247_10019618 | |||
| 347 | Ga0105243_10005852 | |||
| 348 | Ga0105242_10000303 | |||
| 349 | Ga0105246_10001062 | |||
| 350 | Ga0105246_10023145 | |||
| 351 | Ga0157378_10001003 | |||
| 352 | Ga0157378_10001592 | |||
| 353 | Ga0163162_10600031 | |||
| 354 | Ga0157372_10156227 | |||
| 355 | Ga0157376_10073948 | |||
| 356 | Ga0209784_100134 | |||
| 357 | Ga0209566_100183 | |||
| 358 | Ga0209147_100190 | |||
| 359 | Ga0209147_100262 | |||
| 360 | Ga0209437_100357 | |||
| 361 | Ga0209258_101293 | |||
| 362 | Ga0209673_1001689 | |||
| 363 | Ga0209675_1018048 | |||
| 364 | Ga0209025_1005341 | |||
| 365 | Ga0209025_1005797 | |||
| 366 | Ga0209025_1005842 | |||
| 367 | Ga0209025_1019388 | |||
| 368 | Ga0209025_1024679 | |||
| 369 | Ga0207426_1007297 | |||
| 370 | Ga0207696_1003513 | |||
| 371 | Ga0207655_1006187 | |||
| 372 | Ga0207655_1052373 | |||
| 373 | Ga0207713_1000242 | |||
| 374 | Ga0207713_1018092 | |||
| 375 | Ga0207710_10100630 | |||
| 376 | Ga0207680_10000121 | |||
| 377 | Ga0207680_10010888 | |||
| 378 | Ga0207647_10000003 | |||
| 379 | Ga0207686_10041740 | |||
| 380 | Ga0207709_10020459 | |||
| 381 | Ga0207691_10155161 | |||
| 382 | Ga0207708_10212258 | |||
| 383 | Ga0207428_10120225 | |||
| 384 | Ga0307408_100041873 | |||
| 385 | Ga0316575_10025881 | |||
| 386 | Ga0316575_10077509 | |||
| 387 | Ga0316579_10009147 | |||
| 388 | Ga0316579_10011896 | |||
| 389 | Ga0316579_10014370 | |||
| 390 | Ga0316578_10006106 | |||
| 391 | Ga0316578_10138109 | |||
| 392 | Ga0307405_10327996 | |||
| 393 | Ga0316577_10035376 | |||
| 394 | Ga0316577_10036646 | |||
| 395 | Ga0316577_10080413 | |||
| 396 | Ga0307406_10326844 | |||
| 397 | Ga0307412_10517135 | |||
| 398 | Ga0307409_100210193 | |||
| 399 | Ga0307416_100353919 | |||
| 400 | Ga0316580_10004096 | |||
| 401 | Ga0373962_0045781 | |||
| 402 | Ga0316574_0079625 | |||
| 403 | Ga0316574_0102384 | |||
| 404 | Ga0373947_0225231 | |||
| 405 | Ga0316584_0024827 | |||
| 406 | Ga0400488_06052 | |||
| 407 | Ga0439436_0010349 | |||
| 408 | Ga0439439_0002310 | |||
| 409 | Ga0439433_0000416 | |||
| 410 | Ga0439449_0000197 | |||
| 411 | Ga0439462_0000518 | |||
| 412 | Ga0453684_0199010 | |||
| 413 | Ga0453684_0233355 | |||
| 414 | Ga0453684_0879789 | |||
| 415 | Ga0466959_0236345 | |||
| 416 | Ga0451576_0013781 | |||
| 417 | Ga0495603_0120135 | |||
| 418 | Ga0495585_0047305 | |||
| 419 | Ga0495622_0054128 | |||
| 420 | Ga0495622_0189190 | |||
| 421 | Ga0495661_0032877 | |||
| 422 | Ga0495661_0084959 | |||
| 423 | Ga0495670_0232422 | |||
| 424 | Ga0495649_0066473 | |||
| 425 | Ga0495660_0044066 | |||
| 426 | Ga0495660_0066562 | |||
| 427 | Ga0495676_0177677 | |||
| 428 | Ga0495683_0006210 | |||
| 429 | Ga0496100_0001656 | |||
| 430 | Ga0496100_0097225 | |||
| 431 | Ga0496101_0002804 | |||
| 432 | Ga0496102_0030507 | |||
| 433 | Ga0496103_0027585 | |||
| 434 | Ga0496104_0003934 | |||
| 435 | Ga0496105_0012839 | |||
| 436 | Ga0496106_0000224 | |||
| 437 | Ga0496107_0003741 | |||
| 438 | Ga0496108_0028043 | |||
| 439 | Ga0496110_0004762 | |||
| 440 | Ga0496110_0114697 | |||
| 441 | Ga0496111_0012436 | |||
| 442 | Ga0496113_0019042 | |||
| 443 | Ga0496116_0005178 | |||
| 444 | Ga0496116_0006945 | |||
| 445 | Ga0496116_0048629 | |||
| 446 | Ga0496116_0056290 | |||
| 447 | Ga0496116_0069184 | |||
| 448 | Ga0496116_0072831 | |||
| 449 | Ga0496116_0103107 | |||
| 450 | Ga0496117_0008853 | |||
| 451 | Ga0496117_0087075 | |||
| 452 | Ga0496118_0005682 | |||
| 453 | Ga0496118_0061118 | |||
| 454 | Ga0496119_0005766 | |||
| 455 | Ga0496119_0008471 | |||
| 456 | Ga0496119_0009285 | |||
| 457 | Ga0496120_0002515 | |||
| 458 | Ga0496120_0006991 | |||
| 459 | Ga0496120_0027741 | |||
| 460 | Ga0496120_0030992 | |||
| 461 | Ga0496121_0041254 | |||
| 462 | Ga0496122_0009411 | |||
| 463 | Ga0496122_0011678 | |||
| 464 | Ga0496122_0022837 | |||
| 465 | Ga0496122_0023292 | |||
| 466 | Ga0496122_0028747 | |||
| 467 | Ga0496122_0069980 | |||
| 468 | Ga0496122_0155783 | |||
| 469 | Ga0496123_0030628 | |||
| 470 | Ga0496123_0049507 | |||
| 471 | Ga0496123_0082326 | |||
| 472 | Ga0496124_0000183 | |||
| 473 | Ga0496124_0000335 | |||
| 474 | Ga0496124_0066518 | |||
| 475 | Ga0496124_0100974 | |||
| 476 | Ga0496124_0336848 | |||
| 477 | Ga0496125_0000535 | |||
| 478 | Ga0496125_0001459 | |||
| 479 | Ga0496125_0015306 | |||
| 480 | Ga0496125_0016268 | |||
| 481 | Ga0496126_0002544 | |||
| 482 | Ga0496126_0002731 | |||
| 483 | Ga0496126_0003379 | |||
| 484 | Ga0496126_0027546 | |||
| 485 | Ga0501039_0125297 | |||
| 486 | Ga0501041_0014783 | |||
| 487 | Ga0501042_0341087 | |||
| 488 | Ga0501046_0070473 | |||
| 489 | Ga0501072_0038811 | |||
| 490 | Ga0501076_0012809 | |||
| 491 | Ga0501079_0043009 | |||
| 492 | Ga0501045_0011905 | |||
| 493 | nmdc:mga06z11_115720_c1 | |||
| 494 | nmdc:mga08y16_417000_c1 | |||
| 495 | Ga0500628_001217 | |||
| 496 | Ga0501084_0039790 | |||
| 497 | Ga0501082_0218283 | |||
| 498 | 2511179517 | |||
| 499 | 2511700579 | |||
| 500 | 2512636154 | |||
| 501 | 2524187246 | |||
| 502 | 2540607793 | |||
| 503 | 2545557277 | |||
| 504 | 2556062966 | |||
| 505 | 2563926227 | |||
| 506 | 2571527426 | |||
| 507 | 2573040045 | |||
| 508 | 2578336289 | |||
| 509 | 2578931540 | |||
| 510 | 2580931725 | |||
| 511 | 2587739164 | |||
| 512 | 2601637206 | |||
| 513 | 2621274470 | |||
| 514 | 2631984523 | |||
| 515 | 2643737700 | |||
| 516 | 2644428027 | |||
| 517 | 2644715553 | |||
| 518 | 2644726857 | |||
| 519 | 2651532700 | |||
| 520 | 2673818871 | |||
| 521 | 2674418594 | |||
| 522 | 2695628573 | |||
| 523 | 2712198216 | |||
| 524 | 2717915734 | |||
| 525 | 2723603156 | |||
| 526 | 2728533842 | |||
| 527 | 2730139185 | |||
| 528 | 2738815477 | |||
| 529 | 2739229904 | |||
| 530 | 2745167790 | |||
| 531 | 2753808505 | |||
| 532 | 2793183298 | |||
| 533 | 2802436291 | |||
| 534 | 2808869712 | |||
| 535 | 2809056170 | |||
| 536 | 2817481169 | |||
| 537 | 2817617197 | |||
| 538 | 2819671954 | |||
| 539 | 2819709021 | |||
| 540 | 2821113892 | |||
| 541 | 2831906532 | |||
| 542 | 2842884739 | |||
| 543 | 2857460718 | |||
| 544 | 2857465935 | |||
| 545 | 2857477134 | |||
| 546 | 2857593898 | |||
| 547 | 2860840568 | |||
| 548 | 2864733830 | |||
| 549 | 2865001089 | |||
| 550 | 2865002862 | |||
| 551 | 2877771481 | |||
| 552 | 2880172339 | |||
| 553 | 2881639247 | |||
| 554 | 2885530248 | |||
| 555 | 2888583186 | |||
| 556 | 2889044502 | |||
| 557 | 2889054597 | |||
| 558 | 2889279119 | |||
| 559 | 2889297816 | |||
| 560 | 2897112615 | |||
| 561 | 2904118500 | |||
| 562 | 2904165809 | |||
| 563 | 2904491380 | |||
| 564 | 2904524231 | |||
| 565 | 2904564381 | |||
| 566 | 2904599423 | |||
| 567 | 2904758854 | |||
| 568 | 2907204300 | |||
| 569 | 2915599940 | |||
| 570 | 2915609513 | |||
| 571 | 2916975034 | |||
| 572 | 2919147192 | |||
| 573 | 2919160654 | |||
| 574 | 2919417648 | |||
| 575 | 2919426055 | |||
| 576 | 2919519096 | |||
| 577 | 2919723465 | |||
| 578 | 2925333338 | |||
| 579 | 2928096009 | |||
| 580 | 2929006620 | |||
| 581 | 2929185121 | |||
| 582 | 2929208297 | |||
| 583 | 2931387936 | |||
| 584 | 2936362080 | |||
| 585 | 2938651451 | |||
| 586 | 2939681708 | |||
| 587 | 2939706068 | |||
| 588 | 2945993460 | |||
| 589 | 2946056211 | |||
| 590 | 2960319628 | |||
| 591 | 2960381161 | |||
| 592 | 2962293779 | |||
| 593 | 2964379323 | |||
| 594 | 2968562729 | |||
| 595 | 2969139773 | |||
| 596 | 2969143929 | |||
| 597 | 2969769746 | |||
| 598 | 2969772822 | |||
| 599 | 2971406671 | |||
| 600 | 2971411822 | |||
| 601 | 2971515346 | |||
| 602 | 2971896145 | |||
| 603 | 2977256331 | |||
| 604 | 2980181442 | |||
| 605 | 2980185401 | |||
| 606 | 2980495562 | |||
| 607 | 2981286296 | |||
| 608 | 2981291246 | |||
| 609 | 2981981941 | |||
| 610 | 2981986840 | |||
| 611 | 2984528699 | |||
| 612 | 2984534800 | |||
| 613 | 2988227701 | |||
| 614 | 2990277209 | |||
| 615 | 2996634203 | |||
| 616 | 2996711748 | |||
| 617 | 3001897516 | |||
| 618 | 3006829255 | |||
| 619 | 3006861583 | |||
| 620 | 3006982130 | |||
| 621 | 648169523 | |||
| 622 | 8002322222 | |||
| 623 | 8022632212 | |||
| 624 | 8022654739 | |||
| 625 | 8022898443 | |||
| 626 | 8022917593 | |||
| 627 | 8022950098 | |||
| 628 | 8046991685 | |||
| 629 | 8051954884 | |||
| 630 | 8052176398 | |||
| 631 | 8054280886 | |||
| 632 | 8054467500 | |||
| 633 | 8054797447 | |||
| 634 | 8055637179 | |||
| 635 | 8056538069 | |||
| 636 | 8057476951 | |||
| 637 | 8057635718 | |||
| 638 | 8057734158 | |||
| 639 | 8057978090 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l2d-assembly1.cif.gz_A | mutm (fpg)-dna estranged guanine mismatch recognition complex | 0.9885 | 2 | 273 |
| 3jr5-assembly1.cif.gz_A | mutm lesion recognition control complex with n174c crosslinking site | 0.9872 | 2 | 273 |
| 3jr4-assembly1.cif.gz_A | mutm interrogating an extrahelical g | 0.9871 | 2 | 273 |
| 3gq4-assembly1.cif.gz_A | sequence-matched mutm lesion recognition complex 5 (lrc5) | 0.9866 | 2 | 273 |
| 1l2b-assembly1.cif.gz_A | mutm (fpg) dna end-product structure | 0.9863 | 2 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1l1tA01 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.9911 | 2 | 131 | 3.20.190.10 |
| 1l1tA01 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.9689 | 2 | 131 | 3.20.190.10 |
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9686 | 134 | 273 | 1.10.8.50 |
| 1k82C02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9663 | 134 | 273 | 1.10.8.50 |
| 1ee8B02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9654 | 134 | 269 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A511ZDR6-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9936 | 1 | 276 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A5D0CYT8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9914 | 1 | 277 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A7U9JD24-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9912 | 2 | 273 |
GO:0003684
GO:0003906 GO:0006284 GO:0008270 GO:0016829 GO:0034039 |
| AF-A0A5D0CYT8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9878 | 1 | 277 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A511ZDR6-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9864 | 1 | 276 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |