F405097

General Info

Members Datasets Scaffolds Average Seq Length
319 258 639 276

Family's Representative Sequence

Representative Sequence 3300025225|Ga0209566_100368|Ga0209566_10036816
Length 319
Sequence MPELPEVETVRRTLSELIVGKQIKSVTVRLPRILQKPDDPDVFGAMLEGRTFTSVERRGKFLRLVLDGLVLVSHLRMEGRYGLFADDAPLDKHTHVIFHFTDGTALRYTDVRQFGTMHLFPAGEELDSPPLMKLGLEPLEAGFTVEAFRTSLGRRNTKIKPLLLNQEWIVGLGNIYVDEALHLAGIHPERNAGELKPKDWQRLHEAIVTTLTAAVEAGGSSVKSYVNGQGEMGMFQHRLRVYGRTGEACPACGHPIAKSVVGGRGTHVCAKCQKPPKGAAGPASGVSAAASRRYREGGNAVKRRLDGAADASGRDGGEL

Samples

Sample ID Description Type Environment
1 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
59 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
78 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
118 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
119 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
120 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
121 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
122 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
123 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
124 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
125 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
126 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
127 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
128 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
129 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
130 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
131 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
132 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
133 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
134 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
135 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
136 2643221731 Bacillus sp. Root147 Isolate Unclassified
137 2643221732 Bacillus sp. Root239 Isolate Unclassified
138 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
139 2671180694 Paenibacillus sp. A3 Isolate Unclassified
140 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
141 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
142 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
143 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
144 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
145 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
146 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
147 2738541295 Bacillus sp. OK085 Isolate Unclassified
148 2738543010 Bacillus sp. YR335 Isolate Unclassified
149 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
150 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
151 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
152 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
153 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
154 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
155 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
156 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
157 2818991459 Paenibacillus sp. 597 Isolate Unclassified
158 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
159 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
160 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
161 2842882022 Bacillus sp. R-71893 Isolate Unclassified
162 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
163 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
164 2857472729 Cohnella sp. R-74144 Isolate Unclassified
165 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
166 2860837431 Bacillus sp. WR11 Isolate Unclassified
167 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
168 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
169 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
170 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
171 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
172 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
173 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
174 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
175 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
176 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
177 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
178 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
179 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
180 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
181 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
182 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
183 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
184 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
185 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
186 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
187 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
188 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
189 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
190 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
191 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
192 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
193 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
194 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
195 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
196 2919720352 Priestia megaterium 4340 Isolate Unclassified
197 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
198 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
199 2929004312 Priestia megaterium 1104 Isolate Unclassified
200 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
201 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
202 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
203 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
204 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
205 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
206 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
207 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
208 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
209 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
210 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
211 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
212 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
213 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
214 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
215 2969141011 Bacillus velezensis MH25 Isolate Unclassified
216 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
217 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
218 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
219 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
220 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
221 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
222 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
223 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
224 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
225 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
226 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
227 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
228 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
229 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
230 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
231 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
232 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
233 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
234 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
235 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
236 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
237 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
238 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
239 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
240 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
241 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
242 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
243 8022653035 Bacillus sp. Rc4 Isolate Unclassified
244 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
245 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
246 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
247 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
248 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
249 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
250 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
251 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
252 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
253 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
254 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
255 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
256 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
257 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
258 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 55.17
Metatranscriptomes 0.31
Isolates 44.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 7.52
Nodule 0.63
Rhizoplane 4.7
Rhizosphere 52.66
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209566_100368 3300025225 Bacteria 37595
2 JGI25151J46595_10008591 3300003187 Bacteria 4896
3 JGI25151J46595_10012958 3300003187 Bacteria 3768
4 JGI25151J46595_10035448 3300003187 Bacteria 1895
5 rootH1_10005765 3300003316 Bacteria 19570
6 rootH1_10005765 3300003323 Bacteria 6456
7 rootH2_10221815 3300003320 Bacteria 6650
8 rootL2_10013974 3300003322 Bacteria 148551
9 rootL2_10330782 3300003322 Unclassified 1355
10 Ga0006562J51391_1000483 3300003578 Bacteria 10540
11 Ga0055538_1001041 3300003751 Bacteria 6242
12 Ga0055532_1003864 3300003758 Bacteria 2417
13 Ga0055528_1001594 3300003790 Bacteria 13452
14 Ga0070666_10000203 3300005335 Bacteria 40659
15 Ga0070666_10041087 3300005335 Unclassified 3089
16 Ga0070674_100020971 3300005356 Unclassified 4187
17 Ga0070673_100157994 3300005364 Bacteria 1926
18 Ga0070672_100105876 3300005543 Unclassified 2287
19 Ga0070665_100097481 3300005548 Unclassified 2945
20 Ga0070704_100397016 3300005549 Bacteria 1176
21 Ga0070715_10137571 3300006163 Bacteria 1182
22 Ga0075367_10141770 3300006178 Bacteria 1489
23 Ga0105251_10019433 3300009011 Bacteria 3589
24 Ga0105244_10027793 3300009036 Bacteria 3044
25 Ga0105244_10042849 3300009036 Bacteria 2338
26 Ga0111539_10034131 3300009094 Bacteria 6172
27 Ga0105247_10019618 3300009101 Bacteria 4059
28 Ga0105243_10005852 3300009148 Bacteria 9531
29 Ga0105242_10000303 3300009176 Bacteria 39278
30 Ga0105246_10001062 3300011119 Bacteria 15875
31 Ga0105246_10023145 3300011119 Bacteria 4017
32 Ga0157378_10001003 3300013297 Bacteria 25863
33 Ga0157378_10001592 3300013297 Bacteria 20530
34 Ga0163162_10600031 3300013306 Bacteria 1227
35 Ga0157372_10156227 3300013307 Bacteria 2635
36 Ga0157376_10073948 3300014969 Bacteria 2904
37 Ga0209784_100134 3300025224 Bacteria 71273
38 Ga0209566_100183 3300025225 Bacteria 66605
39 Ga0209147_100190 3300025229 Bacteria 71748
40 Ga0209147_100262 3300025229 Bacteria 48219
41 Ga0209437_100357 3300025233 Bacteria 51450
42 Ga0209258_101293 3300025242 Bacteria 9314
43 Ga0209673_1001689 3300025273 Bacteria 18811
44 Ga0209675_1018048 3300025291 Bacteria 1987
45 Ga0209025_1005341 3300025294 Bacteria 10536
46 Ga0209025_1005797 3300025294 Bacteria 9907
47 Ga0209025_1005842 3300025294 Bacteria 9851
48 Ga0209025_1019388 3300025294 Bacteria 3784
49 Ga0209025_1024679 3300025294 Bacteria 3093
50 Ga0207426_1007297 3300025302 Bacteria 4646
51 Ga0207696_1003513 3300025711 Bacteria 7090
52 Ga0207655_1006187 3300025728 Bacteria 7976
53 Ga0207655_1052373 3300025728 Bacteria 1642
54 Ga0207713_1000242 3300025735 Bacteria 72255
55 Ga0207713_1018092 3300025735 Bacteria 3500
56 Ga0207710_10100630 3300025900 Bacteria 1363
57 Ga0207680_10000121 3300025903 Bacteria 36291
58 Ga0207680_10010888 3300025903 Bacteria 4571
59 Ga0207647_10000003 3300025904 Bacteria 321014
60 Ga0207686_10041740 3300025934 Bacteria 2800
61 Ga0207709_10020459 3300025935 Bacteria 3733
62 Ga0207691_10155161 3300025940 Unclassified 2011
63 Ga0207708_10212258 3300026075 Bacteria 1548
64 Ga0207428_10120225 3300027907 Bacteria 2015
65 Ga0307408_100041873 3300031548 Bacteria 3249
66 Ga0316575_10025881 3300031665 Bacteria 2278
67 Ga0316575_10077509 3300031665 Bacteria 1339
68 Ga0316579_10009147 3300031691 Bacteria 4160
69 Ga0316579_10011896 3300031691 Bacteria 3713
70 Ga0316579_10014370 3300031691 Bacteria 3422
71 Ga0316578_10006106 3300031728 Bacteria 5913
72 Ga0316578_10138109 3300031728 Bacteria 1468
73 Ga0307405_10327996 3300031731 Bacteria 1172
74 Ga0316577_10035376 3300031733 Bacteria 2791
75 Ga0316577_10036646 3300031733 Bacteria 2743
76 Ga0316577_10080413 3300031733 Bacteria 1822
77 Ga0307406_10326844 3300031901 Bacteria 1189
78 Ga0307412_10517135 3300031911 Bacteria 997
79 Ga0307409_100210193 3300031995 Bacteria 1748
80 Ga0307416_100353919 3300032002 Bacteria 1487
81 Ga0316580_10004096 3300032139 Bacteria 4201
82 Ga0373962_0045781 3300035242 Unclassified 1247
83 Ga0316574_0079625 3300035398 Bacteria 2078
84 Ga0316574_0102384 3300035398 Bacteria 1833
85 Ga0373947_0225231 3300035725 Bacteria 1234
86 Ga0316584_0024827 3300036712 Bacteria 4390
87 Ga0400488_06052 3300038741 Bacteria 2483
88 Ga0439436_0010349 3300041404 Bacteria 2847
89 Ga0439439_0002310 3300041406 Bacteria 4030
90 Ga0439433_0000416 3300041999 Bacteria 7734
91 Ga0439449_0000197 3300042007 Bacteria 21037
92 Ga0439462_0000518 3300042015 Bacteria 7619
93 Ga0453684_0199010 3300044712 Bacteria 2337
94 Ga0453684_0233355 3300044712 Unclassified 2123
95 Ga0453684_0879789 3300044712 Unclassified 961
96 Ga0466959_0236345 3300045049 Bacteria 1263
97 Ga0451576_0013781 3300045051 Bacteria 9032
98 Ga0495603_0120135 3300046455 Bacteria 1531
99 Ga0495585_0047305 3300046492 Bacteria 2396
100 Ga0495622_0054128 3300046557 Bacteria 1862
101 Ga0495622_0189190 3300046557 Bacteria 921
102 Ga0495661_0032877 3300046665 Bacteria 3276
103 Ga0495661_0084959 3300046665 Bacteria 1815
104 Ga0495670_0232422 3300046691 Bacteria 981
105 Ga0495649_0066473 3300046694 Bacteria 1935
106 Ga0495660_0044066 3300046810 Bacteria 2457
107 Ga0495660_0066562 3300046810 Bacteria 1921
108 Ga0495676_0177677 3300047321 Bacteria 1494
109 Ga0495683_0006210 3300047323 Bacteria 6541
110 Ga0496100_0001656 3300048903 Bacteria 11045
111 Ga0496100_0097225 3300048903 Bacteria 2022
112 Ga0496101_0002804 3300048904 Bacteria 10696
113 Ga0496102_0030507 3300048905 Bacteria 4826
114 Ga0496103_0027585 3300048906 Bacteria 3441
115 Ga0496104_0003934 3300048907 Bacteria 12850
116 Ga0496105_0012839 3300048908 Bacteria 6638
117 Ga0496106_0000224 3300048909 Bacteria 39551
118 Ga0496107_0003741 3300048910 Bacteria 10218
119 Ga0496108_0028043 3300048911 Bacteria 4657
120 Ga0496110_0004762 3300048913 Bacteria 10569
121 Ga0496110_0114697 3300048913 Bacteria 2425
122 Ga0496111_0012436 3300048914 Bacteria 5762
123 Ga0496113_0019042 3300048916 Bacteria 4795
124 Ga0496116_0005178 3300048919 Bacteria 12235
125 Ga0496116_0006945 3300048919 Bacteria 10149
126 Ga0496116_0048629 3300048919 Bacteria 2844
127 Ga0496116_0056290 3300048919 Bacteria 2578
128 Ga0496116_0069184 3300048919 Bacteria 2245
129 Ga0496116_0072831 3300048919 Bacteria 2169
130 Ga0496116_0103107 3300048919 Bacteria 1698
131 Ga0496117_0008853 3300048920 Bacteria 9499
132 Ga0496117_0087075 3300048920 Bacteria 2026
133 Ga0496118_0005682 3300048921 Bacteria 14052
134 Ga0496118_0061118 3300048921 Bacteria 2792
135 Ga0496119_0005766 3300048922 Bacteria 11729
136 Ga0496119_0008471 3300048922 Bacteria 9027
137 Ga0496119_0009285 3300048922 Bacteria 8467
138 Ga0496120_0002515 3300048923 Bacteria 18341
139 Ga0496120_0006991 3300048923 Bacteria 8488
140 Ga0496120_0027741 3300048923 Bacteria 3478
141 Ga0496120_0030992 3300048923 Bacteria 3244
142 Ga0496121_0041254 3300048924 Bacteria 4036
143 Ga0496122_0009411 3300048925 Bacteria 10304
144 Ga0496122_0011678 3300048925 Bacteria 8851
145 Ga0496122_0022837 3300048925 Bacteria 5542
146 Ga0496122_0023292 3300048925 Bacteria 5466
147 Ga0496122_0028747 3300048925 Bacteria 4706
148 Ga0496122_0069980 3300048925 Bacteria 2510
149 Ga0496122_0155783 3300048925 Bacteria 1402
150 Ga0496123_0030628 3300048926 Bacteria 3935
151 Ga0496123_0049507 3300048926 Bacteria 2816
152 Ga0496123_0082326 3300048926 Bacteria 1952
153 Ga0496124_0000183 3300048927 Bacteria 124048
154 Ga0496124_0000335 3300048927 Bacteria 86882
155 Ga0496124_0066518 3300048927 Bacteria 3001
156 Ga0496124_0100974 3300048927 Bacteria 2338
157 Ga0496124_0336848 3300048927 Bacteria 1073
158 Ga0496125_0000535 3300048928 Bacteria 65395
159 Ga0496125_0001459 3300048928 Bacteria 34240
160 Ga0496125_0015306 3300048928 Bacteria 7424
161 Ga0496125_0016268 3300048928 Bacteria 7149
162 Ga0496126_0002544 3300048929 Bacteria 24393
163 Ga0496126_0002731 3300048929 Bacteria 23325
164 Ga0496126_0003379 3300048929 Bacteria 20223
165 Ga0496126_0027546 3300048929 Bacteria 5426
166 Ga0501039_0125297 3300049575 Bacteria 2015
167 Ga0501041_0014783 3300049577 Bacteria 4636
168 Ga0501042_0341087 3300049578 Unclassified 1083
169 Ga0501046_0070473 3300049580 Bacteria 2718
170 Ga0501072_0038811 3300049588 Bacteria 3738
171 Ga0501076_0012809 3300049592 Bacteria 6280
172 Ga0501079_0043009 3300049741 Bacteria 3487
173 Ga0501045_0011905 3300049824 Bacteria 6114
174 nmdc:mga06z11_115720_c1 3300050494 Bacteria 1490
175 nmdc:mga08y16_417000_c1 3300050511 Bacteria 1373
176 Ga0500628_001217 3300053129 Unclassified 4467
177 Ga0501084_0039790 3300054114 Bacteria 3932
178 Ga0501082_0218283 3300060353 Bacteria 1659
179 2511179517 2510917027 Bacteria 5287437
180 2511700579 2511231119 Bacteria 4019861
181 2512636154 2512564013 Bacteria 6286191
182 2524187246 2524023129 Bacteria 6762600
183 2540607793 2540341094 Bacteria 4061186
184 2545557277 2545555800 Bacteria 4222588
185 2556062966 2554235469 Bacteria 3590176
186 2563926227 2563366752 Bacteria 4961801
187 2571527426 2571042143 Bacteria 6986194
188 2573040045 2571042588 Bacteria 5045676
189 2578336289 2576861424 Bacteria 5270569
190 2578931540 2576861599 Bacteria 4217202
191 2580931725 2579778775 Bacteria 5360914
192 2587739164 2585428059 Bacteria 8696589
193 2601637206 2600255286 Bacteria 5390125
194 2621274470 2619619294 Bacteria 5575484
195 2631984523 2630968484 Bacteria 3876276
196 2643737700 2643221543 Bacteria 6628015
197 2644428027 2643221676 Bacteria 8119172
198 2644715553 2643221731 Bacteria 5623886
199 2644726857 2643221732 Bacteria 5756404
200 2651532700 2648501850 Bacteria 3975476
201 2673818871 2671180694 Bacteria 7506943
202 2674418594 2671180844 Bacteria 4164150
203 2695628573 2695420354 Bacteria 3922431
204 2712198216 2711768088 Bacteria 3195027
205 2717915734 2716884898 Bacteria 3928789
206 2723603156 2721755693 Bacteria 6126117
207 2728533842 2728368933 Bacteria 7044283
208 2730139185 2728369359 Bacteria 5621728
209 2738815477 2738541295 Bacteria 5730091
210 2739229904 2738543010 Bacteria 5583595
211 2745167790 2744054657 Bacteria 5016802
212 2753808505 2751185905 Bacteria 6142767
213 2793183298 2791355222 Bacteria 5898266
214 2802436291 2802428803 Bacteria 5806948
215 2808869712 2808606364 Bacteria 4465927
216 2809056170 2808606399 Bacteria 4021018
217 2817481169 2816332295 Bacteria 4352468
218 2817617197 2816332336 Bacteria 5207640
219 2819671954 2818991459 Bacteria 8736032
220 2819709021 2818991465 Bacteria 5388835
221 2821113892 2821111986 Bacteria 6894338
222 2831906532 2831905167 Bacteria 3319172
223 2842884739 2842882022 Bacteria 6158489
224 2857460718 2857460504 Bacteria 5194327
225 2857465935 2857465823 Bacteria 6772595
226 2857477134 2857472729 Bacteria 6568124
227 2857593898 2857591370 Bacteria 6569758
228 2860840568 2860837431 Bacteria 4202080
229 2864733830 2864733723 Bacteria 6770668
230 2865001089 2864997549 Bacteria 5139696
231 2865002862 2865002811 Bacteria 6333767
232 2877771481 2877768649 Bacteria 3957164
233 2880172339 2880169592 Bacteria 3900066
234 2881639247 2881636855 Bacteria 5205297
235 2885530248 2885526491 Bacteria 7164189
236 2888583186 2888578766 Bacteria 6743310
237 2889044502 2889042446 Bacteria 7618936
238 2889054597 2889049205 Bacteria 7524325
239 2889279119 2889276214 Bacteria 5979355
240 2889297816 2889295896 Bacteria 4704906
241 2897112615 2897109615 Bacteria 4009619
242 2904118500 2904113452 Bacteria 7796941
243 2904165809 2904162308 Bacteria 7086713
244 2904491380 2904490793 Bacteria 7046938
245 2904524231 2904524088 Bacteria 5887454
246 2904564381 2904560550 Bacteria 4029838
247 2904599423 2904595352 Bacteria 6124848
248 2904758854 2904755435 Bacteria 7986759
249 2907204300 2907202186 Bacteria 6632024
250 2915599940 2915597211 Bacteria 6475886
251 2915609513 2915606848 Bacteria 6032732
252 2916975034 2916971899 Bacteria 4250608
253 2919147192 2919143609 Bacteria 6219228
254 2919160654 2919160200 Bacteria 6929020
255 2919417648 2919414237 Bacteria 5429133
256 2919426055 2919425241 Bacteria 8055701
257 2919519096 2919517244 Bacteria 5858162
258 2919723465 2919720352 Bacteria 5986006
259 2925333338 2925326138 Bacteria 9652120
260 2928096009 2928093941 Bacteria 5965005
261 2929006620 2929004312 Bacteria 5678476
262 2929185121 2929183550 Bacteria 6377511
263 2929208297 2929206907 Bacteria 5918291
264 2931387936 2931384279 Bacteria 7299545
265 2936362080 2936361878 Bacteria 5632809
266 2938651451 2938649242 Bacteria 7118381
267 2939681708 2939679117 Bacteria 6921672
268 2939706068 2939702853 Bacteria 5139229
269 2945993460 2945991243 Bacteria 7008369
270 2946056211 2946053406 Bacteria 6978655
271 2960319628 2960319331 Bacteria 5502575
272 2960381161 2960375949 Bacteria 5361395
273 2962293779 2962290636 Bacteria 4072939
274 2964379323 2964375228 Bacteria 4909004
275 2968562729 2968558590 Bacteria 6956864
276 2969139773 2969136845 Bacteria 3923176
277 2969143929 2969141011 Bacteria 4118468
278 2969769746 2969765954 Bacteria 4216713
279 2969772822 2969770375 Bacteria 4271280
280 2971406671 2971403814 Bacteria 7370929
281 2971411822 2971410472 Bacteria 8311090
282 2971515346 2971511577 Bacteria 5404012
283 2971896145 2971893375 Bacteria 3929648
284 2977256331 2977254563 Bacteria 4828420
285 2980181442 2980176882 Bacteria 5397533
286 2980185401 2980182181 Bacteria 9454109
287 2980495562 2980492589 Bacteria 4072961
288 2981286296 2981284811 Bacteria 4641497
289 2981291246 2981289755 Bacteria 4641509
290 2981981941 2981980479 Bacteria 4641628
291 2981986840 2981985349 Bacteria 4641497
292 2984528699 2984527788 Bacteria 5288478
293 2984534800 2984532647 Bacteria 5288506
294 2988227701 2988225383 Bacteria 7221625
295 2990277209 2990275345 Bacteria 4887158
296 2996634203 2996632988 Bacteria 6921523
297 2996711748 2996706504 Bacteria 5757485
298 3001897516 3001892409 Bacteria 6328293
299 3006829255 3006826541 Bacteria 4678913
300 3006861583 3006858327 Bacteria 4317835
301 3006982130 3006978542 Bacteria 5328100
302 648169523 648028048 Bacteria 5394884
303 8002322222 8002317523 Bacteria 8051857
304 8022632212 8022630665 Bacteria 3886130
305 8022654739 8022653035 Bacteria 4035078
306 8022898443 8022893055 Bacteria 5300455
307 8022917593 8022914991 Bacteria 5584517
308 8022950098 8022948649 Bacteria 5366783
309 8046991685 8046991243 Bacteria 8497463
310 8051954884 8051952484 Bacteria 3926774
311 8052176398 8052174270 Bacteria 3881265
312 8054280886 8054280661 Bacteria 4232245
313 8054467500 8054465665 Bacteria 7323556
314 8054797447 8054795415 Bacteria 9785225
315 8055637179 8055632911 Bacteria 5283357
316 8056538069 8056533031 Bacteria 8964429
317 8057476951 8057473075 Bacteria 5892720
318 8057635718 8057632132 Bacteria 4726859
319 8057734158 8057733483 Bacteria 6578323
320 8057978090 8057977335 Bacteria 5694872
321 Ga0209566_100368
322 JGI25151J46595_10008591
323 JGI25151J46595_10012958
324 JGI25151J46595_10035448
325 rootH1_10005765
326 rootH2_10221815
327 rootL2_10013974
328 rootL2_10330782
329 Ga0006562J51391_1000483
330 Ga0055538_1001041
331 Ga0055532_1003864
332 Ga0055528_1001594
333 Ga0070666_10000203
334 Ga0070666_10041087
335 Ga0070674_100020971
336 Ga0070673_100157994
337 Ga0070672_100105876
338 Ga0070665_100097481
339 Ga0070704_100397016
340 Ga0070715_10137571
341 Ga0075367_10141770
342 Ga0105251_10019433
343 Ga0105244_10027793
344 Ga0105244_10042849
345 Ga0111539_10034131
346 Ga0105247_10019618
347 Ga0105243_10005852
348 Ga0105242_10000303
349 Ga0105246_10001062
350 Ga0105246_10023145
351 Ga0157378_10001003
352 Ga0157378_10001592
353 Ga0163162_10600031
354 Ga0157372_10156227
355 Ga0157376_10073948
356 Ga0209784_100134
357 Ga0209566_100183
358 Ga0209147_100190
359 Ga0209147_100262
360 Ga0209437_100357
361 Ga0209258_101293
362 Ga0209673_1001689
363 Ga0209675_1018048
364 Ga0209025_1005341
365 Ga0209025_1005797
366 Ga0209025_1005842
367 Ga0209025_1019388
368 Ga0209025_1024679
369 Ga0207426_1007297
370 Ga0207696_1003513
371 Ga0207655_1006187
372 Ga0207655_1052373
373 Ga0207713_1000242
374 Ga0207713_1018092
375 Ga0207710_10100630
376 Ga0207680_10000121
377 Ga0207680_10010888
378 Ga0207647_10000003
379 Ga0207686_10041740
380 Ga0207709_10020459
381 Ga0207691_10155161
382 Ga0207708_10212258
383 Ga0207428_10120225
384 Ga0307408_100041873
385 Ga0316575_10025881
386 Ga0316575_10077509
387 Ga0316579_10009147
388 Ga0316579_10011896
389 Ga0316579_10014370
390 Ga0316578_10006106
391 Ga0316578_10138109
392 Ga0307405_10327996
393 Ga0316577_10035376
394 Ga0316577_10036646
395 Ga0316577_10080413
396 Ga0307406_10326844
397 Ga0307412_10517135
398 Ga0307409_100210193
399 Ga0307416_100353919
400 Ga0316580_10004096
401 Ga0373962_0045781
402 Ga0316574_0079625
403 Ga0316574_0102384
404 Ga0373947_0225231
405 Ga0316584_0024827
406 Ga0400488_06052
407 Ga0439436_0010349
408 Ga0439439_0002310
409 Ga0439433_0000416
410 Ga0439449_0000197
411 Ga0439462_0000518
412 Ga0453684_0199010
413 Ga0453684_0233355
414 Ga0453684_0879789
415 Ga0466959_0236345
416 Ga0451576_0013781
417 Ga0495603_0120135
418 Ga0495585_0047305
419 Ga0495622_0054128
420 Ga0495622_0189190
421 Ga0495661_0032877
422 Ga0495661_0084959
423 Ga0495670_0232422
424 Ga0495649_0066473
425 Ga0495660_0044066
426 Ga0495660_0066562
427 Ga0495676_0177677
428 Ga0495683_0006210
429 Ga0496100_0001656
430 Ga0496100_0097225
431 Ga0496101_0002804
432 Ga0496102_0030507
433 Ga0496103_0027585
434 Ga0496104_0003934
435 Ga0496105_0012839
436 Ga0496106_0000224
437 Ga0496107_0003741
438 Ga0496108_0028043
439 Ga0496110_0004762
440 Ga0496110_0114697
441 Ga0496111_0012436
442 Ga0496113_0019042
443 Ga0496116_0005178
444 Ga0496116_0006945
445 Ga0496116_0048629
446 Ga0496116_0056290
447 Ga0496116_0069184
448 Ga0496116_0072831
449 Ga0496116_0103107
450 Ga0496117_0008853
451 Ga0496117_0087075
452 Ga0496118_0005682
453 Ga0496118_0061118
454 Ga0496119_0005766
455 Ga0496119_0008471
456 Ga0496119_0009285
457 Ga0496120_0002515
458 Ga0496120_0006991
459 Ga0496120_0027741
460 Ga0496120_0030992
461 Ga0496121_0041254
462 Ga0496122_0009411
463 Ga0496122_0011678
464 Ga0496122_0022837
465 Ga0496122_0023292
466 Ga0496122_0028747
467 Ga0496122_0069980
468 Ga0496122_0155783
469 Ga0496123_0030628
470 Ga0496123_0049507
471 Ga0496123_0082326
472 Ga0496124_0000183
473 Ga0496124_0000335
474 Ga0496124_0066518
475 Ga0496124_0100974
476 Ga0496124_0336848
477 Ga0496125_0000535
478 Ga0496125_0001459
479 Ga0496125_0015306
480 Ga0496125_0016268
481 Ga0496126_0002544
482 Ga0496126_0002731
483 Ga0496126_0003379
484 Ga0496126_0027546
485 Ga0501039_0125297
486 Ga0501041_0014783
487 Ga0501042_0341087
488 Ga0501046_0070473
489 Ga0501072_0038811
490 Ga0501076_0012809
491 Ga0501079_0043009
492 Ga0501045_0011905
493 nmdc:mga06z11_115720_c1
494 nmdc:mga08y16_417000_c1
495 Ga0500628_001217
496 Ga0501084_0039790
497 Ga0501082_0218283
498 2511179517
499 2511700579
500 2512636154
501 2524187246
502 2540607793
503 2545557277
504 2556062966
505 2563926227
506 2571527426
507 2573040045
508 2578336289
509 2578931540
510 2580931725
511 2587739164
512 2601637206
513 2621274470
514 2631984523
515 2643737700
516 2644428027
517 2644715553
518 2644726857
519 2651532700
520 2673818871
521 2674418594
522 2695628573
523 2712198216
524 2717915734
525 2723603156
526 2728533842
527 2730139185
528 2738815477
529 2739229904
530 2745167790
531 2753808505
532 2793183298
533 2802436291
534 2808869712
535 2809056170
536 2817481169
537 2817617197
538 2819671954
539 2819709021
540 2821113892
541 2831906532
542 2842884739
543 2857460718
544 2857465935
545 2857477134
546 2857593898
547 2860840568
548 2864733830
549 2865001089
550 2865002862
551 2877771481
552 2880172339
553 2881639247
554 2885530248
555 2888583186
556 2889044502
557 2889054597
558 2889279119
559 2889297816
560 2897112615
561 2904118500
562 2904165809
563 2904491380
564 2904524231
565 2904564381
566 2904599423
567 2904758854
568 2907204300
569 2915599940
570 2915609513
571 2916975034
572 2919147192
573 2919160654
574 2919417648
575 2919426055
576 2919519096
577 2919723465
578 2925333338
579 2928096009
580 2929006620
581 2929185121
582 2929208297
583 2931387936
584 2936362080
585 2938651451
586 2939681708
587 2939706068
588 2945993460
589 2946056211
590 2960319628
591 2960381161
592 2962293779
593 2964379323
594 2968562729
595 2969139773
596 2969143929
597 2969769746
598 2969772822
599 2971406671
600 2971411822
601 2971515346
602 2971896145
603 2977256331
604 2980181442
605 2980185401
606 2980495562
607 2981286296
608 2981291246
609 2981981941
610 2981986840
611 2984528699
612 2984534800
613 2988227701
614 2990277209
615 2996634203
616 2996711748
617 3001897516
618 3006829255
619 3006861583
620 3006982130
621 648169523
622 8002322222
623 8022632212
624 8022654739
625 8022898443
626 8022917593
627 8022950098
628 8046991685
629 8051954884
630 8052176398
631 8054280886
632 8054467500
633 8054797447
634 8055637179
635 8056538069
636 8057476951
637 8057635718
638 8057734158
639 8057978090

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

134

226

0.98

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

246

275

0.97

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

117

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l2d-assembly1.cif.gz_A mutm (fpg)-dna estranged guanine mismatch recognition complex 0.9885 2 273
3jr5-assembly1.cif.gz_A mutm lesion recognition control complex with n174c crosslinking site 0.9872 2 273
3jr4-assembly1.cif.gz_A mutm interrogating an extrahelical g 0.9871 2 273
3gq4-assembly1.cif.gz_A sequence-matched mutm lesion recognition complex 5 (lrc5) 0.9866 2 273
1l2b-assembly1.cif.gz_A mutm (fpg) dna end-product structure 0.9863 2 273
ID Description Score Start End Superfamily
1l1tA01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9911 2 131 3.20.190.10
1l1tA01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9689 2 131 3.20.190.10
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9686 134 273 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9663 134 273 1.10.8.50
1ee8B02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9654 134 269 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A511ZDR6-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9936 1 276 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A5D0CYT8-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9914 1 277 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7U9JD24-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9912 2 273 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A5D0CYT8-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9878 1 277 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A511ZDR6-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9864 1 276 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Map