F405026

General Info

Members Datasets Scaffolds Average Seq Length
319 171 316 201

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100038185|Ga0075431_1000381855
Length 214
Sequence VVAAADLARGDGVFVVGLTGGIGSGKSAAADAFAKLGATVVDTDALAHELTAAGGAALPAIEKAFGRAFIAPSGAMDRERMRQLVFGDPVAKKRLEAVLHPMIREASARRIAQAPGPYVVHVVPLLIESPDYRRRVDRVLVVDCPEALQVERVLARSALPEAQVRAIVAAQVSREKRLAAADDVIDNSGTLDALRGQVGRLHAAYLLRTGTRKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
3 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
4 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
111 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
112 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.57
Rhizosphere 97.49
Stem 0
Stem Tuber 0.63
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
2 Ga0065704_10070132 3300005289 Bacteria 1955461
3 Ga0070683_100270368 3300005329 Bacteria 1617
4 Ga0070690_100004080 3300005330 Bacteria 8082
5 Ga0070680_100057265 3300005336 Bacteria 3186
6 Ga0070689_100043894 3300005340 Bacteria 3439
7 Ga0070689_100321418 3300005340 Bacteria 1292
8 Ga0070692_10048192 3300005345 Bacteria 2207
9 Ga0070669_100134240 3300005353 Bacteria 1902
10 Ga0070675_100064174 3300005354 Bacteria 3036
11 Ga0070673_100089231 3300005364 Bacteria 2516
12 Ga0070688_100238051 3300005365 Bacteria 1290
13 Ga0070688_100293219 3300005365 Bacteria 1173
14 Ga0070710_10234672 3300005437 Bacteria 1173
15 Ga0070701_10102789 3300005438 Bacteria 1585
16 Ga0070705_100097754 3300005440 Bacteria 1846
17 Ga0070705_100119946 3300005440 Bacteria 1696
18 Ga0070705_100212803 3300005440 Bacteria 1333
19 Ga0070705_100717217 3300005440 Bacteria 787
20 Ga0070700_100064471 3300005441 Bacteria 2320
21 Ga0070700_100084946 3300005441 Bacteria 2052
22 Ga0070700_100357565 3300005441 Bacteria 1085
23 Ga0070700_100360572 3300005441 Bacteria 1081
24 Ga0070694_100010569 3300005444 Bacteria 5698
25 Ga0070694_100045270 3300005444 Bacteria 2949
26 Ga0070694_100055015 3300005444 Bacteria 2698
27 Ga0070694_100108727 3300005444 Bacteria 1973
28 Ga0070694_100157504 3300005444 Bacteria 1663
29 Ga0070694_100176676 3300005444 Bacteria 1577
30 Ga0070694_100197771 3300005444 Bacteria 1496
31 Ga0070694_100628142 3300005444 Bacteria 867
32 Ga0070694_100660757 3300005444 Bacteria 847
33 Ga0070678_100369321 3300005456 Bacteria 1238
34 Ga0068867_100042634 3300005459 Bacteria 3320
35 Ga0068867_101049272 3300005459 Bacteria 741
36 Ga0070706_100124848 3300005467 Bacteria 2400
37 Ga0070698_100021141 3300005471 Bacteria 6818
38 Ga0070698_100227888 3300005471 Bacteria 1797
39 Ga0070698_100431212 3300005471 Bacteria 1253
40 Ga0070699_100129447 3300005518 Bacteria 2224
41 Ga0070679_100036041 3300005530 Bacteria 4908
42 Ga0070697_100000561 3300005536 Bacteria 27986
43 Ga0070672_100858398 3300005543 Bacteria 800
44 Ga0070686_100161858 3300005544 Bacteria 1577
45 Ga0070695_100151189 3300005545 Bacteria 1620
46 Ga0070696_100114071 3300005546 Bacteria 1948
47 Ga0070696_100199632 3300005546 Bacteria 1492
48 Ga0070696_100237734 3300005546 Bacteria 1373
49 Ga0070704_100001456 3300005549 Bacteria 12693
50 Ga0070704_100044577 3300005549 Bacteria 3083
51 Ga0070704_100155729 3300005549 Bacteria 1802
52 Ga0070704_100438084 3300005549 Bacteria 1122
53 Ga0070704_100456159 3300005549 Bacteria 1102
54 Ga0068857_100896635 3300005577 Bacteria 850
55 Ga0070702_100123445 3300005615 Bacteria 1624
56 Ga0068864_100304998 3300005618 Bacteria 1492
57 Ga0068861_100024544 3300005719 Bacteria 4361
58 Ga0068863_100637383 3300005841 Bacteria 1056
59 Ga0068862_100011142 3300005844 Bacteria 7423
60 Ga0070715_10310259 3300006163 Bacteria 847
61 Ga0070716_100141454 3300006173 Bacteria 1535
62 Ga0075428_100112154 3300006844 Bacteria 2970
63 Ga0075428_100154909 3300006844 Bacteria 2489
64 Ga0075430_100495287 3300006846 Bacteria 1008
65 Ga0075431_100038185 3300006847 Bacteria 4945
66 Ga0075431_100302212 3300006847 Bacteria 1616
67 Ga0075431_100677055 3300006847 Bacteria 1010
68 Ga0075433_10025822 3300006852 Bacteria 4967
69 Ga0075434_100124945 3300006871 Bacteria 2590
70 Ga0075434_100934196 3300006871 Bacteria 882
71 Ga0075429_100000043 3300006880 Bacteria 57531
72 Ga0075429_100017859 3300006880 Bacteria 6133
73 Ga0075429_100290525 3300006880 Bacteria 1431
74 Ga0075429_100461949 3300006880 Bacteria 1112
75 Ga0068865_100008613 3300006881 Bacteria 6308
76 Ga0068865_100517656 3300006881 Bacteria 997
77 Ga0075436_100082170 3300006914 Bacteria 2235
78 Ga0075436_100199022 3300006914 Bacteria 1418
79 Ga0075435_100093441 3300007076 Bacteria 2485
80 Ga0099794_10020304 3300007265 Bacteria 3005
81 Ga0111539_10003759 3300009094 Bacteria 19981
82 Ga0111539_10204598 3300009094 Bacteria 2301
83 Ga0111539_10205245 3300009094 Bacteria 2297
84 Ga0111539_10296463 3300009094 Bacteria 1882
85 Ga0111539_11311991 3300009094 Bacteria 840
86 Ga0111539_11469217 3300009094 Bacteria 791
87 Ga0111539_11647689 3300009094 Bacteria 744
88 Ga0114129_10093950 3300009147 Bacteria 4154
89 Ga0114129_10156794 3300009147 Bacteria 3112
90 Ga0114129_10334728 3300009147 Bacteria 2009
91 Ga0114129_10397620 3300009147 Bacteria 1816
92 Ga0114129_10478608 3300009147 Bacteria 1629
93 Ga0105243_10006331 3300009148 Bacteria 9144
94 Ga0105243_10286606 3300009148 Bacteria 1486
95 Ga0105249_10011119 3300009553 Bacteria 7907
96 Ga0163162_10156337 3300013306 Bacteria 2400
97 Ga0157380_10124914 3300014326 Bacteria 2185
98 Ga0157377_10109615 3300014745 Bacteria 1657
99 Ga0213871_10034132 3300021441 Bacteria 1340
100 Ga0207645_10034782 3300025907 Bacteria 3237
101 Ga0207643_10013335 3300025908 Bacteria 4448
102 Ga0207684_10406661 3300025910 Bacteria 1170
103 Ga0207693_10051789 3300025915 Bacteria 3220
104 Ga0207660_10052759 3300025917 Bacteria 2896
105 Ga0207660_10071034 3300025917 Bacteria 2532
106 Ga0207652_10060811 3300025921 Bacteria 3260
107 Ga0207646_10055896 3300025922 Bacteria 3528
108 Ga0207659_10026658 3300025926 Bacteria 3902
109 Ga0207690_10268826 3300025932 Bacteria 1324
110 Ga0207709_10002253 3300025935 Bacteria 12260
111 Ga0207670_10012861 3300025936 Bacteria 4913
112 Ga0207670_10125202 3300025936 Bacteria 1874
113 Ga0207669_10238372 3300025937 Bacteria 1347
114 Ga0207669_10255516 3300025937 Bacteria 1307
115 Ga0207704_10009003 3300025938 Bacteria 4798
116 Ga0207691_10098702 3300025940 Bacteria 2608
117 Ga0207689_10060085 3300025942 Bacteria 3126
118 Ga0207712_10009623 3300025961 Bacteria 6121
119 Ga0207712_10476717 3300025961 Bacteria 1063
120 Ga0207708_10003647 3300026075 Bacteria 11354
121 Ga0207708_10181425 3300026075 Bacteria 1671
122 Ga0207708_11008575 3300026075 Bacteria 723
123 Ga0207676_10036210 3300026095 Bacteria 3753
124 Ga0207683_10143479 3300026121 Bacteria 2152
125 Ga0209967_1001925 3300027364 Bacteria 2675
126 Ga0209981_1003625 3300027378 Bacteria 2003
127 Ga0210000_1000788 3300027462 Bacteria 4379
128 Ga0209995_1000178 3300027471 Bacteria 10190
129 Ga0209999_1002506 3300027543 Bacteria 3244
130 Ga0209983_1004196 3300027665 Bacteria 3040
131 Ga0209983_1008175 3300027665 Bacteria 2139
132 Ga0209971_1009620 3300027682 Bacteria 2289
133 Ga0209966_1017875 3300027695 Bacteria 1354
134 Ga0207428_10017367 3300027907 Bacteria 6176
135 Ga0207428_10023312 3300027907 Bacteria 5206
136 Ga0207428_10130644 3300027907 Bacteria 1922
137 Ga0268265_10013533 3300028380 Bacteria 5545
138 Ga0268265_11046027 3300028380 Bacteria 808
139 Ga0265316_10132444 3300031344 Bacteria 1877
140 Ga0307408_100038893 3300031548 Bacteria 3358
141 Ga0307408_100119906 3300031548 Bacteria 2036
142 Ga0316575_10000446 3300031665 Bacteria 11788
143 Ga0316579_10000450 3300031691 Bacteria 13195
144 Ga0307405_10179088 3300031731 Bacteria 1520
145 Ga0307405_10332413 3300031731 Bacteria 1165
146 Ga0307409_100494828 3300031995 Bacteria 1189
147 Ga0307416_100081579 3300032002 Bacteria 2735
148 Ga0307416_100105546 3300032002 Bacteria 2466
149 Ga0307411_10226100 3300032005 Bacteria 1455
150 Ga0373938_0015739 3300034957 Bacteria 1470
151 Ga0373923_0097014 3300035111 Bacteria 1296
152 Ga0373956_0009098 3300035119 Bacteria 4028
153 Ga0373960_0010717 3300035121 Bacteria 2245
154 Ga0373962_0255703 3300035242 Bacteria 609
155 Ga0373924_0006340 3300035410 Bacteria 4235
156 Ga0373931_0090787 3300035691 Bacteria 1701
157 Ga0373933_0001046 3300035724 Bacteria 16779
158 Ga0373937_0016163 3300036401 Bacteria 6620
159 Ga0373937_0225795 3300036401 Bacteria 1763
160 Ga0373937_0278622 3300036401 Bacteria 1579
161 Ga0316582_0014092 3300036647 Bacteria 4527
162 Ga0316584_0205896 3300036712 Bacteria 1450
163 Ga0373925_0248979 3300037068 Bacteria 1425
164 Ga0436360_0314355 3300039438 Bacteria 1878
165 Ga0451807_0334405 3300041486 Bacteria 1066
166 Ga0451807_0848876 3300041486 Bacteria 1299
167 Ga0451853_3280505 3300041512 Bacteria 1589
168 Ga0439441_003307 3300042001 Bacteria 2366
169 Ga0439443_007395 3300042003 Bacteria 1527
170 Ga0450888_011339 3300042126 Bacteria 1044
171 Ga0439434_0000121 3300042435 Bacteria 20613
172 Ga0439435_0000031 3300042436 Bacteria 15689
173 Ga0439435_0000893 3300042436 Bacteria 5136
174 Ga0439435_0004097 3300042436 Bacteria 3107
175 Ga0439444_0002628 3300042437 Bacteria 2474
176 Ga0439460_0000173 3300042461 Bacteria 12207
177 Ga0439460_0018978 3300042461 Bacteria 1857
178 Ga0451577_0003116 3300042876 Bacteria 18704
179 Ga0451577_0026831 3300042876 Bacteria 5215
180 Ga0453684_0004300 3300044712 Bacteria 30354
181 Ga0453684_0010768 3300044712 Bacteria 15523
182 Ga0453684_0913448 3300044712 Bacteria 939
183 Ga0451576_0003530 3300045051 Bacteria 21338
184 Ga0451576_0003608 3300045051 Bacteria 21042
185 Ga0451576_0005507 3300045051 Bacteria 15815
186 Ga0451576_0010323 3300045051 Bacteria 10724
187 Ga0451576_0030048 3300045051 Bacteria 5810
188 Ga0451576_0060752 3300045051 Bacteria 3942
189 Ga0451576_0477105 3300045051 Bacteria 1310
190 Ga0451576_0887903 3300045051 Unclassified 935
191 Ga0495653_0299303 3300046463 Bacteria 1050
192 Ga0495652_0169602 3300046529 Bacteria 1686
193 Ga0495598_0109700 3300046537 Bacteria 923
194 Ga0495667_0503785 3300046559 Bacteria 758
195 Ga0495659_0113939 3300046664 Bacteria 1058
196 Ga0495669_0055278 3300046684 Bacteria 1787
197 Ga0495636_0094316 3300047318 Bacteria 1302
198 Ga0495680_0085969 3300047322 Bacteria 2367
199 Ga0495593_0030743 3300047673 Bacteria 2937
200 Ga0495602_0249894 3300048088 Bacteria 1322
201 Ga0496110_0001293 3300048913 Bacteria 17957
202 Ga0496111_0320047 3300048914 Bacteria 1149
203 Ga0501032_0016716 3300049569 Bacteria 5155
204 Ga0501033_0001878 3300049570 Bacteria 18274
205 Ga0501033_0087434 3300049570 Bacteria 2281
206 Ga0501034_1000049 3300049571 Bacteria 720
207 Ga0501036_0025591 3300049572 Bacteria 4980
208 Ga0501036_0032034 3300049572 Bacteria 4441
209 Ga0501036_0202170 3300049572 Bacteria 1671
210 Ga0501036_0565475 3300049572 Bacteria 944
211 Ga0501037_0139582 3300049573 Bacteria 1735
212 Ga0501037_0239513 3300049573 Bacteria 1272
213 Ga0501037_0541495 3300049573 Bacteria 786
214 Ga0501038_0000505 3300049574 Bacteria 34234
215 Ga0501038_0197922 3300049574 Bacteria 1614
216 Ga0501039_0002690 3300049575 Bacteria 13263
217 Ga0501039_0036528 3300049575 Bacteria 3792
218 Ga0501039_0039487 3300049575 Bacteria 3646
219 Ga0501039_0057386 3300049575 Bacteria 3015
220 Ga0501039_0097135 3300049575 Bacteria 2297
221 Ga0501040_0031345 3300049576 Bacteria 3592
222 Ga0501040_0045350 3300049576 Bacteria 2998
223 Ga0501040_0046986 3300049576 Bacteria 2947
224 Ga0501040_0110862 3300049576 Bacteria 1919
225 Ga0501040_0316114 3300049576 Bacteria 1117
226 Ga0501040_0462868 3300049576 Bacteria 913
227 Ga0501041_0000236 3300049577 Bacteria 25702
228 Ga0501041_0013502 3300049577 Bacteria 4843
229 Ga0501041_0041710 3300049577 Bacteria 2788
230 Ga0501041_0069147 3300049577 Bacteria 2165
231 Ga0501041_0106018 3300049577 Bacteria 1742
232 Ga0501041_0391074 3300049577 Bacteria 880
233 Ga0501042_0000107 3300049578 Bacteria 34352
234 Ga0501042_0066433 3300049578 Bacteria 2578
235 Ga0501043_0012436 3300049579 Bacteria 6657
236 Ga0501043_0074857 3300049579 Bacteria 2660
237 Ga0501046_0000548 3300049580 Bacteria 37400
238 Ga0501046_0036963 3300049580 Bacteria 3926
239 Ga0501046_0200440 3300049580 Bacteria 1485
240 Ga0501047_0150479 3300049581 Bacteria 2204
241 Ga0501048_0000076 3300049582 Bacteria 51144
242 Ga0501048_0067586 3300049582 Bacteria 2526
243 Ga0501048_0115982 3300049582 Bacteria 1892
244 Ga0501068_0022564 3300049584 Bacteria 3681
245 Ga0501070_0014131 3300049586 Bacteria 6720
246 Ga0501071_0000836 3300049587 Bacteria 16486
247 Ga0501071_0044781 3300049587 Bacteria 3175
248 Ga0501071_0069882 3300049587 Bacteria 2557
249 Ga0501071_0290857 3300049587 Bacteria 1237
250 Ga0501071_0298821 3300049587 Bacteria 1220
251 Ga0501072_0000201 3300049588 Bacteria 43540
252 Ga0501072_0001610 3300049588 Bacteria 16870
253 Ga0501072_0025495 3300049588 Bacteria 4606
254 Ga0501072_0116774 3300049588 Bacteria 2125
255 Ga0501073_0127767 3300049589 Bacteria 1762
256 Ga0501074_0021509 3300049590 Bacteria 4683
257 Ga0501074_0140897 3300049590 Bacteria 1725
258 Ga0501074_0280249 3300049590 Bacteria 1185
259 Ga0501075_0000544 3300049591 Bacteria 22874
260 Ga0501075_0014368 3300049591 Bacteria 5672
261 Ga0501075_0056513 3300049591 Bacteria 2954
262 Ga0501076_0000771 3300049592 Bacteria 20696
263 Ga0501076_0001109 3300049592 Bacteria 17761
264 Ga0501076_0023996 3300049592 Bacteria 4709
265 Ga0501076_0084993 3300049592 Bacteria 2542
266 Ga0501076_0085545 3300049592 Bacteria 2534
267 Ga0501077_0014916 3300049593 Bacteria 4886
268 Ga0501077_0049267 3300049593 Bacteria 2677
269 Ga0501079_0000441 3300049741 Bacteria 26973
270 Ga0501079_0017995 3300049741 Bacteria 5396
271 Ga0501079_0056856 3300049741 Bacteria 3019
272 Ga0501079_0138289 3300049741 Bacteria 1897
273 Ga0501080_0014631 3300049742 Bacteria 7227
274 Ga0501080_0031979 3300049742 Bacteria 4905
275 Ga0501080_0125969 3300049742 Bacteria 2372
276 Ga0501080_0145146 3300049742 Bacteria 2194
277 Ga0501081_0001178 3300049743 Bacteria 15807
278 Ga0501081_0008200 3300049743 Bacteria 6781
279 Ga0501081_0020582 3300049743 Bacteria 4398
280 Ga0501081_0200815 3300049743 Bacteria 1446
281 Ga0501035_0057280 3300049822 Bacteria 3475
282 Ga0501035_0063830 3300049822 Bacteria 3274
283 Ga0501044_0033293 3300049823 Bacteria 5417
284 Ga0501045_0000911 3300049824 Bacteria 19278
285 Ga0501045_0014667 3300049824 Bacteria 5556
286 Ga0501045_0034795 3300049824 Bacteria 3657
287 Ga0501045_0086212 3300049824 Bacteria 2318
288 Ga0501045_0151157 3300049824 Bacteria 1727
289 nmdc:mga05p37_1118117_c1 3300050507 Bacteria 823
290 nmdc:mga05p37_134773_c1 3300050507 Bacteria 3030
291 nmdc:mga05p37_207197_c1 3300050507 Bacteria 2371
292 nmdc:mga05p37_242325_c1 3300050507 Bacteria 2167
293 nmdc:mga09592_17826_c1 3300050508 Bacteria 5817
294 nmdc:mga09592_3676_c1 3300050508 Bacteria 12364
295 nmdc:mga09592_66179_c1 3300050508 Bacteria 3063
296 nmdc:mga06r32_20189_c1 3300050510 Bacteria 6130
297 nmdc:mga06r32_280370_c1 3300050510 Bacteria 1654
298 nmdc:mga06r32_655533_c1 3300050510 Bacteria 1018
299 nmdc:mga08y16_231880_c1 3300050511 Bacteria 1909
300 nmdc:mga08y16_250377_c1 3300050511 Bacteria 1831
301 nmdc:mga08y16_56792_c1 3300050511 Bacteria 4091
302 nmdc:mga0n895_698886_c1 3300050512 Bacteria 1010
303 nmdc:mga0rr50_110566_c1 3300050513 Bacteria 2174
304 nmdc:mga08x19_193332_c1 3300050514 Bacteria 1393
305 nmdc:mga08x19_28296_c1 3300050514 Bacteria 3509
306 Ga0495619_0285391 3300053085 Bacteria 1144
307 Ga0501084_0014223 3300054114 Bacteria 6589
308 Ga0501084_0016719 3300054114 Bacteria 6092
309 Ga0501084_0062751 3300054114 Bacteria 3111
310 Ga0501082_0006025 3300060353 Bacteria 10515
311 Ga0501082_0140221 3300060353 Bacteria 2098
312 Ga0501082_0436856 3300060353 Bacteria 1143
313 Ga0530510_0000543 3300061734 Bacteria 24227
314 Ga0530510_0000585 3300061734 Bacteria 23421
315 Ga0530510_0139383 3300061734 Bacteria 1786
316 Ga0530510_0246441 3300061734 Bacteria 1331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035242 Ga0373962_0255703 Ga0373962_0255703_79_594 169
2 3300005440 Ga0070705_100097754 Ga0070705_1000977543 174
3 3300005444 Ga0070694_100055015 Ga0070694_1000550154 174
4 3300045051 Ga0451576_0060752 Ga0451576_0060752_122_757 174
5 3300048088 Ga0495602_0249894 Ga0495602_0249894_522_1088 186
6 3300025937 Ga0207669_10238372 Ga0207669_102383722 190
7 3300037068 Ga0373925_0248979 Ga0373925_0248979_439_1050 190
8 3300005340 Ga0070689_100321418 Ga0070689_1003214182 194
9 3300005354 Ga0070675_100064174 Ga0070675_1000641742 194
10 3300005364 Ga0070673_100089231 Ga0070673_1000892313 194
11 3300005438 Ga0070701_10102789 Ga0070701_101027893 194
12 3300005440 Ga0070705_100119946 Ga0070705_1001199462 194
13 3300005444 Ga0070694_100197771 Ga0070694_1001977711 194
14 3300005456 Ga0070678_100369321 Ga0070678_1003693212 194
15 3300005459 Ga0068867_101049272 Ga0068867_1010492721 194
16 3300006844 Ga0075428_100112154 Ga0075428_1001121542 194
17 3300006846 Ga0075430_100495287 Ga0075430_1004952872 194
18 3300006847 Ga0075431_100302212 Ga0075431_1003022123 194
19 3300006880 Ga0075429_100290525 Ga0075429_1002905252 194
20 3300009094 Ga0111539_10205245 Ga0111539_102052451 194
21 3300009094 Ga0111539_11647689 Ga0111539_116476892 194
22 3300009147 Ga0114129_10397620 Ga0114129_103976202 194
23 3300014745 Ga0157377_10109615 Ga0157377_101096152 194
24 3300025907 Ga0207645_10034782 Ga0207645_100347822 194
25 3300025926 Ga0207659_10026658 Ga0207659_100266583 194
26 3300025940 Ga0207691_10098702 Ga0207691_100987023 194
27 3300025942 Ga0207689_10060085 Ga0207689_100600852 194
28 3300026121 Ga0207683_10143479 Ga0207683_101434792 194
29 3300027907 Ga0207428_10023312 Ga0207428_100233123 194
30 3300028380 Ga0268265_11046027 Ga0268265_110460271 194
31 3300036401 Ga0373937_0225795 Ga0373937_0225795_1055_1645 194
32 3300049572 Ga0501036_0025591 Ga0501036_0025591_176_766 194
33 3300049573 Ga0501037_0239513 Ga0501037_0239513_13_603 194
34 3300049575 Ga0501039_0036528 Ga0501039_0036528_999_1589 194
35 3300049576 Ga0501040_0045350 Ga0501040_0045350_82_672 194
36 3300049577 Ga0501041_0013502 Ga0501041_0013502_1615_2205 194
37 3300049579 Ga0501043_0074857 Ga0501043_0074857_1848_2438 194
38 3300049580 Ga0501046_0036963 Ga0501046_0036963_3061_3651 194
39 3300049582 Ga0501048_0115982 Ga0501048_0115982_246_836 194
40 3300049587 Ga0501071_0044781 Ga0501071_0044781_53_643 194
41 3300049588 Ga0501072_0001610 Ga0501072_0001610_3403_3993 194
42 3300049590 Ga0501074_0140897 Ga0501074_0140897_967_1557 194
43 3300049591 Ga0501075_0014368 Ga0501075_0014368_1362_1952 194
44 3300049592 Ga0501076_0001109 Ga0501076_0001109_4939_5529 194
45 3300049593 Ga0501077_0014916 Ga0501077_0014916_217_807 194
46 3300049741 Ga0501079_0017995 Ga0501079_0017995_3997_4587 194
47 3300049742 Ga0501080_0031979 Ga0501080_0031979_2853_3443 194
48 3300049743 Ga0501081_0008200 Ga0501081_0008200_4273_4863 194
49 3300049822 Ga0501035_0057280 Ga0501035_0057280_537_1127 194
50 3300049824 Ga0501045_0014667 Ga0501045_0014667_3741_4331 194
51 3300050508 nmdc:mga09592_66179_c1 nmdc:mga09592_66179_c1_1795_2385 194
52 3300050511 nmdc:mga08y16_250377_c1 nmdc:mga08y16_250377_c1_1197_1787 194
53 3300054114 Ga0501084_0016719 Ga0501084_0016719_1945_2535 194
54 3300060353 Ga0501082_0140221 Ga0501082_0140221_363_953 194
55 3300061734 Ga0530510_0000585 Ga0530510_0000585_1400_1990 194
56 iso_pu_bacteria 2537561728 2538427869 194
57 iso_pu_bacteria 2855195626 2855197808 194
58 iso_pu_bacteria 2900051742 2900053636 194
59 3300036401 Ga0373937_0278622 Ga0373937_0278622_67_660 195
60 3300049574 Ga0501038_0197922 Ga0501038_0197922_749_1342 195
61 3300049587 Ga0501071_0290857 Ga0501071_0290857_47_649 195
62 3300005329 Ga0070683_100270368 Ga0070683_1002703682 196
63 3300005330 Ga0070690_100004080 Ga0070690_1000040806 196
64 3300005336 Ga0070680_100057265 Ga0070680_1000572652 196
65 3300005340 Ga0070689_100043894 Ga0070689_1000438942 196
66 3300005345 Ga0070692_10048192 Ga0070692_100481922 196
67 3300005353 Ga0070669_100134240 Ga0070669_1001342403 196
68 3300005365 Ga0070688_100293219 Ga0070688_1002932192 196
69 3300005437 Ga0070710_10234672 Ga0070710_102346722 196
70 3300005441 Ga0070700_100084946 Ga0070700_1000849463 196
71 3300005441 Ga0070700_100357565 Ga0070700_1003575652 196
72 3300005441 Ga0070700_100360572 Ga0070700_1003605722 196
73 3300005444 Ga0070694_100010569 Ga0070694_1000105694 196
74 3300005444 Ga0070694_100176676 Ga0070694_1001766762 196
75 3300005444 Ga0070694_100660757 Ga0070694_1006607571 196
76 3300005459 Ga0068867_100042634 Ga0068867_1000426344 196
77 3300005471 Ga0070698_100431212 Ga0070698_1004312122 196
78 3300005543 Ga0070672_100858398 Ga0070672_1008583981 196
79 3300005544 Ga0070686_100161858 Ga0070686_1001618582 196
80 3300005545 Ga0070695_100151189 Ga0070695_1001511891 196
81 3300005546 Ga0070696_100114071 Ga0070696_1001140712 196
82 3300005546 Ga0070696_100199632 Ga0070696_1001996322 196
83 3300005546 Ga0070696_100237734 Ga0070696_1002377342 196
84 3300005549 Ga0070704_100044577 Ga0070704_1000445773 196
85 3300005615 Ga0070702_100123445 Ga0070702_1001234452 196
86 3300005618 Ga0068864_100304998 Ga0068864_1003049982 196
87 3300005719 Ga0068861_100024544 Ga0068861_1000245445 196
88 3300005844 Ga0068862_100011142 Ga0068862_1000111428 196
89 3300006847 Ga0075431_100677055 Ga0075431_1006770552 196
90 3300006871 Ga0075434_100934196 Ga0075434_1009341962 196
91 3300006880 Ga0075429_100461949 Ga0075429_1004619492 196
92 3300006881 Ga0068865_100008613 Ga0068865_1000086134 196
93 3300009094 Ga0111539_10003759 Ga0111539_1000375922 196
94 3300009094 Ga0111539_10204598 Ga0111539_102045983 196
95 3300009147 Ga0114129_10334728 Ga0114129_103347283 196
96 3300009148 Ga0105243_10006331 Ga0105243_100063317 196
97 3300009553 Ga0105249_10011119 Ga0105249_100111196 196
98 3300013306 Ga0163162_10156337 Ga0163162_101563372 196
99 3300014326 Ga0157380_10124914 Ga0157380_101249143 196
100 3300021441 Ga0213871_10034132 Ga0213871_100341322 196
101 3300025932 Ga0207690_10268826 Ga0207690_102688262 196
102 3300025935 Ga0207709_10002253 Ga0207709_100022536 196
103 3300025936 Ga0207670_10012861 Ga0207670_100128614 196
104 3300025936 Ga0207670_10125202 Ga0207670_101252022 196
105 3300025937 Ga0207669_10255516 Ga0207669_102555161 196
106 3300025938 Ga0207704_10009003 Ga0207704_100090034 196
107 3300025961 Ga0207712_10009623 Ga0207712_100096235 196
108 3300026075 Ga0207708_10003647 Ga0207708_100036478 196
109 3300026075 Ga0207708_10181425 Ga0207708_101814252 196
110 3300026075 Ga0207708_11008575 Ga0207708_110085751 196
111 3300026095 Ga0207676_10036210 Ga0207676_100362106 196
112 3300027695 Ga0209966_1017875 Ga0209966_10178752 196
113 3300027907 Ga0207428_10017367 Ga0207428_100173671 196
114 3300027907 Ga0207428_10130644 Ga0207428_101306442 196
115 3300028380 Ga0268265_10013533 Ga0268265_100135332 196
116 3300031548 Ga0307408_100119906 Ga0307408_1001199063 196
117 3300031731 Ga0307405_10332413 Ga0307405_103324132 196
118 3300031995 Ga0307409_100494828 Ga0307409_1004948282 196
119 3300032002 Ga0307416_100081579 Ga0307416_1000815792 196
120 3300034957 Ga0373938_0015739 Ga0373938_0015739_156_767 196
121 3300035111 Ga0373923_0097014 Ga0373923_0097014_669_1265 196
122 3300035119 Ga0373956_0009098 Ga0373956_0009098_2886_3482 196
123 3300035121 Ga0373960_0010717 Ga0373960_0010717_1069_1674 196
124 3300035410 Ga0373924_0006340 Ga0373924_0006340_2456_3052 196
125 3300035691 Ga0373931_0090787 Ga0373931_0090787_555_1166 196
126 3300035724 Ga0373933_0001046 Ga0373933_0001046_4924_5520 196
127 3300036401 Ga0373937_0016163 Ga0373937_0016163_956_1552 196
128 3300039438 Ga0436360_0314355 Ga0436360_0314355_914_1531 196
129 3300041486 Ga0451807_0334405 Ga0451807_0334405_388_1011 196
130 3300041486 Ga0451807_0848876 Ga0451807_0848876_660_1283 196
131 3300041512 Ga0451853_3280505 Ga0451853_3280505_442_1065 196
132 3300042876 Ga0451577_0003116 Ga0451577_0003116_1527_2159 196
133 3300042876 Ga0451577_0026831 Ga0451577_0026831_38_670 196
134 3300044712 Ga0453684_0010768 Ga0453684_0010768_11366_11998 196
135 3300044712 Ga0453684_0913448 Ga0453684_0913448_194_826 196
136 3300045051 Ga0451576_0003608 Ga0451576_0003608_13038_13664 196
137 3300045051 Ga0451576_0010323 Ga0451576_0010323_4581_5213 196
138 3300046463 Ga0495653_0299303 Ga0495653_0299303_193_789 196
139 3300046529 Ga0495652_0169602 Ga0495652_0169602_867_1463 196
140 3300046559 Ga0495667_0503785 Ga0495667_0503785_63_659 196
141 3300046684 Ga0495669_0055278 Ga0495669_0055278_375_971 196
142 3300047318 Ga0495636_0094316 Ga0495636_0094316_473_1081 196
143 3300047322 Ga0495680_0085969 Ga0495680_0085969_1102_1698 196
144 3300047673 Ga0495593_0030743 Ga0495593_0030743_1132_1737 196
145 3300050510 nmdc:mga06r32_655533_c1 nmdc:mga06r32_655533_c1_253_849 196
146 3300050511 nmdc:mga08y16_56792_c1 nmdc:mga08y16_56792_c1_443_1039 196
147 3300050512 nmdc:mga0n895_698886_c1 nmdc:mga0n895_698886_c1_272_874 196
148 3300053085 Ga0495619_0285391 Ga0495619_0285391_248_844 196
149 3300005365 Ga0070688_100238051 Ga0070688_1002380512 197
150 3300005440 Ga0070705_100212803 Ga0070705_1002128032 197
151 3300005440 Ga0070705_100717217 Ga0070705_1007172171 197
152 3300005441 Ga0070700_100064471 Ga0070700_1000644712 197
153 3300005444 Ga0070694_100045270 Ga0070694_1000452703 197
154 3300005444 Ga0070694_100108727 Ga0070694_1001087274 197
155 3300005444 Ga0070694_100157504 Ga0070694_1001575042 197
156 3300005444 Ga0070694_100628142 Ga0070694_1006281422 197
157 3300005467 Ga0070706_100124848 Ga0070706_1001248483 197
158 3300005471 Ga0070698_100021141 Ga0070698_1000211412 197
159 3300005471 Ga0070698_100227888 Ga0070698_1002278882 197
160 3300005518 Ga0070699_100129447 Ga0070699_1001294472 197
161 3300005530 Ga0070679_100036041 Ga0070679_1000360415 197
162 3300005536 Ga0070697_100000561 Ga0070697_10000056112 197
163 3300005549 Ga0070704_100001456 Ga0070704_1000014567 197
164 3300005549 Ga0070704_100155729 Ga0070704_1001557292 197
165 3300005549 Ga0070704_100438084 Ga0070704_1004380842 197
166 3300005549 Ga0070704_100456159 Ga0070704_1004561592 197
167 3300005577 Ga0068857_100896635 Ga0068857_1008966351 197
168 3300005841 Ga0068863_100637383 Ga0068863_1006373832 197
169 3300006163 Ga0070715_10310259 Ga0070715_103102592 197
170 3300006173 Ga0070716_100141454 Ga0070716_1001414542 197
171 3300006844 Ga0075428_100154909 Ga0075428_1001549092 197
172 3300006847 Ga0075431_100038185 Ga0075431_1000381855 197
173 3300006852 Ga0075433_10025822 Ga0075433_100258222 197
174 3300006871 Ga0075434_100124945 Ga0075434_1001249452 197
175 3300006880 Ga0075429_100000043 Ga0075429_10000004320 197
176 3300006880 Ga0075429_100017859 Ga0075429_1000178592 197
177 3300006881 Ga0068865_100517656 Ga0068865_1005176562 197
178 3300006914 Ga0075436_100082170 Ga0075436_1000821703 197
179 3300006914 Ga0075436_100199022 Ga0075436_1001990222 197
180 3300007076 Ga0075435_100093441 Ga0075435_1000934413 197
181 3300007265 Ga0099794_10020304 Ga0099794_100203043 197
182 3300009094 Ga0111539_10296463 Ga0111539_102964633 197
183 3300009094 Ga0111539_11311991 Ga0111539_113119912 197
184 3300009094 Ga0111539_11469217 Ga0111539_114692171 197
185 3300009147 Ga0114129_10093950 Ga0114129_100939503 197
186 3300009147 Ga0114129_10156794 Ga0114129_101567943 197
187 3300009147 Ga0114129_10478608 Ga0114129_104786082 197
188 3300009148 Ga0105243_10286606 Ga0105243_102866062 197
189 3300025908 Ga0207643_10013335 Ga0207643_100133353 197
190 3300025910 Ga0207684_10406661 Ga0207684_104066612 197
191 3300025915 Ga0207693_10051789 Ga0207693_100517893 197
192 3300025917 Ga0207660_10052759 Ga0207660_100527594 197
193 3300025917 Ga0207660_10071034 Ga0207660_100710342 197
194 3300025921 Ga0207652_10060811 Ga0207652_100608112 197
195 3300025922 Ga0207646_10055896 Ga0207646_100558962 197
196 3300025961 Ga0207712_10476717 Ga0207712_104767172 197
197 3300027364 Ga0209967_1001925 Ga0209967_10019253 197
198 3300027378 Ga0209981_1003625 Ga0209981_10036252 197
199 3300027462 Ga0210000_1000788 Ga0210000_10007883 197
200 3300027471 Ga0209995_1000178 Ga0209995_10001782 197
201 3300027543 Ga0209999_1002506 Ga0209999_10025063 197
202 3300027665 Ga0209983_1004196 Ga0209983_10041964 197
203 3300027665 Ga0209983_1008175 Ga0209983_10081752 197
204 3300027682 Ga0209971_1009620 Ga0209971_10096203 197
205 3300031548 Ga0307408_100038893 Ga0307408_1000388932 197
206 3300031665 Ga0316575_10000446 Ga0316575_100004462 197
207 3300031691 Ga0316579_10000450 Ga0316579_1000045011 197
208 3300031731 Ga0307405_10179088 Ga0307405_101790882 197
209 3300032002 Ga0307416_100105546 Ga0307416_1001055463 197
210 3300032005 Ga0307411_10226100 Ga0307411_102261002 197
211 3300036647 Ga0316582_0014092 Ga0316582_0014092_1448_2056 197
212 3300036712 Ga0316584_0205896 Ga0316584_0205896_178_786 197
213 3300042001 Ga0439441_003307 Ga0439441_003307_830_1432 197
214 3300042003 Ga0439443_007395 Ga0439443_007395_758_1360 197
215 3300042126 Ga0450888_011339 Ga0450888_011339_196_798 197
216 3300042435 Ga0439434_0000121 Ga0439434_0000121_12580_13203 197
217 3300042436 Ga0439435_0000031 Ga0439435_0000031_9614_10237 197
218 3300042436 Ga0439435_0000893 Ga0439435_0000893_4096_4698 197
219 3300042436 Ga0439435_0004097 Ga0439435_0004097_772_1374 197
220 3300042437 Ga0439444_0002628 Ga0439444_0002628_631_1233 197
221 3300042461 Ga0439460_0000173 Ga0439460_0000173_4921_5523 197
222 3300042461 Ga0439460_0018978 Ga0439460_0018978_206_808 197
223 3300045051 Ga0451576_0003530 Ga0451576_0003530_10_618 197
224 3300045051 Ga0451576_0005507 Ga0451576_0005507_15107_15727 197
225 3300045051 Ga0451576_0030048 Ga0451576_0030048_1583_2188 197
226 3300045051 Ga0451576_0477105 Ga0451576_0477105_673_1275 197
227 3300045051 Ga0451576_0887903 Ga0451576_0887903_65_691 197
228 3300046537 Ga0495598_0109700 Ga0495598_0109700_151_759 197
229 3300046664 Ga0495659_0113939 Ga0495659_0113939_224_832 197
230 3300048913 Ga0496110_0001293 Ga0496110_0001293_15212_15805 197
231 3300048914 Ga0496111_0320047 Ga0496111_0320047_397_990 197
232 3300049569 Ga0501032_0016716 Ga0501032_0016716_1611_2222 197
233 3300049570 Ga0501033_0001878 Ga0501033_0001878_13577_14188 197
234 3300049570 Ga0501033_0087434 Ga0501033_0087434_63_665 197
235 3300049571 Ga0501034_1000049 Ga0501034_1000049_81_692 197
236 3300049572 Ga0501036_0032034 Ga0501036_0032034_1830_2441 197
237 3300049572 Ga0501036_0202170 Ga0501036_0202170_15_617 197
238 3300049572 Ga0501036_0565475 Ga0501036_0565475_153_755 197
239 3300049573 Ga0501037_0139582 Ga0501037_0139582_180_788 197
240 3300049573 Ga0501037_0541495 Ga0501037_0541495_78_689 197
241 3300049574 Ga0501038_0000505 Ga0501038_0000505_6365_6976 197
242 3300049575 Ga0501039_0002690 Ga0501039_0002690_3720_4331 197
243 3300049575 Ga0501039_0039487 Ga0501039_0039487_447_1058 197
244 3300049575 Ga0501039_0057386 Ga0501039_0057386_1393_2001 197
245 3300049575 Ga0501039_0097135 Ga0501039_0097135_188_790 197
246 3300049576 Ga0501040_0031345 Ga0501040_0031345_1261_1872 197
247 3300049576 Ga0501040_0046986 Ga0501040_0046986_1368_1979 197
248 3300049576 Ga0501040_0110862 Ga0501040_0110862_1126_1734 197
249 3300049576 Ga0501040_0316114 Ga0501040_0316114_147_749 197
250 3300049576 Ga0501040_0462868 Ga0501040_0462868_255_857 197
251 3300049577 Ga0501041_0000236 Ga0501041_0000236_6568_7179 197
252 3300049577 Ga0501041_0041710 Ga0501041_0041710_598_1200 197
253 3300049577 Ga0501041_0069147 Ga0501041_0069147_524_1126 197
254 3300049577 Ga0501041_0106018 Ga0501041_0106018_190_801 197
255 3300049577 Ga0501041_0391074 Ga0501041_0391074_210_818 197
256 3300049578 Ga0501042_0000107 Ga0501042_0000107_27122_27733 197
257 3300049578 Ga0501042_0066433 Ga0501042_0066433_458_1060 197
258 3300049579 Ga0501043_0012436 Ga0501043_0012436_1180_1791 197
259 3300049580 Ga0501046_0000548 Ga0501046_0000548_25173_25784 197
260 3300049580 Ga0501046_0200440 Ga0501046_0200440_695_1297 197
261 3300049581 Ga0501047_0150479 Ga0501047_0150479_267_878 197
262 3300049582 Ga0501048_0000076 Ga0501048_0000076_12226_12837 197
263 3300049582 Ga0501048_0067586 Ga0501048_0067586_1451_2053 197
264 3300049584 Ga0501068_0022564 Ga0501068_0022564_513_1124 197
265 3300049586 Ga0501070_0014131 Ga0501070_0014131_5678_6289 197
266 3300049587 Ga0501071_0000836 Ga0501071_0000836_10601_11212 197
267 3300049587 Ga0501071_0069882 Ga0501071_0069882_1185_1793 197
268 3300049587 Ga0501071_0298821 Ga0501071_0298821_393_1004 197
269 3300049588 Ga0501072_0000201 Ga0501072_0000201_17514_18125 197
270 3300049588 Ga0501072_0025495 Ga0501072_0025495_1001_1612 197
271 3300049588 Ga0501072_0116774 Ga0501072_0116774_455_1063 197
272 3300049589 Ga0501073_0127767 Ga0501073_0127767_247_855 197
273 3300049590 Ga0501074_0021509 Ga0501074_0021509_1047_1658 197
274 3300049590 Ga0501074_0280249 Ga0501074_0280249_106_714 197
275 3300049591 Ga0501075_0000544 Ga0501075_0000544_21735_22346 197
276 3300049591 Ga0501075_0056513 Ga0501075_0056513_1321_1929 197
277 3300049592 Ga0501076_0000771 Ga0501076_0000771_12288_12899 197
278 3300049592 Ga0501076_0023996 Ga0501076_0023996_2078_2689 197
279 3300049592 Ga0501076_0084993 Ga0501076_0084993_1866_2474 197
280 3300049592 Ga0501076_0085545 Ga0501076_0085545_1764_2366 197
281 3300049593 Ga0501077_0049267 Ga0501077_0049267_513_1124 197
282 3300049741 Ga0501079_0000441 Ga0501079_0000441_6175_6786 197
283 3300049741 Ga0501079_0056856 Ga0501079_0056856_1663_2274 197
284 3300049741 Ga0501079_0138289 Ga0501079_0138289_236_844 197
285 3300049742 Ga0501080_0014631 Ga0501080_0014631_3657_4268 197
286 3300049742 Ga0501080_0125969 Ga0501080_0125969_1471_2079 197
287 3300049742 Ga0501080_0145146 Ga0501080_0145146_581_1183 197
288 3300049743 Ga0501081_0001178 Ga0501081_0001178_5038_5649 197
289 3300049743 Ga0501081_0020582 Ga0501081_0020582_274_885 197
290 3300049743 Ga0501081_0200815 Ga0501081_0200815_676_1284 197
291 3300049822 Ga0501035_0063830 Ga0501035_0063830_2113_2724 197
292 3300049823 Ga0501044_0033293 Ga0501044_0033293_1548_2159 197
293 3300049824 Ga0501045_0000911 Ga0501045_0000911_7587_8198 197
294 3300049824 Ga0501045_0034795 Ga0501045_0034795_649_1260 197
295 3300049824 Ga0501045_0086212 Ga0501045_0086212_339_941 197
296 3300049824 Ga0501045_0151157 Ga0501045_0151157_317_919 197
297 3300050507 nmdc:mga05p37_1118117_c1 nmdc:mga05p37_1118117_c1_100_714 197
298 3300050507 nmdc:mga05p37_134773_c1 nmdc:mga05p37_134773_c1_246_872 197
299 3300050507 nmdc:mga05p37_207197_c1 nmdc:mga05p37_207197_c1_1052_1654 197
300 3300050507 nmdc:mga05p37_242325_c1 nmdc:mga05p37_242325_c1_817_1461 197
301 3300050508 nmdc:mga09592_17826_c1 nmdc:mga09592_17826_c1_171_815 197
302 3300050508 nmdc:mga09592_3676_c1 nmdc:mga09592_3676_c1_8875_9501 197
303 3300050510 nmdc:mga06r32_20189_c1 nmdc:mga06r32_20189_c1_5337_5963 197
304 3300050510 nmdc:mga06r32_280370_c1 nmdc:mga06r32_280370_c1_802_1446 197
305 3300050511 nmdc:mga08y16_231880_c1 nmdc:mga08y16_231880_c1_261_887 197
306 3300050513 nmdc:mga0rr50_110566_c1 nmdc:mga0rr50_110566_c1_1108_1719 197
307 3300050514 nmdc:mga08x19_193332_c1 nmdc:mga08x19_193332_c1_137_748 197
308 3300050514 nmdc:mga08x19_28296_c1 nmdc:mga08x19_28296_c1_1208_1819 197
309 3300054114 Ga0501084_0014223 Ga0501084_0014223_2429_3040 197
310 3300054114 Ga0501084_0062751 Ga0501084_0062751_2212_2823 197
311 3300060353 Ga0501082_0006025 Ga0501082_0006025_4711_5322 197
312 3300060353 Ga0501082_0436856 Ga0501082_0436856_429_1031 197
313 3300061734 Ga0530510_0000543 Ga0530510_0000543_15434_16045 197
314 3300061734 Ga0530510_0139383 Ga0530510_0139383_405_1016 197
315 3300061734 Ga0530510_0246441 Ga0530510_0246441_149_760 197
316 3300044712 Ga0453684_0004300 Ga0453684_0004300_16698_17333 198
317 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00007730 200
318 3300005289 Ga0065704_10070132 Ga0065704_100701321510 200
319 3300031344 Ga0265316_10132444 Ga0265316_101324442 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

14

193

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.9193 2 195
1n3b-assembly1.cif.gz_A crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.8764 2 195
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.8762 2 195
8u97-assembly1.cif.gz_A crystal structure of dephospho-coa kinase from klebsiella aerogenes (amp-pnp bound) 0.8732 1 195
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.8707 2 200
ID Description Score Start End Superfamily
af_P34558_5_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9452 3 195 3.40.50.300
af_Q4D748_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9338 113 195 3.40.50.300
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9232 1 200 3.40.50.300
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9189 1 200 3.40.50.300
af_Q2FXP1_1_198_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9131 2 194 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6G0V4H6-F1-model_v4 Dephospho-CoA kinase 0.9647 1 195 GO:0004140
GO:0005524
GO:0015937
AF-A0A317JLJ9-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9583 2 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1W9HIR5-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9577 1 196 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A0N5ADP6-F1-model_v4 Dephospho-CoA kinase domain-containing protein 0.9563 1 199 GO:0004140
GO:0005524
GO:0015937
GO:0016020
AF-A0A0N4W3Q1-F1-model_v4 Dephospho-CoA kinase 0.9541 1 188 GO:0004140
GO:0005524
GO:0015937

Feature Viewer

pLDDT pTM Quality
94.01 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map