F405029

General Info

Members Datasets Scaffolds Average Seq Length
319 181 638 448

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100008033|Ga0075434_1000080333
Length 463
Sequence VSSNSDYDVIILGGGAPGEHCAGVLAARGLRVAIVERELVGGECSYWACIPSKSLLRPGEAVQGAREAGASAQVDVQAALAWRDFMVSNYSDAGQARWLASRGIDLLRGTGRLAGTGVVEVGGARHTAEHVVVATGADPIVPPLPGLRELEGVWGTREATSMKTVPRRLLVLGGGSAGVEIAQIVRRFGGEVALVEGAARVIPREPAPLGQALSEALRRDGVELVLGMHAAAAXXXXDEYVLQFDGGKELRGDRLLVATGRRPRVAGIGLETVGVEANPHGIRVDEYLRAGERLWAIGDVTGIWPLTHVGEYEGDVVAANIAGEARRANYEAVPRVTYTDPQAAAVGASEAEYSGTAPVSEVPKTATYTHAYAESNGFLTLLSDGERLTGAYALGPEAGEWMQQATLAIRAHIPLEVLSDTIQPFPSFSGIYNAALVELRMAIADMPRPASPMAAQMASISEE

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
78 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2558860280 Kutzneria sp. 744 Isolate Unclassified
180 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
181 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 1.25
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 13.79
Rhizosphere 79.94
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100008033 3300006871 Bacteria 9781
2 Ga0070658_10013641 3300005327 Bacteria 6520
3 Ga0070683_100069414 3300005329 Bacteria 3286
4 Ga0068868_100031011 3300005338 Bacteria 4103
5 Ga0070668_100014566 3300005347 Bacteria 5877
6 Ga0070709_10002264 3300005434 Bacteria 10430
7 Ga0070709_10064782 3300005434 Bacteria 2338
8 Ga0070709_10075379 3300005434 Bacteria 2188
9 Ga0070714_100002053 3300005435 Bacteria 14752
10 Ga0070714_100092090 3300005435 Bacteria 2657
11 Ga0070714_100104240 3300005435 Bacteria 2503
12 Ga0070713_100003501 3300005436 Bacteria 10366
13 Ga0070713_100006618 3300005436 Bacteria 8056
14 Ga0070713_100035040 3300005436 Bacteria 4038
15 Ga0070713_100088160 3300005436 Bacteria 2663
16 Ga0070710_10001071 3300005437 Bacteria 12967
17 Ga0070710_10015951 3300005437 Bacteria 3812
18 Ga0070710_10075591 3300005437 Bacteria 1952
19 Ga0070711_100000588 3300005439 Bacteria 18987
20 Ga0070711_100030455 3300005439 Bacteria 3572
21 Ga0070711_100043063 3300005439 Bacteria 3056
22 Ga0070705_100043268 3300005440 Bacteria 2580
23 Ga0070708_100008925 3300005445 Bacteria 8073
24 Ga0070708_100107820 3300005445 Bacteria 2557
25 Ga0070708_100162669 3300005445 Bacteria 2080
26 Ga0070678_100128873 3300005456 Bacteria 2007
27 Ga0070681_10035667 3300005458 Bacteria 4995
28 Ga0070706_100042665 3300005467 Bacteria 4191
29 Ga0070707_100007709 3300005468 Bacteria 9998
30 Ga0070707_100021947 3300005468 Bacteria 6037
31 Ga0070707_100144962 3300005468 Bacteria 2311
32 Ga0070698_100003651 3300005471 Bacteria 16898
33 Ga0070698_100005013 3300005471 Bacteria 14509
34 Ga0070699_100000237 3300005518 Bacteria 53797
35 Ga0070699_100009516 3300005518 Bacteria 8420
36 Ga0070699_100079807 3300005518 Bacteria 2851
37 Ga0070679_100084673 3300005530 Bacteria 3158
38 Ga0070684_100062487 3300005535 Bacteria 3262
39 Ga0070697_100022401 3300005536 Bacteria 5014
40 Ga0070693_100084379 3300005547 Bacteria 1901
41 Ga0070665_100023580 3300005548 Bacteria 6196
42 Ga0070665_100250460 3300005548 Bacteria 1772
43 Ga0068857_100097205 3300005577 Bacteria 2640
44 Ga0068856_100024204 3300005614 Bacteria 5907
45 Ga0068856_100040597 3300005614 Bacteria 4571
46 Ga0070702_100001322 3300005615 Bacteria 10043
47 Ga0068864_100032847 3300005618 Bacteria 4411
48 Ga0068864_100070266 3300005618 Bacteria 3046
49 Ga0068862_100000973 3300005844 Bacteria 27530
50 Ga0081539_10001782 3300005985 Bacteria 34184
51 Ga0070717_10001024 3300006028 Bacteria 18729
52 Ga0070717_10012582 3300006028 Bacteria 6456
53 Ga0070717_10229836 3300006028 Bacteria 1633
54 Ga0070716_100000580 3300006173 Bacteria 15351
55 Ga0070716_100020894 3300006173 Bacteria 3443
56 Ga0070712_100001279 3300006175 Bacteria 15193
57 Ga0070712_100006912 3300006175 Bacteria 7069
58 Ga0070712_100038626 3300006175 Bacteria 3263
59 Ga0075431_100065347 3300006847 Bacteria 3757
60 Ga0075436_100071821 3300006914 Bacteria 2394
61 Ga0075435_100023659 3300007076 Bacteria 4755
62 Ga0111539_10001540 3300009094 Bacteria 30701
63 Ga0111539_10004337 3300009094 Bacteria 18563
64 Ga0105245_10086509 3300009098 Bacteria 2875
65 Ga0114129_10238296 3300009147 Bacteria 2447
66 Ga0114129_10385244 3300009147 Bacteria 1851
67 Ga0105242_10163477 3300009176 Bacteria 1950
68 Ga0105249_10009688 3300009553 Bacteria 8442
69 Ga0157369_10036606 3300013105 Bacteria 5375
70 Ga0157369_10116928 3300013105 Bacteria 2831
71 Ga0157378_10114366 3300013297 Bacteria 2479
72 Ga0157380_10020466 3300014326 Bacteria 4946
73 Ga0157377_10023164 3300014745 Bacteria 3289
74 Ga0157379_10002011 3300014968 Bacteria 16848
75 Ga0157379_10029764 3300014968 Bacteria 4855
76 Ga0157376_10038591 3300014969 Bacteria 3887
77 Ga0163161_10050116 3300017792 Bacteria 3021
78 Ga0206351_10870403 3300020077 Bacteria 2731
79 Ga0206354_10639923 3300020081 Bacteria 4956
80 Ga0213874_10008645 3300021377 Bacteria 2489
81 Ga0213875_10020407 3300021388 Bacteria 3179
82 Ga0224712_10002280 3300022467 Bacteria 4697
83 Ga0224712_10007728 3300022467 Bacteria 3147
84 Ga0207426_1000338 3300025302 Bacteria 88019
85 Ga0207692_10001153 3300025898 Bacteria 9752
86 Ga0207692_10007819 3300025898 Bacteria 4398
87 Ga0207692_10018840 3300025898 Bacteria 3106
88 Ga0207692_10021370 3300025898 Bacteria 2960
89 Ga0207685_10005230 3300025905 Bacteria 3402
90 Ga0207685_10030499 3300025905 Bacteria 1920
91 Ga0207699_10002094 3300025906 Bacteria 9434
92 Ga0207699_10002854 3300025906 Bacteria 8178
93 Ga0207699_10011514 3300025906 Bacteria 4470
94 Ga0207699_10031438 3300025906 Bacteria 2980
95 Ga0207699_10047388 3300025906 Bacteria 2520
96 Ga0207699_10055309 3300025906 Bacteria 2361
97 Ga0207705_10057282 3300025909 Bacteria 2811
98 Ga0207684_10019714 3300025910 Bacteria 5768
99 Ga0207684_10089352 3300025910 Bacteria 2625
100 Ga0207684_10109694 3300025910 Bacteria 2362
101 Ga0207707_10025384 3300025912 Bacteria 5184
102 Ga0207693_10002713 3300025915 Bacteria 15346
103 Ga0207693_10013263 3300025915 Bacteria 6649
104 Ga0207693_10044988 3300025915 Bacteria 3468
105 Ga0207663_10005243 3300025916 Bacteria 6524
106 Ga0207663_10047310 3300025916 Bacteria 2655
107 Ga0207663_10075919 3300025916 Bacteria 2182
108 Ga0207657_10046091 3300025919 Bacteria 3820
109 Ga0207652_10054570 3300025921 Bacteria 3435
110 Ga0207646_10008925 3300025922 Bacteria 9983
111 Ga0207646_10022040 3300025922 Bacteria 5876
112 Ga0207646_10022192 3300025922 Bacteria 5853
113 Ga0207646_10254723 3300025922 Bacteria 1586
114 Ga0207700_10001414 3300025928 Bacteria 13622
115 Ga0207700_10002352 3300025928 Bacteria 10855
116 Ga0207700_10021922 3300025928 Bacteria 4373
117 Ga0207700_10037170 3300025928 Bacteria 3524
118 Ga0207664_10000125 3300025929 Bacteria 66876
119 Ga0207664_10005101 3300025929 Bacteria 8946
120 Ga0207664_10024631 3300025929 Bacteria 4523
121 Ga0207664_10037753 3300025929 Bacteria 3741
122 Ga0207664_10140622 3300025929 Bacteria 2041
123 Ga0207665_10001760 3300025939 Bacteria 14534
124 Ga0207665_10140611 3300025939 Bacteria 1721
125 Ga0207712_10018194 3300025961 Bacteria 4574
126 Ga0207668_10012104 3300025972 Bacteria 5271
127 Ga0207668_10074155 3300025972 Bacteria 2442
128 Ga0207658_10002621 3300025986 Bacteria 13054
129 Ga0207677_10010377 3300026023 Bacteria 5268
130 Ga0207703_10038283 3300026035 Bacteria 3826
131 Ga0207702_10030189 3300026078 Bacteria 4516
132 Ga0207702_10162732 3300026078 Bacteria 2039
133 Ga0207676_10077425 3300026095 Bacteria 2690
134 Ga0207428_10019685 3300027907 Bacteria 5752
135 Ga0207428_10122585 3300027907 Bacteria 1993
136 Ga0268265_10001017 3300028380 Bacteria 25271
137 Ga0373958_0007907 3300034819 Bacteria 1708
138 Ga0373959_0008055 3300034820 Bacteria 1784
139 Ga0373926_0012768 3300035083 Bacteria 2843
140 Ga0373934_0002682 3300035086 Bacteria 6537
141 Ga0373934_0013500 3300035086 Bacteria 3089
142 Ga0373941_0012152 3300035115 Bacteria 2244
143 Ga0373945_0044161 3300035116 Bacteria 1619
144 Ga0373953_0002039 3300035117 Bacteria 6013
145 Ga0373954_0011878 3300035118 Bacteria 3867
146 Ga0373956_0003384 3300035119 Bacteria 6425
147 Ga0373956_0015317 3300035119 Bacteria 3209
148 Ga0373957_0000652 3300035120 Bacteria 8908
149 Ga0373943_0002414 3300035170 Bacteria 8473
150 Ga0373946_0034961 3300035171 Bacteria 2032
151 Ga0373955_0001273 3300035172 Bacteria 10719
152 Ga0373955_0008149 3300035172 Bacteria 4849
153 Ga0373924_0014419 3300035410 Bacteria 2987
154 Ga0373935_0139888 3300035692 Bacteria 1634
155 Ga0373927_0034369 3300035695 Bacteria 3298
156 Ga0373927_0056019 3300035695 Bacteria 2548
157 Ga0373933_0011228 3300035724 Bacteria 4930
158 Ga0373947_0042869 3300035725 Bacteria 2701
159 Ga0373947_0105867 3300035725 Bacteria 1772
160 Ga0373937_0009466 3300036401 Bacteria 8469
161 Ga0373937_0035571 3300036401 Bacteria 4534
162 Ga0373925_0159526 3300037068 Bacteria 1776
163 Ga0395900_0103198 3300037418 Bacteria 2929
164 Ga0395898_0199462 3300037466 Bacteria 1911
165 Ga0395898_0233736 3300037466 Bacteria 1753
166 Ga0436364_0094526 3300037853 Bacteria 5700
167 Ga0436364_0431017 3300037853 Bacteria 22054
168 Ga0436364_0968611 3300037853 Bacteria 2956
169 Ga0395901_0181243 3300038443 Bacteria 2209
170 Ga0395901_0309774 3300038443 Bacteria 1635
171 Ga0436365_0510016 3300039437 Bacteria 1884
172 Ga0436365_0945109 3300039437 Bacteria 32440
173 Ga0436365_1290681 3300039437 Bacteria 1760
174 Ga0436363_0122939 3300039450 Bacteria 1558
175 Ga0436363_0485426 3300039450 Bacteria 6611
176 Ga0436363_0580471 3300039450 Bacteria 3464
177 Ga0436363_1197220 3300039450 Bacteria 1517
178 Ga0439450_001836 3300042008 Bacteria 3207
179 Ga0439440_0001278 3300042993 Bacteria 4560
180 Ga0466965_0020394 3300044683 Bacteria 3186
181 Ga0466963_0007959 3300044694 Bacteria 6346
182 Ga0466963_0012641 3300044694 Bacteria 5171
183 Ga0466963_0026742 3300044694 Bacteria 3692
184 Ga0466963_0074047 3300044694 Bacteria 2297
185 Ga0466967_0015955 3300045976 Bacteria 5906
186 Ga0466967_0104079 3300045976 Bacteria 2598
187 Ga0466967_0121853 3300045976 Bacteria 2411
188 Ga0466967_0143004 3300045976 Bacteria 2229
189 Ga0495592_0007636 3300046454 Bacteria 8098
190 Ga0495592_0083936 3300046454 Bacteria 2299
191 Ga0495603_0056441 3300046455 Bacteria 2325
192 Ga0495641_0004202 3300046461 Bacteria 10325
193 Ga0495641_0015908 3300046461 Bacteria 3987
194 Ga0495651_0019365 3300046462 Bacteria 5275
195 Ga0495653_0015300 3300046463 Bacteria 6254
196 Ga0495653_0064792 3300046463 Bacteria 2752
197 Ga0495580_0146876 3300046472 Bacteria 1634
198 Ga0495582_0011577 3300046473 Bacteria 4861
199 Ga0495662_0019760 3300046476 Bacteria 3259
200 Ga0495662_0020392 3300046476 Bacteria 3206
201 Ga0495594_0038409 3300046499 Bacteria 2614
202 Ga0495608_0011137 3300046511 Bacteria 6260
203 Ga0495608_0020833 3300046511 Bacteria 4504
204 Ga0495618_0017276 3300046514 Bacteria 4421
205 Ga0495628_0020066 3300046516 Bacteria 5516
206 Ga0495630_0168999 3300046517 Bacteria 1665
207 Ga0495666_0071261 3300046526 Bacteria 1652
208 Ga0495652_0028500 3300046529 Bacteria 4913
209 Ga0495665_0002110 3300046531 Bacteria 10763
210 Ga0495665_0006101 3300046531 Bacteria 6505
211 Ga0495640_0024926 3300046533 Bacteria 4346
212 Ga0495586_0014352 3300046535 Bacteria 4209
213 Ga0495587_0000655 3300046536 Bacteria 23214
214 Ga0495587_0021125 3300046536 Bacteria 4014
215 Ga0495587_0050557 3300046536 Bacteria 2459
216 Ga0495645_0008226 3300046543 Bacteria 7274
217 Ga0495645_0019826 3300046543 Bacteria 4845
218 Ga0495645_0034333 3300046543 Bacteria 3701
219 Ga0495667_0000560 3300046559 Bacteria 23722
220 Ga0495667_0004346 3300046559 Bacteria 9566
221 Ga0495667_0009893 3300046559 Bacteria 6458
222 Ga0495667_0034254 3300046559 Bacteria 3395
223 Ga0495634_0009278 3300046642 Bacteria 7264
224 Ga0495634_0020158 3300046642 Bacteria 4730
225 Ga0495635_0045791 3300046663 Bacteria 3018
226 Ga0495657_0006712 3300046675 Bacteria 8976
227 Ga0495599_0021615 3300046678 Bacteria 4015
228 Ga0495599_0029420 3300046678 Bacteria 3444
229 Ga0495623_0028050 3300046679 Bacteria 3624
230 Ga0495623_0028408 3300046679 Bacteria 3598
231 Ga0495623_0066787 3300046679 Bacteria 2246
232 Ga0495646_0028647 3300046680 Bacteria 3485
233 Ga0495646_0069046 3300046680 Bacteria 2085
234 Ga0495647_0029752 3300046681 Bacteria 2022
235 Ga0495624_0033596 3300046690 Bacteria 3322
236 Ga0495600_0009699 3300046809 Bacteria 5949
237 Ga0495600_0024335 3300046809 Bacteria 3897
238 Ga0495604_0078135 3300047317 Bacteria 2484
239 Ga0495604_0082579 3300047317 Bacteria 2403
240 Ga0495674_0030623 3300047319 Bacteria 4891
241 Ga0495680_0021217 3300047322 Bacteria 5442
242 Ga0495680_0029159 3300047322 Bacteria 4521
243 Ga0495675_0011663 3300047444 Bacteria 5518
244 Ga0495684_0078508 3300047471 Bacteria 2505
245 Ga0495602_0039540 3300048088 Bacteria 4341
246 Ga0495602_0075279 3300048088 Bacteria 2865
247 Ga0495614_0041225 3300048089 Bacteria 1980
248 Ga0496100_0119417 3300048903 Bacteria 1842
249 Ga0496101_0050206 3300048904 Bacteria 3002
250 Ga0496101_0133970 3300048904 Bacteria 1884
251 Ga0496101_0203383 3300048904 Bacteria 1532
252 Ga0496102_0007405 3300048905 Bacteria 9377
253 Ga0496102_0061888 3300048905 Bacteria 3427
254 Ga0496102_0102953 3300048905 Bacteria 2655
255 Ga0496102_0106695 3300048905 Bacteria 2607
256 Ga0496104_0012478 3300048907 Bacteria 7642
257 Ga0496104_0028912 3300048907 Bacteria 5140
258 Ga0496105_0008809 3300048908 Bacteria 7857
259 Ga0496105_0026318 3300048908 Bacteria 4744
260 Ga0496105_0030348 3300048908 Bacteria 4429
261 Ga0496105_0113632 3300048908 Bacteria 2234
262 Ga0496105_0143923 3300048908 Bacteria 1961
263 Ga0496105_0255139 3300048908 Bacteria 1420
264 Ga0496106_0005903 3300048909 Bacteria 9051
265 Ga0496106_0031168 3300048909 Bacteria 3973
266 Ga0496107_0004150 3300048910 Bacteria 9771
267 Ga0496108_0003467 3300048911 Bacteria 12654
268 Ga0496108_0052592 3300048911 Bacteria 3414
269 Ga0496108_0059330 3300048911 Bacteria 3217
270 Ga0496109_0010501 3300048912 Bacteria 7912
271 Ga0496109_0022023 3300048912 Bacteria 5642
272 Ga0496109_0119098 3300048912 Bacteria 2458
273 Ga0496109_0251507 3300048912 Bacteria 1664
274 Ga0496110_0015799 3300048913 Bacteria 6294
275 Ga0496110_0059659 3300048913 Bacteria 3363
276 Ga0496111_0020487 3300048914 Bacteria 4604
277 Ga0496111_0024827 3300048914 Bacteria 4227
278 Ga0496111_0057774 3300048914 Bacteria 2808
279 Ga0496112_0002277 3300048915 Bacteria 15347
280 Ga0496112_0008349 3300048915 Bacteria 9273
281 Ga0496112_0060925 3300048915 Bacteria 3719
282 Ga0496113_0189480 3300048916 Bacteria 1632
283 Ga0496114_0000389 3300048917 Bacteria 32470
284 Ga0496114_0087859 3300048917 Bacteria 2636
285 Ga0496114_0091625 3300048917 Bacteria 2582
286 Ga0496114_0196076 3300048917 Bacteria 1768
287 Ga0496114_0202874 3300048917 Bacteria 1737
288 Ga0496115_0000188 3300048918 Bacteria 57530
289 Ga0496115_0024472 3300048918 Bacteria 4694
290 Ga0496115_0030532 3300048918 Bacteria 4240
291 Ga0496115_0073260 3300048918 Bacteria 2779
292 Ga0496119_0097427 3300048922 Bacteria 1658
293 Ga0496121_0025459 3300048924 Bacteria 5612
294 Ga0496126_0017987 3300048929 Bacteria 7027
295 Ga0496126_0026164 3300048929 Bacteria 5599
296 Ga0501071_0033049 3300049587 Bacteria 3676
297 Ga0501072_0020093 3300049588 Bacteria 5172
298 Ga0501072_0166859 3300049588 Bacteria 1757
299 Ga0501074_0055791 3300049590 Bacteria 2847
300 Ga0501081_0276323 3300049743 Bacteria 1229
301 nmdc:mga05p37_10903_c1 3300050507 Bacteria 10792
302 nmdc:mga09592_260909_c1 3300050508 Bacteria 1502
303 nmdc:mga08y16_143676_c1 3300050511 Bacteria 2480
304 nmdc:mga08y16_94363_c1 3300050511 Bacteria 3117
305 nmdc:mga0n895_2557_c1 3300050512 Bacteria 14264
306 nmdc:mga0n895_80242_c1 3300050512 Bacteria 3251
307 nmdc:mga08x19_36945_c1 3300050514 Unclassified 3096
308 nmdc:mga0a205_20111_c1 3300050515 Bacteria 6298
309 Ga0495601_0017942 3300053077 Bacteria 4302
310 Ga0495601_0018904 3300053077 Bacteria 4198
311 Ga0495612_0007232 3300053078 Bacteria 4542
312 Ga0495595_0044782 3300053084 Bacteria 2033
313 Ga0495595_0088305 3300053084 Bacteria 1485
314 Ga0500616_0000235 3300053153 Bacteria 86785
315 Ga0501084_0037641 3300054114 Bacteria 4043
316 Ga0530510_0044361 3300061734 Bacteria 3213
317 2559432982 2558860280 Bacteria 11429938
318 2819665767 2818991458 Bacteria 4794049
319 2915358838 2915358134 Bacteria 6050864
320 Ga0075434_100008033
321 Ga0070658_10013641
322 Ga0070683_100069414
323 Ga0068868_100031011
324 Ga0070668_100014566
325 Ga0070709_10002264
326 Ga0070709_10064782
327 Ga0070709_10075379
328 Ga0070714_100002053
329 Ga0070714_100092090
330 Ga0070714_100104240
331 Ga0070713_100003501
332 Ga0070713_100006618
333 Ga0070713_100035040
334 Ga0070713_100088160
335 Ga0070710_10001071
336 Ga0070710_10015951
337 Ga0070710_10075591
338 Ga0070711_100000588
339 Ga0070711_100030455
340 Ga0070711_100043063
341 Ga0070705_100043268
342 Ga0070708_100008925
343 Ga0070708_100107820
344 Ga0070708_100162669
345 Ga0070678_100128873
346 Ga0070681_10035667
347 Ga0070706_100042665
348 Ga0070707_100007709
349 Ga0070707_100021947
350 Ga0070707_100144962
351 Ga0070698_100003651
352 Ga0070698_100005013
353 Ga0070699_100000237
354 Ga0070699_100009516
355 Ga0070699_100079807
356 Ga0070679_100084673
357 Ga0070684_100062487
358 Ga0070697_100022401
359 Ga0070693_100084379
360 Ga0070665_100023580
361 Ga0070665_100250460
362 Ga0068857_100097205
363 Ga0068856_100024204
364 Ga0068856_100040597
365 Ga0070702_100001322
366 Ga0068864_100032847
367 Ga0068864_100070266
368 Ga0068862_100000973
369 Ga0081539_10001782
370 Ga0070717_10001024
371 Ga0070717_10012582
372 Ga0070717_10229836
373 Ga0070716_100000580
374 Ga0070716_100020894
375 Ga0070712_100001279
376 Ga0070712_100006912
377 Ga0070712_100038626
378 Ga0075431_100065347
379 Ga0075436_100071821
380 Ga0075435_100023659
381 Ga0111539_10001540
382 Ga0111539_10004337
383 Ga0105245_10086509
384 Ga0114129_10238296
385 Ga0114129_10385244
386 Ga0105242_10163477
387 Ga0105249_10009688
388 Ga0157369_10036606
389 Ga0157369_10116928
390 Ga0157378_10114366
391 Ga0157380_10020466
392 Ga0157377_10023164
393 Ga0157379_10002011
394 Ga0157379_10029764
395 Ga0157376_10038591
396 Ga0163161_10050116
397 Ga0206351_10870403
398 Ga0206354_10639923
399 Ga0213874_10008645
400 Ga0213875_10020407
401 Ga0224712_10002280
402 Ga0224712_10007728
403 Ga0207426_1000338
404 Ga0207692_10001153
405 Ga0207692_10007819
406 Ga0207692_10018840
407 Ga0207692_10021370
408 Ga0207685_10005230
409 Ga0207685_10030499
410 Ga0207699_10002094
411 Ga0207699_10002854
412 Ga0207699_10011514
413 Ga0207699_10031438
414 Ga0207699_10047388
415 Ga0207699_10055309
416 Ga0207705_10057282
417 Ga0207684_10019714
418 Ga0207684_10089352
419 Ga0207684_10109694
420 Ga0207707_10025384
421 Ga0207693_10002713
422 Ga0207693_10013263
423 Ga0207693_10044988
424 Ga0207663_10005243
425 Ga0207663_10047310
426 Ga0207663_10075919
427 Ga0207657_10046091
428 Ga0207652_10054570
429 Ga0207646_10008925
430 Ga0207646_10022040
431 Ga0207646_10022192
432 Ga0207646_10254723
433 Ga0207700_10001414
434 Ga0207700_10002352
435 Ga0207700_10021922
436 Ga0207700_10037170
437 Ga0207664_10000125
438 Ga0207664_10005101
439 Ga0207664_10024631
440 Ga0207664_10037753
441 Ga0207664_10140622
442 Ga0207665_10001760
443 Ga0207665_10140611
444 Ga0207712_10018194
445 Ga0207668_10012104
446 Ga0207668_10074155
447 Ga0207658_10002621
448 Ga0207677_10010377
449 Ga0207703_10038283
450 Ga0207702_10030189
451 Ga0207702_10162732
452 Ga0207676_10077425
453 Ga0207428_10019685
454 Ga0207428_10122585
455 Ga0268265_10001017
456 Ga0373958_0007907
457 Ga0373959_0008055
458 Ga0373926_0012768
459 Ga0373934_0002682
460 Ga0373934_0013500
461 Ga0373941_0012152
462 Ga0373945_0044161
463 Ga0373953_0002039
464 Ga0373954_0011878
465 Ga0373956_0003384
466 Ga0373956_0015317
467 Ga0373957_0000652
468 Ga0373943_0002414
469 Ga0373946_0034961
470 Ga0373955_0001273
471 Ga0373955_0008149
472 Ga0373924_0014419
473 Ga0373935_0139888
474 Ga0373927_0034369
475 Ga0373927_0056019
476 Ga0373933_0011228
477 Ga0373947_0042869
478 Ga0373947_0105867
479 Ga0373937_0009466
480 Ga0373937_0035571
481 Ga0373925_0159526
482 Ga0395900_0103198
483 Ga0395898_0199462
484 Ga0395898_0233736
485 Ga0436364_0094526
486 Ga0436364_0431017
487 Ga0436364_0968611
488 Ga0395901_0181243
489 Ga0395901_0309774
490 Ga0436365_0510016
491 Ga0436365_0945109
492 Ga0436365_1290681
493 Ga0436363_0122939
494 Ga0436363_0485426
495 Ga0436363_0580471
496 Ga0436363_1197220
497 Ga0439450_001836
498 Ga0439440_0001278
499 Ga0466965_0020394
500 Ga0466963_0007959
501 Ga0466963_0012641
502 Ga0466963_0026742
503 Ga0466963_0074047
504 Ga0466967_0015955
505 Ga0466967_0104079
506 Ga0466967_0121853
507 Ga0466967_0143004
508 Ga0495592_0007636
509 Ga0495592_0083936
510 Ga0495603_0056441
511 Ga0495641_0004202
512 Ga0495641_0015908
513 Ga0495651_0019365
514 Ga0495653_0015300
515 Ga0495653_0064792
516 Ga0495580_0146876
517 Ga0495582_0011577
518 Ga0495662_0019760
519 Ga0495662_0020392
520 Ga0495594_0038409
521 Ga0495608_0011137
522 Ga0495608_0020833
523 Ga0495618_0017276
524 Ga0495628_0020066
525 Ga0495630_0168999
526 Ga0495666_0071261
527 Ga0495652_0028500
528 Ga0495665_0002110
529 Ga0495665_0006101
530 Ga0495640_0024926
531 Ga0495586_0014352
532 Ga0495587_0000655
533 Ga0495587_0021125
534 Ga0495587_0050557
535 Ga0495645_0008226
536 Ga0495645_0019826
537 Ga0495645_0034333
538 Ga0495667_0000560
539 Ga0495667_0004346
540 Ga0495667_0009893
541 Ga0495667_0034254
542 Ga0495634_0009278
543 Ga0495634_0020158
544 Ga0495635_0045791
545 Ga0495657_0006712
546 Ga0495599_0021615
547 Ga0495599_0029420
548 Ga0495623_0028050
549 Ga0495623_0028408
550 Ga0495623_0066787
551 Ga0495646_0028647
552 Ga0495646_0069046
553 Ga0495647_0029752
554 Ga0495624_0033596
555 Ga0495600_0009699
556 Ga0495600_0024335
557 Ga0495604_0078135
558 Ga0495604_0082579
559 Ga0495674_0030623
560 Ga0495680_0021217
561 Ga0495680_0029159
562 Ga0495675_0011663
563 Ga0495684_0078508
564 Ga0495602_0039540
565 Ga0495602_0075279
566 Ga0495614_0041225
567 Ga0496100_0119417
568 Ga0496101_0050206
569 Ga0496101_0133970
570 Ga0496101_0203383
571 Ga0496102_0007405
572 Ga0496102_0061888
573 Ga0496102_0102953
574 Ga0496102_0106695
575 Ga0496104_0012478
576 Ga0496104_0028912
577 Ga0496105_0008809
578 Ga0496105_0026318
579 Ga0496105_0030348
580 Ga0496105_0113632
581 Ga0496105_0143923
582 Ga0496105_0255139
583 Ga0496106_0005903
584 Ga0496106_0031168
585 Ga0496107_0004150
586 Ga0496108_0003467
587 Ga0496108_0052592
588 Ga0496108_0059330
589 Ga0496109_0010501
590 Ga0496109_0022023
591 Ga0496109_0119098
592 Ga0496109_0251507
593 Ga0496110_0015799
594 Ga0496110_0059659
595 Ga0496111_0020487
596 Ga0496111_0024827
597 Ga0496111_0057774
598 Ga0496112_0002277
599 Ga0496112_0008349
600 Ga0496112_0060925
601 Ga0496113_0189480
602 Ga0496114_0000389
603 Ga0496114_0087859
604 Ga0496114_0091625
605 Ga0496114_0196076
606 Ga0496114_0202874
607 Ga0496115_0000188
608 Ga0496115_0024472
609 Ga0496115_0030532
610 Ga0496115_0073260
611 Ga0496119_0097427
612 Ga0496121_0025459
613 Ga0496126_0017987
614 Ga0496126_0026164
615 Ga0501071_0033049
616 Ga0501072_0020093
617 Ga0501072_0166859
618 Ga0501074_0055791
619 Ga0501081_0276323
620 nmdc:mga05p37_10903_c1
621 nmdc:mga09592_260909_c1
622 nmdc:mga08y16_143676_c1
623 nmdc:mga08y16_94363_c1
624 nmdc:mga0n895_2557_c1
625 nmdc:mga0n895_80242_c1
626 nmdc:mga08x19_36945_c1
627 nmdc:mga0a205_20111_c1
628 Ga0495601_0017942
629 Ga0495601_0018904
630 Ga0495612_0007232
631 Ga0495595_0044782
632 Ga0495595_0088305
633 Ga0500616_0000235
634 Ga0501084_0037641
635 Ga0530510_0044361
636 2559432982
637 2819665767
638 2915358838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

7

314

0.94

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

168

245

0.92

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

333

436

0.89

PF00890

FAD_binding_2

FAD binding domain

8

153

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdw-assembly1.cif.gz_A nad+-dependent (r)-2-hydroxyglutarate dehydrogenase from acidaminococcus fermentans 0.9525 165 193
2yq5-assembly1.cif.gz_C crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus: nad complexed form 0.9315 165 193
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9241 4 40
1b8s-assembly1.cif.gz_A cholesterol oxidase from streptomyces glu361gln mutant 0.9231 6 36
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.923 6 40
ID Description Score Start End Superfamily
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9717 156 224 3.50.50.60
af_I6Y4U4_173_293_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9607 150 254 3.50.50.60
1xdwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 165 193 3.40.50.720
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.95 149 249 3.50.50.60
1d7yA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9496 164 250 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7V9LG25-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9756 4 229 GO:0003955
GO:0050660
AF-A0A538BX90-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.958 1 216 GO:0003955
GO:0050660
AF-A0A1Q9TA65-F1-model_v4 deleted 0.9467 4 140
AF-A0A7W5V9A2-F1-model_v4 Dihydrolipoamide dehydrogenase (EC 1.8.1.4) 0.9446 4 314 GO:0003955
GO:0004148
GO:0050660
AF-A0A7C2PTZ4-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9427 4 191 GO:0003955
GO:0016020
GO:0050660

Map