F405022

General Info

Members Datasets Scaffolds Average Seq Length
319 198 315 511

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100077538|Ga0075428_1000775383
Length 583
Sequence MRRSFFPLVVGICVITGLIIADVSQHISPGTSLTAQERRPSQEQIKRAAGYEPGSVDGVWGPQTEAAVRDFQKQRGLSVSGALDDGTRHALGLITAQNQPTSRPGVMPDAVQEAQTPRTVLEERPEQRKSAHDRSNIFQASQGLPAXXXXPNQPEQGKILGFDFYRDPLNAKRPMQPFEEIMHADAQAKPQVMTAQRQLLESRYELTPRLDPEAKMARGKPLPVGPTARLAAGTDWNTLASMAPDAIRQRNLFPYPALPHPKQVAGGQVFPAMQIAMFPRLERFDVDFDLPDAFLPEFPPAIFLQNRPELGDVSRGEVVSINNFYALFKDLLTPVQLDGLRLLLTPLPQEEFNPTDDRKSPTPSLGIACLDCHVNGHTTAQFHLNPDDRPQERRMRLDTVSLRGLFNQQIHGSKRSLRSVEDFTEFEQRTAYFNGDPIHAMKKGMMILDRVQVSHMAQMQNMFDVPPATKLTPQGRLDPARATESERRGEQVFFGKGQCATCHTPPFYLDHQMHDLRVERFVNEAPLGPIKTFTLRGIKESPPYLHDGRCLTLEDTVEFFNLVLELKLTPEEKRDLVAFMRVL

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.61
Metatranscriptomes 3.13
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 1.88
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017637 3300003203 Bacteria 2947
2 JGI25406J46586_10026262 3300003203 Bacteria 2247
3 JGI26129J50193_1001425 3300003349 Bacteria 1622
4 Ga0058862_12829385 3300004803 Bacteria 2215
5 Ga0070676_10001273 3300005328 Bacteria 12665
6 Ga0070670_100009839 3300005331 Bacteria 8169
7 Ga0070670_100047928 3300005331 Bacteria 3678
8 Ga0068869_100017210 3300005334 Bacteria 4894
9 Ga0070680_100028522 3300005336 Bacteria 4478
10 Ga0070682_100001964 3300005337 Bacteria 11468
11 Ga0070660_100001376 3300005339 Bacteria 16510
12 Ga0070660_100036842 3300005339 Bacteria 3707
13 Ga0070689_100085284 3300005340 Bacteria 2483
14 Ga0070692_10001557 3300005345 Bacteria 8419
15 Ga0070669_100071961 3300005353 Bacteria 2559
16 Ga0070675_100001385 3300005354 Bacteria 17771
17 Ga0070675_100017214 3300005354 Bacteria 5742
18 Ga0070675_100096807 3300005354 Bacteria 2480
19 Ga0070671_100008471 3300005355 Bacteria 8241
20 Ga0070673_100029669 3300005364 Unclassified 4081
21 Ga0070659_100002197 3300005366 Bacteria 13885
22 Ga0070667_100022937 3300005367 Bacteria 5174
23 Ga0070703_10002306 3300005406 Bacteria 5523
24 Ga0070714_100098508 3300005435 Bacteria 2572
25 Ga0070713_100200018 3300005436 Bacteria 1804
26 Ga0070701_10054785 3300005438 Bacteria 2081
27 Ga0070663_100000406 3300005455 Bacteria 22595
28 Ga0070678_100155804 3300005456 Bacteria 1845
29 Ga0070681_10004719 3300005458 Bacteria 13046
30 Ga0070706_100034431 3300005467 Bacteria 4679
31 Ga0070706_100064422 3300005467 Bacteria 3388
32 Ga0070707_100030018 3300005468 Bacteria 5173
33 Ga0070697_100002248 3300005536 Bacteria 14812
34 Ga0068853_100000062 3300005539 Bacteria 77196
35 Ga0068853_100007983 3300005539 Bacteria 8488
36 Ga0068853_100102991 3300005539 Bacteria 2526
37 Ga0070672_100102043 3300005543 Bacteria 2328
38 Ga0070695_100005982 3300005545 Bacteria 7186
39 Ga0070693_100001093 3300005547 Bacteria 12168
40 Ga0070704_100004628 3300005549 Bacteria 7962
41 Ga0068855_100000294 3300005563 Bacteria 61922
42 Ga0068855_100062410 3300005563 Bacteria 4350
43 Ga0070664_100066825 3300005564 Bacteria 3071
44 Ga0070664_100165339 3300005564 Bacteria 1960
45 Ga0068857_100040911 3300005577 Bacteria 4109
46 Ga0068854_100015131 3300005578 Bacteria 5102
47 Ga0068856_100006423 3300005614 Bacteria 11534
48 Ga0068856_100019239 3300005614 Bacteria 6628
49 Ga0068852_100121644 3300005616 Bacteria 2391
50 Ga0068859_100010377 3300005617 Bacteria 9371
51 Ga0068859_100046774 3300005617 Bacteria 4345
52 Ga0068863_100000892 3300005841 Bacteria 30096
53 Ga0068860_100000930 3300005843 Bacteria 32372
54 Ga0068862_100026895 3300005844 Bacteria 4838
55 Ga0081455_10018410 3300005937 Bacteria 6656
56 Ga0081538_10008237 3300005981 Bacteria 8883
57 Ga0081538_10036357 3300005981 Unclassified 3215
58 Ga0081539_10000083 3300005985 Bacteria 218881
59 Ga0081539_10009382 3300005985 Bacteria 8190
60 Ga0081539_10018712 3300005985 Bacteria 4787
61 Ga0081539_10043111 3300005985 Bacteria 2619
62 Ga0070717_10052586 3300006028 Unclassified 3356
63 Ga0070716_100071959 3300006173 Bacteria 2034
64 Ga0097621_100021659 3300006237 Bacteria 4978
65 Ga0075428_100000801 3300006844 Bacteria 32802
66 Ga0075428_100002581 3300006844 Bacteria 19672
67 Ga0075428_100041688 3300006844 Bacteria 5046
68 Ga0075428_100077538 3300006844 Bacteria 3627
69 Ga0075430_100001122 3300006846 Bacteria 21335
70 Ga0075430_100038678 3300006846 Bacteria 4040
71 Ga0075431_100011686 3300006847 Bacteria 8859
72 Ga0075431_100026767 3300006847 Bacteria 5915
73 Ga0075431_100045887 3300006847 Bacteria 4504
74 Ga0075433_10143571 3300006852 Bacteria 2122
75 Ga0075434_100041384 3300006871 Bacteria 4566
76 Ga0075429_100001140 3300006880 Bacteria 21430
77 Ga0075429_100045570 3300006880 Bacteria 3815
78 Ga0075429_100100618 3300006880 Bacteria 2523
79 Ga0075429_100139503 3300006880 Bacteria 2122
80 Ga0097620_100010377 3300006931 Bacteria 9371
81 Ga0097620_100046774 3300006931 Bacteria 4345
82 Ga0075435_100106163 3300007076 Bacteria 2332
83 Ga0099794_10002147 3300007265 Bacteria 7174
84 Ga0099794_10012554 3300007265 Bacteria 3660
85 Ga0105240_10004053 3300009093 Bacteria 22537
86 Ga0111539_10000901 3300009094 Bacteria 38812
87 Ga0111539_10020636 3300009094 Bacteria 8115
88 Ga0111539_10223811 3300009094 Bacteria 2191
89 Ga0114129_10000414 3300009147 Bacteria 50458
90 Ga0114129_10015155 3300009147 Bacteria 10973
91 Ga0114129_10103907 3300009147 Bacteria 3927
92 Ga0114129_10188090 3300009147 Bacteria 2805
93 Ga0105248_10024202 3300009177 Bacteria 6750
94 Ga0105248_10075779 3300009177 Bacteria 3781
95 Ga0105248_10085539 3300009177 Unclassified 3548
96 Ga0105237_10025885 3300009545 Bacteria 5997
97 Ga0105237_10045954 3300009545 Bacteria 4393
98 Ga0105239_10026994 3300010375 Bacteria 6321
99 Ga0105246_10019379 3300011119 Bacteria 4346
100 Ga0157373_10059726 3300013100 Bacteria 2702
101 Ga0157371_10052169 3300013102 Bacteria 2905
102 Ga0157370_10012606 3300013104 Bacteria 8760
103 Ga0157370_10021825 3300013104 Bacteria 6377
104 Ga0157370_10097253 3300013104 Bacteria 2761
105 Ga0157370_10215171 3300013104 Bacteria 1780
106 Ga0157369_10031105 3300013105 Bacteria 5881
107 Ga0157374_10028939 3300013296 Bacteria 5009
108 Ga0163162_10005755 3300013306 Bacteria 11990
109 Ga0163162_10020605 3300013306 Bacteria 6479
110 Ga0157372_10030475 3300013307 Bacteria 5902
111 Ga0157372_10044194 3300013307 Bacteria 4936
112 Ga0157372_10063265 3300013307 Bacteria 4148
113 Ga0157372_10082732 3300013307 Bacteria 3635
114 Ga0157372_10161910 3300013307 Bacteria 2586
115 Ga0157372_10279189 3300013307 Bacteria 1942
116 Ga0157375_10009126 3300013308 Bacteria 8689
117 Ga0157375_10111867 3300013308 Bacteria 2830
118 Ga0163163_10008946 3300014325 Bacteria 8921
119 Ga0157379_10003537 3300014968 Bacteria 13231
120 Ga0157379_10008802 3300014968 Bacteria 8804
121 Ga0197907_11114090 3300020069 Bacteria 1760
122 Ga0206356_11859015 3300020070 Bacteria 2967
123 Ga0206352_10095980 3300020078 Bacteria 2157
124 Ga0206350_10263449 3300020080 Bacteria 2699
125 Ga0206350_11013479 3300020080 Bacteria 2124
126 Ga0213876_10011490 3300021384 Bacteria 4727
127 Ga0213876_10077713 3300021384 Unclassified 1753
128 Ga0213875_10008913 3300021388 Bacteria 5113
129 Ga0224712_10009151 3300022467 Bacteria 2970
130 Ga0224712_10032823 3300022467 Bacteria 1895
131 Ga0224712_10038647 3300022467 Bacteria 1784
132 Ga0207653_10001805 3300025885 Bacteria 6839
133 Ga0207688_10030976 3300025901 Bacteria 2951
134 Ga0207645_10000582 3300025907 Bacteria 30310
135 Ga0207643_10003639 3300025908 Bacteria 8305
136 Ga0207684_10085641 3300025910 Bacteria 2684
137 Ga0207695_10000436 3300025913 Bacteria 91698
138 Ga0207671_10035174 3300025914 Bacteria 3719
139 Ga0207671_10040355 3300025914 Bacteria 3455
140 Ga0207693_10073211 3300025915 Bacteria 2682
141 Ga0207660_10000220 3300025917 Bacteria 36783
142 Ga0207657_10000730 3300025919 Bacteria 34885
143 Ga0207649_10049325 3300025920 Bacteria 2599
144 Ga0207652_10059041 3300025921 Bacteria 3306
145 Ga0207646_10016373 3300025922 Bacteria 6958
146 Ga0207646_10130279 3300025922 Bacteria 2263
147 Ga0207681_10028885 3300025923 Bacteria 3596
148 Ga0207659_10002561 3300025926 Bacteria 10815
149 Ga0207659_10074807 3300025926 Bacteria 2483
150 Ga0207659_10121733 3300025926 Bacteria 2000
151 Ga0207700_10150004 3300025928 Bacteria 1925
152 Ga0207644_10008574 3300025931 Bacteria 6690
153 Ga0207644_10017338 3300025931 Bacteria 4862
154 Ga0207644_10165464 3300025931 Bacteria 1723
155 Ga0207706_10005515 3300025933 Bacteria 11796
156 Ga0207669_10004980 3300025937 Bacteria 5909
157 Ga0207691_10051213 3300025940 Bacteria 3776
158 Ga0207711_10064774 3300025941 Unclassified 3157
159 Ga0207711_10103080 3300025941 Bacteria 2526
160 Ga0207689_10000846 3300025942 Bacteria 29434
161 Ga0207661_10235233 3300025944 Bacteria 1624
162 Ga0207679_10036638 3300025945 Bacteria 3480
163 Ga0207667_10000787 3300025949 Bacteria 41210
164 Ga0207667_10086584 3300025949 Bacteria 3242
165 Ga0207639_10000053 3300026041 Bacteria 113162
166 Ga0207639_10014920 3300026041 Bacteria 5473
167 Ga0207702_10006797 3300026078 Bacteria 9810
168 Ga0207702_10008530 3300026078 Bacteria 8638
169 Ga0207641_10081046 3300026088 Unclassified 2817
170 Ga0207676_10010320 3300026095 Bacteria 6651
171 Ga0207674_10052804 3300026116 Bacteria 4144
172 Ga0207674_10090936 3300026116 Bacteria 3043
173 Ga0209995_1000192 3300027471 Bacteria 9697
174 Ga0209970_1001750 3300027614 Bacteria 3765
175 Ga0209588_1000155 3300027671 Bacteria 19577
176 Ga0209588_1006813 3300027671 Bacteria 3341
177 Ga0209971_1000008 3300027682 Bacteria 102612
178 Ga0209966_1000290 3300027695 Bacteria 17006
179 Ga0209998_10000016 3300027717 Bacteria 85166
180 Ga0209974_10000073 3300027876 Bacteria 26904
181 Ga0207428_10094119 3300027907 Bacteria 2323
182 Ga0268265_10024994 3300028380 Bacteria 4233
183 Ga0268264_10085901 3300028381 Unclassified 2701
184 Ga0265327_10005122 3300031251 Bacteria 11130
185 Ga0265327_10015607 3300031251 Bacteria 4889
186 Ga0307408_100011415 3300031548 Bacteria 5870
187 Ga0307516_10000779 3300031730 Bacteria 43455
188 Ga0307413_10011204 3300031824 Bacteria 4395
189 Ga0307410_10042107 3300031852 Bacteria 3016
190 Ga0307409_100007643 3300031995 Bacteria 6485
191 Ga0307416_100008071 3300032002 Bacteria 6750
192 Ga0307416_100015547 3300032002 Bacteria 5260
193 Ga0307416_100018089 3300032002 Bacteria 4954
194 Ga0307411_10035141 3300032005 Bacteria 3126
195 Ga0307415_100006644 3300032126 Bacteria 6259
196 Ga0373923_0013673 3300035111 Bacteria 3030
197 Ga0373941_0007363 3300035115 Bacteria 2691
198 Ga0373954_0004461 3300035118 Bacteria 6022
199 Ga0373937_0009399 3300036401 Bacteria 8497
200 Ga0373937_0101419 3300036401 Bacteria 2671
201 Ga0395905_0026019 3300037471 Bacteria 5518
202 Ga0436364_0996625 3300037853 Bacteria 4383
203 Ga0436365_0011257 3300039437 Unclassified 2733
204 Ga0436365_0477873 3300039437 Bacteria 1657
205 Ga0436365_1610796 3300039437 Bacteria 10394
206 Ga0436360_1001598 3300039438 Bacteria 2405
207 Ga0436363_1179741 3300039450 Bacteria 13484
208 Ga0436363_1532402 3300039450 Bacteria 2372
209 Ga0436362_0702035 3300039453 Bacteria 2318
210 Ga0439448_0000257 3300042005 Bacteria 11486
211 Ga0439459_0000760 3300042438 Bacteria 4436
212 Ga0466969_0002629 3300044656 Bacteria 9607
213 Ga0453683_0001015 3300044673 Bacteria 26339
214 Ga0466966_0022631 3300044684 Bacteria 4123
215 Ga0453684_0068052 3300044712 Bacteria 4524
216 Ga0466959_0032728 3300045049 Bacteria 3849
217 Ga0451576_0000214 3300045051 Bacteria 144183
218 Ga0451576_0003358 3300045051 Bacteria 22167
219 Ga0451576_0040348 3300045051 Bacteria 4942
220 Ga0451576_0116724 3300045051 Bacteria 2778
221 Ga0495592_0131780 3300046454 Bacteria 1748
222 Ga0495620_0001937 3300046515 Bacteria 12117
223 Ga0495652_0078195 3300046529 Bacteria 2739
224 Ga0495602_0190715 3300048088 Bacteria 1572
225 Ga0496108_0021799 3300048911 Bacteria 5266
226 Ga0496109_0031978 3300048912 Bacteria 4727
227 Ga0496110_0066678 3300048913 Bacteria 3184
228 Ga0496112_0183821 3300048915 Bacteria 2054
229 Ga0496114_0014358 3300048917 Bacteria 6354
230 Ga0496114_0018635 3300048917 Bacteria 5615
231 Ga0501031_0002260 3300049568 Bacteria 12200
232 Ga0501032_0000694 3300049569 Bacteria 27376
233 Ga0501032_0011706 3300049569 Bacteria 6289
234 Ga0501032_0045937 3300049569 Bacteria 2952
235 Ga0501032_0119579 3300049569 Bacteria 1742
236 Ga0501033_0000119 3300049570 Bacteria 75685
237 Ga0501033_0003250 3300049570 Bacteria 13453
238 Ga0501033_0004254 3300049570 Bacteria 11511
239 Ga0501034_0003641 3300049571 Bacteria 17452
240 Ga0501034_0015219 3300049571 Bacteria 7906
241 Ga0501036_0001985 3300049572 Bacteria 15876
242 Ga0501036_0003565 3300049572 Bacteria 12439
243 Ga0501036_0018925 3300049572 Bacteria 5777
244 Ga0501036_0085883 3300049572 Bacteria 2660
245 Ga0501037_0005015 3300049573 Bacteria 9629
246 Ga0501037_0063624 3300049573 Bacteria 2689
247 Ga0501037_0106073 3300049573 Bacteria 2025
248 Ga0501038_0001457 3300049574 Bacteria 21748
249 Ga0501038_0002378 3300049574 Bacteria 17524
250 Ga0501038_0008508 3300049574 Bacteria 9430
251 Ga0501038_0029720 3300049574 Bacteria 4840
252 Ga0501039_0004783 3300049575 Bacteria 10254
253 Ga0501039_0174040 3300049575 Bacteria 1693
254 Ga0501040_0003339 3300049576 Bacteria 10368
255 Ga0501041_0099274 3300049577 Bacteria 1801
256 Ga0501042_0064204 3300049578 Bacteria 2624
257 Ga0501043_0003217 3300049579 Bacteria 13483
258 Ga0501043_0015607 3300049579 Bacteria 5953
259 Ga0501043_0058381 3300049579 Bacteria 3029
260 Ga0501046_0014688 3300049580 Bacteria 6595
261 Ga0501046_0021304 3300049580 Bacteria 5349
262 Ga0501046_0143495 3300049580 Bacteria 1805
263 Ga0501047_0002159 3300049581 Bacteria 18814
264 Ga0501048_0012624 3300049582 Bacteria 6283
265 Ga0501068_0000701 3300049584 Bacteria 17174
266 Ga0501070_0023227 3300049586 Bacteria 5195
267 Ga0501072_0104764 3300049588 Bacteria 2249
268 Ga0501079_0070357 3300049741 Bacteria 2702
269 Ga0501080_0040506 3300049742 Bacteria 4345
270 Ga0501035_0000790 3300049822 Bacteria 33779
271 Ga0501035_0014881 3300049822 Bacteria 7180
272 Ga0501035_0015556 3300049822 Bacteria 7018
273 Ga0501044_0000093 3300049823 Bacteria 109832
274 Ga0501044_0002294 3300049823 Bacteria 21790
275 Ga0501044_0008737 3300049823 Bacteria 11087
276 Ga0501044_0044995 3300049823 Bacteria 4577
277 Ga0501044_0051346 3300049823 Bacteria 4252
278 Ga0501044_0072061 3300049823 Bacteria 3513
279 Ga0501045_0003397 3300049824 Bacteria 10904
280 Ga0501045_0057765 3300049824 Bacteria 2840
281 nmdc:mga05p37_151378_c1 3300050507 Bacteria 2837
282 nmdc:mga05p37_212051_c1 3300050507 Bacteria 2341
283 nmdc:mga05p37_2239_c1 3300050507 Bacteria 19930
284 nmdc:mga05p37_38583_c1 3300050507 Bacteria 5860
285 nmdc:mga05p37_6679_c1 3300050507 Bacteria 13602
286 nmdc:mga05p37_83788_c1 3300050507 Bacteria 3928
287 nmdc:mga09592_120139_c1 3300050508 Bacteria 2257
288 nmdc:mga09592_168716_c1 3300050508 Bacteria 1892
289 nmdc:mga09592_1954_c1 3300050508 Bacteria 16600
290 nmdc:mga09592_21688_c1 3300050508 Bacteria 5296
291 nmdc:mga09592_44802_c1 3300050508 Bacteria 3725
292 nmdc:mga0qj67_157150_c1 3300050509 Bacteria 1846
293 nmdc:mga0qj67_170821_c1 3300050509 Bacteria 1765
294 nmdc:mga0qj67_41198_c1 3300050509 Bacteria 3632
295 nmdc:mga06r32_30007_c1 3300050510 Bacteria 5100
296 nmdc:mga06r32_49309_c1 3300050510 Bacteria 4026
297 nmdc:mga06r32_56023_c1 3300050510 Bacteria 3783
298 nmdc:mga08y16_14448_c1 3300050511 Bacteria 8305
299 nmdc:mga08y16_41466_c1 3300050511 Bacteria 4822
300 nmdc:mga0n895_150459_c1 3300050512 Bacteria 2358
301 nmdc:mga0n895_153902_c1 3300050512 Bacteria 2330
302 nmdc:mga0n895_43960_c1 3300050512 Bacteria 4356
303 nmdc:mga0a205_43086_c1 3300050515 Bacteria 4351
304 nmdc:mga0a205_57675_c1 3300050515 Bacteria 3749
305 Ga0495619_0028614 3300053085 Bacteria 3596
306 Ga0500555_001470 3300053103 Bacteria 7183
307 Ga0500568_0000807 3300053139 Bacteria 22061
308 Ga0500616_0002987 3300053153 Bacteria 13383
309 Ga0501084_0194695 3300054114 Bacteria 1710
310 Ga0587073_0003888 3300059492 Bacteria 2095
311 Ga0501082_0117197 3300060353 Bacteria 2307
312 Ga0530510_0000127 3300061734 Bacteria 44086
313 Ga0530510_0007244 3300061734 Bacteria 7716
314 Ga0530510_0025265 3300061734 Bacteria 4246
315 Ga0530510_0057836 3300061734 Bacteria 2803

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_21688_c1 nmdc:mga09592_21688_c1_3528_5033 393
2 3300046454 Ga0495592_0131780 Ga0495592_0131780_384_1679 399
3 3300049580 Ga0501046_0143495 Ga0501046_0143495_81_1460 446
4 3300049741 Ga0501079_0070357 Ga0501079_0070357_30_1532 446
5 3300005841 Ga0068863_100000892 Ga0068863_1000008922 449
6 3300005843 Ga0068860_100000930 Ga0068860_1000009305 449
7 3300048088 Ga0495602_0190715 Ga0495602_0190715_77_1477 449
8 3300049824 Ga0501045_0057765 Ga0501045_0057765_51_1439 449
9 3300050507 nmdc:mga05p37_212051_c1 nmdc:mga05p37_212051_c1_710_2260 452
10 3300031251 Ga0265327_10005122 Ga0265327_100051225 453
11 3300061734 Ga0530510_0007244 Ga0530510_0007244_5688_7106 455
12 iso_pu_bacteria 2684623219 2687234703 455
13 iso_pu_bacteria 2684623219 2687237532 455
14 3300025931 Ga0207644_10017338 Ga0207644_100173383 457
15 3300005614 Ga0068856_100006423 Ga0068856_1000064237 460
16 3300013100 Ga0157373_10059726 Ga0157373_100597262 460
17 3300013105 Ga0157369_10031105 Ga0157369_100311056 460
18 3300013296 Ga0157374_10028939 Ga0157374_100289396 460
19 3300013307 Ga0157372_10044194 Ga0157372_100441946 460
20 3300026078 Ga0207702_10008530 Ga0207702_100085306 460
21 3300006028 Ga0070717_10052586 Ga0070717_100525862 461
22 3300050509 nmdc:mga0qj67_170821_c1 nmdc:mga0qj67_170821_c1_189_1739 464
23 3300049575 Ga0501039_0174040 Ga0501039_0174040_21_1523 465
24 3300013308 Ga0157375_10111867 Ga0157375_101118672 466
25 3300048917 Ga0496114_0014358 Ga0496114_0014358_2313_3869 466
26 3300049571 Ga0501034_0015219 Ga0501034_0015219_5056_6678 467
27 3300049823 Ga0501044_0072061 Ga0501044_0072061_869_2410 467
28 3300005355 Ga0070671_100008471 Ga0070671_1000084716 469
29 3300006871 Ga0075434_100041384 Ga0075434_1000413843 469
30 3300025941 Ga0207711_10064774 Ga0207711_100647742 469
31 3300039437 Ga0436365_0011257 Ga0436365_0011257_208_1677 469
32 3300006844 Ga0075428_100000801 Ga0075428_10000080132 471
33 3300009094 Ga0111539_10000901 Ga0111539_1000090114 471
34 3300013104 Ga0157370_10097253 Ga0157370_100972532 471
35 3300027907 Ga0207428_10094119 Ga0207428_100941192 471
36 3300050511 nmdc:mga08y16_41466_c1 nmdc:mga08y16_41466_c1_3060_4580 471
37 3300005564 Ga0070664_100066825 Ga0070664_1000668252 472
38 3300028381 Ga0268264_10085901 Ga0268264_100859011 472
39 3300009147 Ga0114129_10188090 Ga0114129_101880901 473
40 3300050515 nmdc:mga0a205_57675_c1 nmdc:mga0a205_57675_c1_1236_2984 474
41 3300009147 Ga0114129_10103907 Ga0114129_101039072 475
42 3300050507 nmdc:mga05p37_6679_c1 nmdc:mga05p37_6679_c1_10320_11846 475
43 3300050508 nmdc:mga09592_44802_c1 nmdc:mga09592_44802_c1_466_1992 475
44 3300039450 Ga0436363_1532402 Ga0436363_1532402_620_2323 476
45 3300050507 nmdc:mga05p37_151378_c1 nmdc:mga05p37_151378_c1_501_1991 476
46 3300050507 nmdc:mga05p37_83788_c1 nmdc:mga05p37_83788_c1_870_2360 476
47 3300050508 nmdc:mga09592_168716_c1 nmdc:mga09592_168716_c1_230_1720 476
48 3300050510 nmdc:mga06r32_49309_c1 nmdc:mga06r32_49309_c1_1772_3268 476
49 3300050512 nmdc:mga0n895_43960_c1 nmdc:mga0n895_43960_c1_2661_4151 476
50 3300050515 nmdc:mga0a205_43086_c1 nmdc:mga0a205_43086_c1_165_1655 476
51 3300039450 Ga0436363_1179741 Ga0436363_1179741_9413_10951 477
52 3300031251 Ga0265327_10015607 Ga0265327_100156072 478
53 3300050509 nmdc:mga0qj67_157150_c1 nmdc:mga0qj67_157150_c1_221_1726 478
54 3300061734 Ga0530510_0057836 Ga0530510_0057836_1086_2600 478
55 3300005436 Ga0070713_100200018 Ga0070713_1002000181 479
56 3300005985 Ga0081539_10043111 Ga0081539_100431112 479
57 3300039438 Ga0436360_1001598 Ga0436360_1001598_15_1529 479
58 iso_pu_bacteria 8001522603 8001525579 479
59 3300014968 Ga0157379_10008802 Ga0157379_100088026 480
60 3300025928 Ga0207700_10150004 Ga0207700_101500041 480
61 3300060353 Ga0501082_0117197 Ga0501082_0117197_81_1649 480
62 3300005539 Ga0068853_100007983 Ga0068853_1000079832 481
63 3300005937 Ga0081455_10018410 Ga0081455_100184109 481
64 3300005981 Ga0081538_10036357 Ga0081538_100363573 481
65 3300006846 Ga0075430_100038678 Ga0075430_1000386784 481
66 3300006847 Ga0075431_100011686 Ga0075431_1000116864 481
67 3300013307 Ga0157372_10161910 Ga0157372_101619101 481
68 3300026041 Ga0207639_10014920 Ga0207639_100149208 481
69 3300031730 Ga0307516_10000779 Ga0307516_1000077926 481
70 3300005539 Ga0068853_100000062 Ga0068853_10000006240 482
71 3300007265 Ga0099794_10012554 Ga0099794_100125542 482
72 3300009177 Ga0105248_10024202 Ga0105248_100242023 482
73 3300025941 Ga0207711_10103080 Ga0207711_101030801 482
74 3300026041 Ga0207639_10000053 Ga0207639_1000005314 482
75 3300046529 Ga0495652_0078195 Ga0495652_0078195_683_2221 482
76 3300009545 Ga0105237_10025885 Ga0105237_100258853 483
77 3300013102 Ga0157371_10052169 Ga0157371_100521692 483
78 3300013307 Ga0157372_10063265 Ga0157372_100632651 483
79 3300025937 Ga0207669_10004980 Ga0207669_100049802 483
80 3300025940 Ga0207691_10051213 Ga0207691_100512132 483
81 3300045051 Ga0451576_0040348 Ga0451576_0040348_2690_4207 483
82 3300061734 Ga0530510_0000127 Ga0530510_0000127_2313_3818 483
83 3300009093 Ga0105240_10004053 Ga0105240_100040538 484
84 3300009094 Ga0111539_10223811 Ga0111539_102238111 484
85 3300009147 Ga0114129_10000414 Ga0114129_1000041454 484
86 3300010375 Ga0105239_10026994 Ga0105239_100269944 484
87 3300025913 Ga0207695_10000436 Ga0207695_1000043677 484
88 3300050507 nmdc:mga05p37_2239_c1 nmdc:mga05p37_2239_c1_2812_4314 484
89 3300061734 Ga0530510_0025265 Ga0530510_0025265_146_1690 484
90 3300013104 Ga0157370_10215171 Ga0157370_102151712 485
91 3300049569 Ga0501032_0119579 Ga0501032_0119579_161_1678 485
92 3300049573 Ga0501037_0063624 Ga0501037_0063624_108_1625 485
93 3300049574 Ga0501038_0029720 Ga0501038_0029720_143_1660 485
94 3300049579 Ga0501043_0058381 Ga0501043_0058381_436_1953 485
95 3300049581 Ga0501047_0002159 Ga0501047_0002159_8005_9522 485
96 3300049586 Ga0501070_0023227 Ga0501070_0023227_1367_2884 485
97 3300049823 Ga0501044_0044995 Ga0501044_0044995_100_1617 485
98 3300053085 Ga0495619_0028614 Ga0495619_0028614_265_1845 485
99 3300053103 Ga0500555_001470 Ga0500555_001470_3589_5139 485
100 3300053139 Ga0500568_0000807 Ga0500568_0000807_2164_3708 485
101 3300054114 Ga0501084_0194695 Ga0501084_0194695_118_1662 485
102 3300059492 Ga0587073_0003888 Ga0587073_0003888_82_1611 485
103 3300005339 Ga0070660_100036842 Ga0070660_1000368422 486
104 3300005354 Ga0070675_100001385 Ga0070675_10000138511 486
105 3300005364 Ga0070673_100029669 Ga0070673_1000296692 486
106 3300005367 Ga0070667_100022937 Ga0070667_1000229375 486
107 3300005458 Ga0070681_10004719 Ga0070681_100047193 486
108 3300005564 Ga0070664_100165339 Ga0070664_1001653391 486
109 3300005617 Ga0068859_100010377 Ga0068859_1000103775 486
110 3300006237 Ga0097621_100021659 Ga0097621_1000216592 486
111 3300006880 Ga0075429_100045570 Ga0075429_1000455702 486
112 3300006931 Ga0097620_100010377 Ga0097620_1000103775 486
113 3300009177 Ga0105248_10075779 Ga0105248_100757792 486
114 3300009177 Ga0105248_10085539 Ga0105248_100855393 486
115 3300013306 Ga0163162_10005755 Ga0163162_100057551 486
116 3300013308 Ga0157375_10009126 Ga0157375_100091265 486
117 3300014325 Ga0163163_10008946 Ga0163163_100089464 486
118 3300014968 Ga0157379_10003537 Ga0157379_100035375 486
119 3300020080 Ga0206350_10263449 Ga0206350_102634491 486
120 3300025914 Ga0207671_10040355 Ga0207671_100403551 486
121 3300025931 Ga0207644_10008574 Ga0207644_100085745 486
122 3300026088 Ga0207641_10081046 Ga0207641_100810462 486
123 3300026116 Ga0207674_10090936 Ga0207674_100909364 486
124 3300044656 Ga0466969_0002629 Ga0466969_0002629_3496_5052 486
125 3300044684 Ga0466966_0022631 Ga0466966_0022631_198_1754 486
126 3300045049 Ga0466959_0032728 Ga0466959_0032728_1848_3404 486
127 3300046515 Ga0495620_0001937 Ga0495620_0001937_10384_11919 486
128 3300048915 Ga0496112_0183821 Ga0496112_0183821_141_1889 486
129 3300004803 Ga0058862_12829385 Ga0058862_128293852 487
130 3300005331 Ga0070670_100047928 Ga0070670_1000479282 487
131 3300005354 Ga0070675_100017214 Ga0070675_1000172146 487
132 3300005468 Ga0070707_100030018 Ga0070707_1000300185 487
133 3300005543 Ga0070672_100102043 Ga0070672_1001020432 487
134 3300006173 Ga0070716_100071959 Ga0070716_1000719591 487
135 3300009094 Ga0111539_10020636 Ga0111539_100206367 487
136 3300013307 Ga0157372_10279189 Ga0157372_102791891 487
137 3300020069 Ga0197907_11114090 Ga0197907_111140901 487
138 3300020070 Ga0206356_11859015 Ga0206356_118590153 487
139 3300020078 Ga0206352_10095980 Ga0206352_100959801 487
140 3300021384 Ga0213876_10011490 Ga0213876_100114904 487
141 3300021388 Ga0213875_10008913 Ga0213875_100089132 487
142 3300022467 Ga0224712_10009151 Ga0224712_100091513 487
143 3300022467 Ga0224712_10032823 Ga0224712_100328231 487
144 3300022467 Ga0224712_10038647 Ga0224712_100386471 487
145 3300025915 Ga0207693_10073211 Ga0207693_100732112 487
146 3300025922 Ga0207646_10016373 Ga0207646_100163732 487
147 3300025926 Ga0207659_10121733 Ga0207659_101217331 487
148 3300025931 Ga0207644_10165464 Ga0207644_101654641 487
149 3300035111 Ga0373923_0013673 Ga0373923_0013673_1082_2644 487
150 3300035118 Ga0373954_0004461 Ga0373954_0004461_4411_5973 487
151 3300036401 Ga0373937_0009399 Ga0373937_0009399_4274_5836 487
152 3300036401 Ga0373937_0101419 Ga0373937_0101419_891_2408 487
153 3300037853 Ga0436364_0996625 Ga0436364_0996625_528_2084 487
154 3300039437 Ga0436365_1610796 Ga0436365_1610796_3980_5518 487
155 3300044673 Ga0453683_0001015 Ga0453683_0001015_17808_19340 487
156 3300049572 Ga0501036_0085883 Ga0501036_0085883_34_1602 487
157 3300049577 Ga0501041_0099274 Ga0501041_0099274_124_1692 487
158 3300049742 Ga0501080_0040506 Ga0501080_0040506_2351_3967 487
159 3300050508 nmdc:mga09592_120139_c1 nmdc:mga09592_120139_c1_36_1538 487
160 3300050510 nmdc:mga06r32_30007_c1 nmdc:mga06r32_30007_c1_821_2323 487
161 3300050511 nmdc:mga08y16_14448_c1 nmdc:mga08y16_14448_c1_5020_6561 487
162 3300053153 Ga0500616_0002987 Ga0500616_0002987_2652_4175 487
163 3300005563 Ga0068855_100000294 Ga0068855_1000002947 488
164 3300005617 Ga0068859_100046774 Ga0068859_1000467742 488
165 3300005985 Ga0081539_10018712 Ga0081539_100187123 488
166 3300006844 Ga0075428_100041688 Ga0075428_1000416883 488
167 3300006846 Ga0075430_100001122 Ga0075430_10000112216 488
168 3300006880 Ga0075429_100001140 Ga0075429_10000114010 488
169 3300006931 Ga0097620_100046774 Ga0097620_1000467742 488
170 3300020080 Ga0206350_11013479 Ga0206350_110134792 488
171 3300025926 Ga0207659_10002561 Ga0207659_1000256112 488
172 3300025949 Ga0207667_10000787 Ga0207667_1000078728 488
173 3300039437 Ga0436365_0477873 Ga0436365_0477873_40_1590 488
174 3300049568 Ga0501031_0002260 Ga0501031_0002260_7633_9186 488
175 3300049569 Ga0501032_0000694 Ga0501032_0000694_22749_24302 488
176 3300049569 Ga0501032_0011706 Ga0501032_0011706_3201_4754 488
177 3300049569 Ga0501032_0045937 Ga0501032_0045937_1145_2785 488
178 3300049570 Ga0501033_0003250 Ga0501033_0003250_4628_6181 488
179 3300049570 Ga0501033_0004254 Ga0501033_0004254_7090_8643 488
180 3300049571 Ga0501034_0003641 Ga0501034_0003641_2653_4206 488
181 3300049572 Ga0501036_0001985 Ga0501036_0001985_3120_4673 488
182 3300049572 Ga0501036_0018925 Ga0501036_0018925_1806_3359 488
183 3300049573 Ga0501037_0005015 Ga0501037_0005015_2680_4233 488
184 3300049573 Ga0501037_0106073 Ga0501037_0106073_231_1784 488
185 3300049574 Ga0501038_0001457 Ga0501038_0001457_3094_4647 488
186 3300049574 Ga0501038_0008508 Ga0501038_0008508_4249_5802 488
187 3300049575 Ga0501039_0004783 Ga0501039_0004783_128_1681 488
188 3300049576 Ga0501040_0003339 Ga0501040_0003339_6163_7716 488
189 3300049578 Ga0501042_0064204 Ga0501042_0064204_81_1625 488
190 3300049579 Ga0501043_0003217 Ga0501043_0003217_3075_4628 488
191 3300049579 Ga0501043_0015607 Ga0501043_0015607_714_2267 488
192 3300049580 Ga0501046_0014688 Ga0501046_0014688_1292_2845 488
193 3300049580 Ga0501046_0021304 Ga0501046_0021304_518_2071 488
194 3300049582 Ga0501048_0012624 Ga0501048_0012624_2006_3559 488
195 3300049584 Ga0501068_0000701 Ga0501068_0000701_10467_12020 488
196 3300049588 Ga0501072_0104764 Ga0501072_0104764_681_2234 488
197 3300049822 Ga0501035_0000790 Ga0501035_0000790_6673_8226 488
198 3300049822 Ga0501035_0015556 Ga0501035_0015556_2786_4339 488
199 3300049823 Ga0501044_0002294 Ga0501044_0002294_17163_18716 488
200 3300049823 Ga0501044_0051346 Ga0501044_0051346_1717_3270 488
201 3300049824 Ga0501045_0003397 Ga0501045_0003397_2786_4339 488
202 3300050508 nmdc:mga09592_1954_c1 nmdc:mga09592_1954_c1_8517_10037 488
203 3300050509 nmdc:mga0qj67_41198_c1 nmdc:mga0qj67_41198_c1_600_2120 488
204 3300050510 nmdc:mga06r32_56023_c1 nmdc:mga06r32_56023_c1_751_2271 488
205 iso_pu_bacteria 2889415604 2889420015 488
206 3300003203 JGI25406J46586_10026262 JGI25406J46586_100262622 489
207 3300005435 Ga0070714_100098508 Ga0070714_1000985082 489
208 3300005456 Ga0070678_100155804 Ga0070678_1001558041 489
209 3300005985 Ga0081539_10009382 Ga0081539_100093823 489
210 3300013104 Ga0157370_10021825 Ga0157370_100218252 489
211 3300021384 Ga0213876_10077713 Ga0213876_100777132 489
212 3300037471 Ga0395905_0026019 Ga0395905_0026019_465_1979 489
213 3300048911 Ga0496108_0021799 Ga0496108_0021799_3436_4986 489
214 3300048912 Ga0496109_0031978 Ga0496109_0031978_2598_4148 489
215 3300048917 Ga0496114_0018635 Ga0496114_0018635_591_2141 489
216 3300049570 Ga0501033_0000119 Ga0501033_0000119_52616_54172 489
217 3300049572 Ga0501036_0003565 Ga0501036_0003565_3543_5099 489
218 3300049574 Ga0501038_0002378 Ga0501038_0002378_13595_15151 489
219 3300049822 Ga0501035_0014881 Ga0501035_0014881_4645_6201 489
220 3300049823 Ga0501044_0000093 Ga0501044_0000093_65338_66894 489
221 3300049823 Ga0501044_0008737 Ga0501044_0008737_6076_7632 489
222 3300003349 JGI26129J50193_1001425 JGI26129J50193_10014251 490
223 3300005328 Ga0070676_10001273 Ga0070676_100012737 490
224 3300005331 Ga0070670_100009839 Ga0070670_1000098394 490
225 3300005334 Ga0068869_100017210 Ga0068869_1000172103 490
226 3300005336 Ga0070680_100028522 Ga0070680_1000285223 490
227 3300005337 Ga0070682_100001964 Ga0070682_1000019642 490
228 3300005339 Ga0070660_100001376 Ga0070660_1000013765 490
229 3300005340 Ga0070689_100085284 Ga0070689_1000852842 490
230 3300005345 Ga0070692_10001557 Ga0070692_100015577 490
231 3300005353 Ga0070669_100071961 Ga0070669_1000719612 490
232 3300005354 Ga0070675_100096807 Ga0070675_1000968071 490
233 3300005366 Ga0070659_100002197 Ga0070659_1000021977 490
234 3300005406 Ga0070703_10002306 Ga0070703_100023066 490
235 3300005438 Ga0070701_10054785 Ga0070701_100547852 490
236 3300005455 Ga0070663_100000406 Ga0070663_10000040620 490
237 3300005467 Ga0070706_100034431 Ga0070706_1000344312 490
238 3300005467 Ga0070706_100064422 Ga0070706_1000644221 490
239 3300005536 Ga0070697_100002248 Ga0070697_1000022483 490
240 3300005539 Ga0068853_100102991 Ga0068853_1001029912 490
241 3300005545 Ga0070695_100005982 Ga0070695_1000059826 490
242 3300005547 Ga0070693_100001093 Ga0070693_1000010936 490
243 3300005549 Ga0070704_100004628 Ga0070704_1000046282 490
244 3300005563 Ga0068855_100062410 Ga0068855_1000624103 490
245 3300005577 Ga0068857_100040911 Ga0068857_1000409114 490
246 3300005578 Ga0068854_100015131 Ga0068854_1000151314 490
247 3300005614 Ga0068856_100019239 Ga0068856_1000192397 490
248 3300005616 Ga0068852_100121644 Ga0068852_1001216441 490
249 3300005844 Ga0068862_100026895 Ga0068862_1000268953 490
250 3300005981 Ga0081538_10008237 Ga0081538_100082372 490
251 3300006844 Ga0075428_100002581 Ga0075428_10000258112 490
252 3300006847 Ga0075431_100026767 Ga0075431_1000267673 490
253 3300006852 Ga0075433_10143571 Ga0075433_101435712 490
254 3300006880 Ga0075429_100139503 Ga0075429_1001395032 490
255 3300007076 Ga0075435_100106163 Ga0075435_1001061631 490
256 3300007265 Ga0099794_10002147 Ga0099794_100021473 490
257 3300009545 Ga0105237_10045954 Ga0105237_100459545 490
258 3300011119 Ga0105246_10019379 Ga0105246_100193793 490
259 3300013104 Ga0157370_10012606 Ga0157370_100126063 490
260 3300013306 Ga0163162_10020605 Ga0163162_100206053 490
261 3300013307 Ga0157372_10030475 Ga0157372_100304755 490
262 3300013307 Ga0157372_10082732 Ga0157372_100827322 490
263 3300025885 Ga0207653_10001805 Ga0207653_100018056 490
264 3300025901 Ga0207688_10030976 Ga0207688_100309764 490
265 3300025907 Ga0207645_10000582 Ga0207645_1000058226 490
266 3300025908 Ga0207643_10003639 Ga0207643_100036395 490
267 3300025910 Ga0207684_10085641 Ga0207684_100856412 490
268 3300025914 Ga0207671_10035174 Ga0207671_100351744 490
269 3300025917 Ga0207660_10000220 Ga0207660_100002202 490
270 3300025919 Ga0207657_10000730 Ga0207657_1000073027 490
271 3300025920 Ga0207649_10049325 Ga0207649_100493252 490
272 3300025921 Ga0207652_10059041 Ga0207652_100590413 490
273 3300025922 Ga0207646_10130279 Ga0207646_101302792 490
274 3300025923 Ga0207681_10028885 Ga0207681_100288852 490
275 3300025926 Ga0207659_10074807 Ga0207659_100748072 490
276 3300025933 Ga0207706_10005515 Ga0207706_1000551511 490
277 3300025942 Ga0207689_10000846 Ga0207689_1000084626 490
278 3300025944 Ga0207661_10235233 Ga0207661_102352331 490
279 3300025945 Ga0207679_10036638 Ga0207679_100366383 490
280 3300025949 Ga0207667_10086584 Ga0207667_100865842 490
281 3300026078 Ga0207702_10006797 Ga0207702_100067975 490
282 3300026095 Ga0207676_10010320 Ga0207676_100103205 490
283 3300026116 Ga0207674_10052804 Ga0207674_100528041 490
284 3300027471 Ga0209995_1000192 Ga0209995_10001925 490
285 3300027614 Ga0209970_1001750 Ga0209970_10017502 490
286 3300027671 Ga0209588_1000155 Ga0209588_10001553 490
287 3300027671 Ga0209588_1006813 Ga0209588_10068132 490
288 3300027682 Ga0209971_1000008 Ga0209971_100000841 490
289 3300027695 Ga0209966_1000290 Ga0209966_10002906 490
290 3300027717 Ga0209998_10000016 Ga0209998_1000001661 490
291 3300027876 Ga0209974_10000073 Ga0209974_100000738 490
292 3300028380 Ga0268265_10024994 Ga0268265_100249942 490
293 3300031548 Ga0307408_100011415 Ga0307408_1000114156 490
294 3300031824 Ga0307413_10011204 Ga0307413_100112043 490
295 3300031852 Ga0307410_10042107 Ga0307410_100421073 490
296 3300031995 Ga0307409_100007643 Ga0307409_1000076436 490
297 3300032002 Ga0307416_100008071 Ga0307416_1000080716 490
298 3300032002 Ga0307416_100015547 Ga0307416_1000155474 490
299 3300032002 Ga0307416_100018089 Ga0307416_1000180894 490
300 3300032005 Ga0307411_10035141 Ga0307411_100351411 490
301 3300032126 Ga0307415_100006644 Ga0307415_1000066441 490
302 3300035115 Ga0373941_0007363 Ga0373941_0007363_767_2308 490
303 3300039453 Ga0436362_0702035 Ga0436362_0702035_614_2173 490
304 3300042005 Ga0439448_0000257 Ga0439448_0000257_2431_3972 490
305 3300042438 Ga0439459_0000760 Ga0439459_0000760_1550_3091 490
306 3300044712 Ga0453684_0068052 Ga0453684_0068052_2853_4394 490
307 3300045051 Ga0451576_0116724 Ga0451576_0116724_1111_2652 490
308 3300048913 Ga0496110_0066678 Ga0496110_0066678_679_2220 490
309 3300050512 nmdc:mga0n895_150459_c1 nmdc:mga0n895_150459_c1_409_1950 490
310 3300006844 Ga0075428_100077538 Ga0075428_1000775383 491
311 3300006847 Ga0075431_100045887 Ga0075431_1000458872 491
312 3300006880 Ga0075429_100100618 Ga0075429_1001006182 491
313 3300009147 Ga0114129_10015155 Ga0114129_1001515513 491
314 3300045051 Ga0451576_0000214 Ga0451576_0000214_58676_60256 491
315 3300045051 Ga0451576_0003358 Ga0451576_0003358_9052_10632 491
316 3300050507 nmdc:mga05p37_38583_c1 nmdc:mga05p37_38583_c1_64_1578 491
317 3300050512 nmdc:mga0n895_153902_c1 nmdc:mga0n895_153902_c1_767_2281 491
318 3300003203 JGI25406J46586_10017637 JGI25406J46586_100176372 492
319 3300005985 Ga0081539_10000083 Ga0081539_1000008355 492

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01471

PG_binding_1

Putative peptidoglycan binding domain

34

91

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c2w-assembly1.cif.gz_F kuenenia stuttgartiensis hydrazine synthase pressurized with 20 bar xenon 0.5818 354 489
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.5699 341 489
3o5c-assembly2.cif.gz_D cytochrome c peroxidase bccp of shewanella oneidensis 0.563 335 488
3o5c-assembly2.cif.gz_C cytochrome c peroxidase bccp of shewanella oneidensis 0.5556 335 488
6e1c-assembly2.cif.gz_B crystal structure of a maug-like protein associated with microbial copper homeostasis 0.4355 201 489
ID Description Score Start End Superfamily
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6099 377 488 1.10.760.10
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.4692 377 488 1.10.760.10
af_Q95XQ4_532_917_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3138 323 366 1.25.10.10
af_A0A0P0WSN8_58_197_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.2952 82 130 3.40.630.10
af_P76578_1172_1439_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.1457 344 488 1.50.10.20
ID Description Score Start End GO Terms
AF-A0A538S2C5-F1-model_v4 Cytochrome c domain-containing protein 0.8603 371 489 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A436CJG0-F1-model_v4 Cytochrome B6 0.837 365 489 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-Q0AGF7-F1-model_v4 Cytochrome c peroxidase 0.8327 81 489 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-Q0AGF7-F1-model_v4 Cytochrome c peroxidase 0.831 81 489 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A2G2MAJ6-F1-model_v4 Cytochrome B6 0.812 68 489 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
68.26 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map