F405022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 198 | 315 | 511 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100077538|Ga0075428_1000775383 |
| Length | 583 |
| Sequence | MRRSFFPLVVGICVITGLIIADVSQHISPGTSLTAQERRPSQEQIKRAAGYEPGSVDGVWGPQTEAAVRDFQKQRGLSVSGALDDGTRHALGLITAQNQPTSRPGVMPDAVQEAQTPRTVLEERPEQRKSAHDRSNIFQASQGLPAXXXXPNQPEQGKILGFDFYRDPLNAKRPMQPFEEIMHADAQAKPQVMTAQRQLLESRYELTPRLDPEAKMARGKPLPVGPTARLAAGTDWNTLASMAPDAIRQRNLFPYPALPHPKQVAGGQVFPAMQIAMFPRLERFDVDFDLPDAFLPEFPPAIFLQNRPELGDVSRGEVVSINNFYALFKDLLTPVQLDGLRLLLTPLPQEEFNPTDDRKSPTPSLGIACLDCHVNGHTTAQFHLNPDDRPQERRMRLDTVSLRGLFNQQIHGSKRSLRSVEDFTEFEQRTAYFNGDPIHAMKKGMMILDRVQVSHMAQMQNMFDVPPATKLTPQGRLDPARATESERRGEQVFFGKGQCATCHTPPFYLDHQMHDLRVERFVNEAPLGPIKTFTLRGIKESPPYLHDGRCLTLEDTVEFFNLVLELKLTPEEKRDLVAFMRVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 2 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 140 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 141 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 142 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 143 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 144 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 145 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 146 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 151 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 192 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 198 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.61 |
| Metatranscriptomes | 3.13 |
| Isolates | 1.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 93.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10017637 | 3300003203 | Bacteria | 2947 |
| 2 | JGI25406J46586_10026262 | 3300003203 | Bacteria | 2247 |
| 3 | JGI26129J50193_1001425 | 3300003349 | Bacteria | 1622 |
| 4 | Ga0058862_12829385 | 3300004803 | Bacteria | 2215 |
| 5 | Ga0070676_10001273 | 3300005328 | Bacteria | 12665 |
| 6 | Ga0070670_100009839 | 3300005331 | Bacteria | 8169 |
| 7 | Ga0070670_100047928 | 3300005331 | Bacteria | 3678 |
| 8 | Ga0068869_100017210 | 3300005334 | Bacteria | 4894 |
| 9 | Ga0070680_100028522 | 3300005336 | Bacteria | 4478 |
| 10 | Ga0070682_100001964 | 3300005337 | Bacteria | 11468 |
| 11 | Ga0070660_100001376 | 3300005339 | Bacteria | 16510 |
| 12 | Ga0070660_100036842 | 3300005339 | Bacteria | 3707 |
| 13 | Ga0070689_100085284 | 3300005340 | Bacteria | 2483 |
| 14 | Ga0070692_10001557 | 3300005345 | Bacteria | 8419 |
| 15 | Ga0070669_100071961 | 3300005353 | Bacteria | 2559 |
| 16 | Ga0070675_100001385 | 3300005354 | Bacteria | 17771 |
| 17 | Ga0070675_100017214 | 3300005354 | Bacteria | 5742 |
| 18 | Ga0070675_100096807 | 3300005354 | Bacteria | 2480 |
| 19 | Ga0070671_100008471 | 3300005355 | Bacteria | 8241 |
| 20 | Ga0070673_100029669 | 3300005364 | Unclassified | 4081 |
| 21 | Ga0070659_100002197 | 3300005366 | Bacteria | 13885 |
| 22 | Ga0070667_100022937 | 3300005367 | Bacteria | 5174 |
| 23 | Ga0070703_10002306 | 3300005406 | Bacteria | 5523 |
| 24 | Ga0070714_100098508 | 3300005435 | Bacteria | 2572 |
| 25 | Ga0070713_100200018 | 3300005436 | Bacteria | 1804 |
| 26 | Ga0070701_10054785 | 3300005438 | Bacteria | 2081 |
| 27 | Ga0070663_100000406 | 3300005455 | Bacteria | 22595 |
| 28 | Ga0070678_100155804 | 3300005456 | Bacteria | 1845 |
| 29 | Ga0070681_10004719 | 3300005458 | Bacteria | 13046 |
| 30 | Ga0070706_100034431 | 3300005467 | Bacteria | 4679 |
| 31 | Ga0070706_100064422 | 3300005467 | Bacteria | 3388 |
| 32 | Ga0070707_100030018 | 3300005468 | Bacteria | 5173 |
| 33 | Ga0070697_100002248 | 3300005536 | Bacteria | 14812 |
| 34 | Ga0068853_100000062 | 3300005539 | Bacteria | 77196 |
| 35 | Ga0068853_100007983 | 3300005539 | Bacteria | 8488 |
| 36 | Ga0068853_100102991 | 3300005539 | Bacteria | 2526 |
| 37 | Ga0070672_100102043 | 3300005543 | Bacteria | 2328 |
| 38 | Ga0070695_100005982 | 3300005545 | Bacteria | 7186 |
| 39 | Ga0070693_100001093 | 3300005547 | Bacteria | 12168 |
| 40 | Ga0070704_100004628 | 3300005549 | Bacteria | 7962 |
| 41 | Ga0068855_100000294 | 3300005563 | Bacteria | 61922 |
| 42 | Ga0068855_100062410 | 3300005563 | Bacteria | 4350 |
| 43 | Ga0070664_100066825 | 3300005564 | Bacteria | 3071 |
| 44 | Ga0070664_100165339 | 3300005564 | Bacteria | 1960 |
| 45 | Ga0068857_100040911 | 3300005577 | Bacteria | 4109 |
| 46 | Ga0068854_100015131 | 3300005578 | Bacteria | 5102 |
| 47 | Ga0068856_100006423 | 3300005614 | Bacteria | 11534 |
| 48 | Ga0068856_100019239 | 3300005614 | Bacteria | 6628 |
| 49 | Ga0068852_100121644 | 3300005616 | Bacteria | 2391 |
| 50 | Ga0068859_100010377 | 3300005617 | Bacteria | 9371 |
| 51 | Ga0068859_100046774 | 3300005617 | Bacteria | 4345 |
| 52 | Ga0068863_100000892 | 3300005841 | Bacteria | 30096 |
| 53 | Ga0068860_100000930 | 3300005843 | Bacteria | 32372 |
| 54 | Ga0068862_100026895 | 3300005844 | Bacteria | 4838 |
| 55 | Ga0081455_10018410 | 3300005937 | Bacteria | 6656 |
| 56 | Ga0081538_10008237 | 3300005981 | Bacteria | 8883 |
| 57 | Ga0081538_10036357 | 3300005981 | Unclassified | 3215 |
| 58 | Ga0081539_10000083 | 3300005985 | Bacteria | 218881 |
| 59 | Ga0081539_10009382 | 3300005985 | Bacteria | 8190 |
| 60 | Ga0081539_10018712 | 3300005985 | Bacteria | 4787 |
| 61 | Ga0081539_10043111 | 3300005985 | Bacteria | 2619 |
| 62 | Ga0070717_10052586 | 3300006028 | Unclassified | 3356 |
| 63 | Ga0070716_100071959 | 3300006173 | Bacteria | 2034 |
| 64 | Ga0097621_100021659 | 3300006237 | Bacteria | 4978 |
| 65 | Ga0075428_100000801 | 3300006844 | Bacteria | 32802 |
| 66 | Ga0075428_100002581 | 3300006844 | Bacteria | 19672 |
| 67 | Ga0075428_100041688 | 3300006844 | Bacteria | 5046 |
| 68 | Ga0075428_100077538 | 3300006844 | Bacteria | 3627 |
| 69 | Ga0075430_100001122 | 3300006846 | Bacteria | 21335 |
| 70 | Ga0075430_100038678 | 3300006846 | Bacteria | 4040 |
| 71 | Ga0075431_100011686 | 3300006847 | Bacteria | 8859 |
| 72 | Ga0075431_100026767 | 3300006847 | Bacteria | 5915 |
| 73 | Ga0075431_100045887 | 3300006847 | Bacteria | 4504 |
| 74 | Ga0075433_10143571 | 3300006852 | Bacteria | 2122 |
| 75 | Ga0075434_100041384 | 3300006871 | Bacteria | 4566 |
| 76 | Ga0075429_100001140 | 3300006880 | Bacteria | 21430 |
| 77 | Ga0075429_100045570 | 3300006880 | Bacteria | 3815 |
| 78 | Ga0075429_100100618 | 3300006880 | Bacteria | 2523 |
| 79 | Ga0075429_100139503 | 3300006880 | Bacteria | 2122 |
| 80 | Ga0097620_100010377 | 3300006931 | Bacteria | 9371 |
| 81 | Ga0097620_100046774 | 3300006931 | Bacteria | 4345 |
| 82 | Ga0075435_100106163 | 3300007076 | Bacteria | 2332 |
| 83 | Ga0099794_10002147 | 3300007265 | Bacteria | 7174 |
| 84 | Ga0099794_10012554 | 3300007265 | Bacteria | 3660 |
| 85 | Ga0105240_10004053 | 3300009093 | Bacteria | 22537 |
| 86 | Ga0111539_10000901 | 3300009094 | Bacteria | 38812 |
| 87 | Ga0111539_10020636 | 3300009094 | Bacteria | 8115 |
| 88 | Ga0111539_10223811 | 3300009094 | Bacteria | 2191 |
| 89 | Ga0114129_10000414 | 3300009147 | Bacteria | 50458 |
| 90 | Ga0114129_10015155 | 3300009147 | Bacteria | 10973 |
| 91 | Ga0114129_10103907 | 3300009147 | Bacteria | 3927 |
| 92 | Ga0114129_10188090 | 3300009147 | Bacteria | 2805 |
| 93 | Ga0105248_10024202 | 3300009177 | Bacteria | 6750 |
| 94 | Ga0105248_10075779 | 3300009177 | Bacteria | 3781 |
| 95 | Ga0105248_10085539 | 3300009177 | Unclassified | 3548 |
| 96 | Ga0105237_10025885 | 3300009545 | Bacteria | 5997 |
| 97 | Ga0105237_10045954 | 3300009545 | Bacteria | 4393 |
| 98 | Ga0105239_10026994 | 3300010375 | Bacteria | 6321 |
| 99 | Ga0105246_10019379 | 3300011119 | Bacteria | 4346 |
| 100 | Ga0157373_10059726 | 3300013100 | Bacteria | 2702 |
| 101 | Ga0157371_10052169 | 3300013102 | Bacteria | 2905 |
| 102 | Ga0157370_10012606 | 3300013104 | Bacteria | 8760 |
| 103 | Ga0157370_10021825 | 3300013104 | Bacteria | 6377 |
| 104 | Ga0157370_10097253 | 3300013104 | Bacteria | 2761 |
| 105 | Ga0157370_10215171 | 3300013104 | Bacteria | 1780 |
| 106 | Ga0157369_10031105 | 3300013105 | Bacteria | 5881 |
| 107 | Ga0157374_10028939 | 3300013296 | Bacteria | 5009 |
| 108 | Ga0163162_10005755 | 3300013306 | Bacteria | 11990 |
| 109 | Ga0163162_10020605 | 3300013306 | Bacteria | 6479 |
| 110 | Ga0157372_10030475 | 3300013307 | Bacteria | 5902 |
| 111 | Ga0157372_10044194 | 3300013307 | Bacteria | 4936 |
| 112 | Ga0157372_10063265 | 3300013307 | Bacteria | 4148 |
| 113 | Ga0157372_10082732 | 3300013307 | Bacteria | 3635 |
| 114 | Ga0157372_10161910 | 3300013307 | Bacteria | 2586 |
| 115 | Ga0157372_10279189 | 3300013307 | Bacteria | 1942 |
| 116 | Ga0157375_10009126 | 3300013308 | Bacteria | 8689 |
| 117 | Ga0157375_10111867 | 3300013308 | Bacteria | 2830 |
| 118 | Ga0163163_10008946 | 3300014325 | Bacteria | 8921 |
| 119 | Ga0157379_10003537 | 3300014968 | Bacteria | 13231 |
| 120 | Ga0157379_10008802 | 3300014968 | Bacteria | 8804 |
| 121 | Ga0197907_11114090 | 3300020069 | Bacteria | 1760 |
| 122 | Ga0206356_11859015 | 3300020070 | Bacteria | 2967 |
| 123 | Ga0206352_10095980 | 3300020078 | Bacteria | 2157 |
| 124 | Ga0206350_10263449 | 3300020080 | Bacteria | 2699 |
| 125 | Ga0206350_11013479 | 3300020080 | Bacteria | 2124 |
| 126 | Ga0213876_10011490 | 3300021384 | Bacteria | 4727 |
| 127 | Ga0213876_10077713 | 3300021384 | Unclassified | 1753 |
| 128 | Ga0213875_10008913 | 3300021388 | Bacteria | 5113 |
| 129 | Ga0224712_10009151 | 3300022467 | Bacteria | 2970 |
| 130 | Ga0224712_10032823 | 3300022467 | Bacteria | 1895 |
| 131 | Ga0224712_10038647 | 3300022467 | Bacteria | 1784 |
| 132 | Ga0207653_10001805 | 3300025885 | Bacteria | 6839 |
| 133 | Ga0207688_10030976 | 3300025901 | Bacteria | 2951 |
| 134 | Ga0207645_10000582 | 3300025907 | Bacteria | 30310 |
| 135 | Ga0207643_10003639 | 3300025908 | Bacteria | 8305 |
| 136 | Ga0207684_10085641 | 3300025910 | Bacteria | 2684 |
| 137 | Ga0207695_10000436 | 3300025913 | Bacteria | 91698 |
| 138 | Ga0207671_10035174 | 3300025914 | Bacteria | 3719 |
| 139 | Ga0207671_10040355 | 3300025914 | Bacteria | 3455 |
| 140 | Ga0207693_10073211 | 3300025915 | Bacteria | 2682 |
| 141 | Ga0207660_10000220 | 3300025917 | Bacteria | 36783 |
| 142 | Ga0207657_10000730 | 3300025919 | Bacteria | 34885 |
| 143 | Ga0207649_10049325 | 3300025920 | Bacteria | 2599 |
| 144 | Ga0207652_10059041 | 3300025921 | Bacteria | 3306 |
| 145 | Ga0207646_10016373 | 3300025922 | Bacteria | 6958 |
| 146 | Ga0207646_10130279 | 3300025922 | Bacteria | 2263 |
| 147 | Ga0207681_10028885 | 3300025923 | Bacteria | 3596 |
| 148 | Ga0207659_10002561 | 3300025926 | Bacteria | 10815 |
| 149 | Ga0207659_10074807 | 3300025926 | Bacteria | 2483 |
| 150 | Ga0207659_10121733 | 3300025926 | Bacteria | 2000 |
| 151 | Ga0207700_10150004 | 3300025928 | Bacteria | 1925 |
| 152 | Ga0207644_10008574 | 3300025931 | Bacteria | 6690 |
| 153 | Ga0207644_10017338 | 3300025931 | Bacteria | 4862 |
| 154 | Ga0207644_10165464 | 3300025931 | Bacteria | 1723 |
| 155 | Ga0207706_10005515 | 3300025933 | Bacteria | 11796 |
| 156 | Ga0207669_10004980 | 3300025937 | Bacteria | 5909 |
| 157 | Ga0207691_10051213 | 3300025940 | Bacteria | 3776 |
| 158 | Ga0207711_10064774 | 3300025941 | Unclassified | 3157 |
| 159 | Ga0207711_10103080 | 3300025941 | Bacteria | 2526 |
| 160 | Ga0207689_10000846 | 3300025942 | Bacteria | 29434 |
| 161 | Ga0207661_10235233 | 3300025944 | Bacteria | 1624 |
| 162 | Ga0207679_10036638 | 3300025945 | Bacteria | 3480 |
| 163 | Ga0207667_10000787 | 3300025949 | Bacteria | 41210 |
| 164 | Ga0207667_10086584 | 3300025949 | Bacteria | 3242 |
| 165 | Ga0207639_10000053 | 3300026041 | Bacteria | 113162 |
| 166 | Ga0207639_10014920 | 3300026041 | Bacteria | 5473 |
| 167 | Ga0207702_10006797 | 3300026078 | Bacteria | 9810 |
| 168 | Ga0207702_10008530 | 3300026078 | Bacteria | 8638 |
| 169 | Ga0207641_10081046 | 3300026088 | Unclassified | 2817 |
| 170 | Ga0207676_10010320 | 3300026095 | Bacteria | 6651 |
| 171 | Ga0207674_10052804 | 3300026116 | Bacteria | 4144 |
| 172 | Ga0207674_10090936 | 3300026116 | Bacteria | 3043 |
| 173 | Ga0209995_1000192 | 3300027471 | Bacteria | 9697 |
| 174 | Ga0209970_1001750 | 3300027614 | Bacteria | 3765 |
| 175 | Ga0209588_1000155 | 3300027671 | Bacteria | 19577 |
| 176 | Ga0209588_1006813 | 3300027671 | Bacteria | 3341 |
| 177 | Ga0209971_1000008 | 3300027682 | Bacteria | 102612 |
| 178 | Ga0209966_1000290 | 3300027695 | Bacteria | 17006 |
| 179 | Ga0209998_10000016 | 3300027717 | Bacteria | 85166 |
| 180 | Ga0209974_10000073 | 3300027876 | Bacteria | 26904 |
| 181 | Ga0207428_10094119 | 3300027907 | Bacteria | 2323 |
| 182 | Ga0268265_10024994 | 3300028380 | Bacteria | 4233 |
| 183 | Ga0268264_10085901 | 3300028381 | Unclassified | 2701 |
| 184 | Ga0265327_10005122 | 3300031251 | Bacteria | 11130 |
| 185 | Ga0265327_10015607 | 3300031251 | Bacteria | 4889 |
| 186 | Ga0307408_100011415 | 3300031548 | Bacteria | 5870 |
| 187 | Ga0307516_10000779 | 3300031730 | Bacteria | 43455 |
| 188 | Ga0307413_10011204 | 3300031824 | Bacteria | 4395 |
| 189 | Ga0307410_10042107 | 3300031852 | Bacteria | 3016 |
| 190 | Ga0307409_100007643 | 3300031995 | Bacteria | 6485 |
| 191 | Ga0307416_100008071 | 3300032002 | Bacteria | 6750 |
| 192 | Ga0307416_100015547 | 3300032002 | Bacteria | 5260 |
| 193 | Ga0307416_100018089 | 3300032002 | Bacteria | 4954 |
| 194 | Ga0307411_10035141 | 3300032005 | Bacteria | 3126 |
| 195 | Ga0307415_100006644 | 3300032126 | Bacteria | 6259 |
| 196 | Ga0373923_0013673 | 3300035111 | Bacteria | 3030 |
| 197 | Ga0373941_0007363 | 3300035115 | Bacteria | 2691 |
| 198 | Ga0373954_0004461 | 3300035118 | Bacteria | 6022 |
| 199 | Ga0373937_0009399 | 3300036401 | Bacteria | 8497 |
| 200 | Ga0373937_0101419 | 3300036401 | Bacteria | 2671 |
| 201 | Ga0395905_0026019 | 3300037471 | Bacteria | 5518 |
| 202 | Ga0436364_0996625 | 3300037853 | Bacteria | 4383 |
| 203 | Ga0436365_0011257 | 3300039437 | Unclassified | 2733 |
| 204 | Ga0436365_0477873 | 3300039437 | Bacteria | 1657 |
| 205 | Ga0436365_1610796 | 3300039437 | Bacteria | 10394 |
| 206 | Ga0436360_1001598 | 3300039438 | Bacteria | 2405 |
| 207 | Ga0436363_1179741 | 3300039450 | Bacteria | 13484 |
| 208 | Ga0436363_1532402 | 3300039450 | Bacteria | 2372 |
| 209 | Ga0436362_0702035 | 3300039453 | Bacteria | 2318 |
| 210 | Ga0439448_0000257 | 3300042005 | Bacteria | 11486 |
| 211 | Ga0439459_0000760 | 3300042438 | Bacteria | 4436 |
| 212 | Ga0466969_0002629 | 3300044656 | Bacteria | 9607 |
| 213 | Ga0453683_0001015 | 3300044673 | Bacteria | 26339 |
| 214 | Ga0466966_0022631 | 3300044684 | Bacteria | 4123 |
| 215 | Ga0453684_0068052 | 3300044712 | Bacteria | 4524 |
| 216 | Ga0466959_0032728 | 3300045049 | Bacteria | 3849 |
| 217 | Ga0451576_0000214 | 3300045051 | Bacteria | 144183 |
| 218 | Ga0451576_0003358 | 3300045051 | Bacteria | 22167 |
| 219 | Ga0451576_0040348 | 3300045051 | Bacteria | 4942 |
| 220 | Ga0451576_0116724 | 3300045051 | Bacteria | 2778 |
| 221 | Ga0495592_0131780 | 3300046454 | Bacteria | 1748 |
| 222 | Ga0495620_0001937 | 3300046515 | Bacteria | 12117 |
| 223 | Ga0495652_0078195 | 3300046529 | Bacteria | 2739 |
| 224 | Ga0495602_0190715 | 3300048088 | Bacteria | 1572 |
| 225 | Ga0496108_0021799 | 3300048911 | Bacteria | 5266 |
| 226 | Ga0496109_0031978 | 3300048912 | Bacteria | 4727 |
| 227 | Ga0496110_0066678 | 3300048913 | Bacteria | 3184 |
| 228 | Ga0496112_0183821 | 3300048915 | Bacteria | 2054 |
| 229 | Ga0496114_0014358 | 3300048917 | Bacteria | 6354 |
| 230 | Ga0496114_0018635 | 3300048917 | Bacteria | 5615 |
| 231 | Ga0501031_0002260 | 3300049568 | Bacteria | 12200 |
| 232 | Ga0501032_0000694 | 3300049569 | Bacteria | 27376 |
| 233 | Ga0501032_0011706 | 3300049569 | Bacteria | 6289 |
| 234 | Ga0501032_0045937 | 3300049569 | Bacteria | 2952 |
| 235 | Ga0501032_0119579 | 3300049569 | Bacteria | 1742 |
| 236 | Ga0501033_0000119 | 3300049570 | Bacteria | 75685 |
| 237 | Ga0501033_0003250 | 3300049570 | Bacteria | 13453 |
| 238 | Ga0501033_0004254 | 3300049570 | Bacteria | 11511 |
| 239 | Ga0501034_0003641 | 3300049571 | Bacteria | 17452 |
| 240 | Ga0501034_0015219 | 3300049571 | Bacteria | 7906 |
| 241 | Ga0501036_0001985 | 3300049572 | Bacteria | 15876 |
| 242 | Ga0501036_0003565 | 3300049572 | Bacteria | 12439 |
| 243 | Ga0501036_0018925 | 3300049572 | Bacteria | 5777 |
| 244 | Ga0501036_0085883 | 3300049572 | Bacteria | 2660 |
| 245 | Ga0501037_0005015 | 3300049573 | Bacteria | 9629 |
| 246 | Ga0501037_0063624 | 3300049573 | Bacteria | 2689 |
| 247 | Ga0501037_0106073 | 3300049573 | Bacteria | 2025 |
| 248 | Ga0501038_0001457 | 3300049574 | Bacteria | 21748 |
| 249 | Ga0501038_0002378 | 3300049574 | Bacteria | 17524 |
| 250 | Ga0501038_0008508 | 3300049574 | Bacteria | 9430 |
| 251 | Ga0501038_0029720 | 3300049574 | Bacteria | 4840 |
| 252 | Ga0501039_0004783 | 3300049575 | Bacteria | 10254 |
| 253 | Ga0501039_0174040 | 3300049575 | Bacteria | 1693 |
| 254 | Ga0501040_0003339 | 3300049576 | Bacteria | 10368 |
| 255 | Ga0501041_0099274 | 3300049577 | Bacteria | 1801 |
| 256 | Ga0501042_0064204 | 3300049578 | Bacteria | 2624 |
| 257 | Ga0501043_0003217 | 3300049579 | Bacteria | 13483 |
| 258 | Ga0501043_0015607 | 3300049579 | Bacteria | 5953 |
| 259 | Ga0501043_0058381 | 3300049579 | Bacteria | 3029 |
| 260 | Ga0501046_0014688 | 3300049580 | Bacteria | 6595 |
| 261 | Ga0501046_0021304 | 3300049580 | Bacteria | 5349 |
| 262 | Ga0501046_0143495 | 3300049580 | Bacteria | 1805 |
| 263 | Ga0501047_0002159 | 3300049581 | Bacteria | 18814 |
| 264 | Ga0501048_0012624 | 3300049582 | Bacteria | 6283 |
| 265 | Ga0501068_0000701 | 3300049584 | Bacteria | 17174 |
| 266 | Ga0501070_0023227 | 3300049586 | Bacteria | 5195 |
| 267 | Ga0501072_0104764 | 3300049588 | Bacteria | 2249 |
| 268 | Ga0501079_0070357 | 3300049741 | Bacteria | 2702 |
| 269 | Ga0501080_0040506 | 3300049742 | Bacteria | 4345 |
| 270 | Ga0501035_0000790 | 3300049822 | Bacteria | 33779 |
| 271 | Ga0501035_0014881 | 3300049822 | Bacteria | 7180 |
| 272 | Ga0501035_0015556 | 3300049822 | Bacteria | 7018 |
| 273 | Ga0501044_0000093 | 3300049823 | Bacteria | 109832 |
| 274 | Ga0501044_0002294 | 3300049823 | Bacteria | 21790 |
| 275 | Ga0501044_0008737 | 3300049823 | Bacteria | 11087 |
| 276 | Ga0501044_0044995 | 3300049823 | Bacteria | 4577 |
| 277 | Ga0501044_0051346 | 3300049823 | Bacteria | 4252 |
| 278 | Ga0501044_0072061 | 3300049823 | Bacteria | 3513 |
| 279 | Ga0501045_0003397 | 3300049824 | Bacteria | 10904 |
| 280 | Ga0501045_0057765 | 3300049824 | Bacteria | 2840 |
| 281 | nmdc:mga05p37_151378_c1 | 3300050507 | Bacteria | 2837 |
| 282 | nmdc:mga05p37_212051_c1 | 3300050507 | Bacteria | 2341 |
| 283 | nmdc:mga05p37_2239_c1 | 3300050507 | Bacteria | 19930 |
| 284 | nmdc:mga05p37_38583_c1 | 3300050507 | Bacteria | 5860 |
| 285 | nmdc:mga05p37_6679_c1 | 3300050507 | Bacteria | 13602 |
| 286 | nmdc:mga05p37_83788_c1 | 3300050507 | Bacteria | 3928 |
| 287 | nmdc:mga09592_120139_c1 | 3300050508 | Bacteria | 2257 |
| 288 | nmdc:mga09592_168716_c1 | 3300050508 | Bacteria | 1892 |
| 289 | nmdc:mga09592_1954_c1 | 3300050508 | Bacteria | 16600 |
| 290 | nmdc:mga09592_21688_c1 | 3300050508 | Bacteria | 5296 |
| 291 | nmdc:mga09592_44802_c1 | 3300050508 | Bacteria | 3725 |
| 292 | nmdc:mga0qj67_157150_c1 | 3300050509 | Bacteria | 1846 |
| 293 | nmdc:mga0qj67_170821_c1 | 3300050509 | Bacteria | 1765 |
| 294 | nmdc:mga0qj67_41198_c1 | 3300050509 | Bacteria | 3632 |
| 295 | nmdc:mga06r32_30007_c1 | 3300050510 | Bacteria | 5100 |
| 296 | nmdc:mga06r32_49309_c1 | 3300050510 | Bacteria | 4026 |
| 297 | nmdc:mga06r32_56023_c1 | 3300050510 | Bacteria | 3783 |
| 298 | nmdc:mga08y16_14448_c1 | 3300050511 | Bacteria | 8305 |
| 299 | nmdc:mga08y16_41466_c1 | 3300050511 | Bacteria | 4822 |
| 300 | nmdc:mga0n895_150459_c1 | 3300050512 | Bacteria | 2358 |
| 301 | nmdc:mga0n895_153902_c1 | 3300050512 | Bacteria | 2330 |
| 302 | nmdc:mga0n895_43960_c1 | 3300050512 | Bacteria | 4356 |
| 303 | nmdc:mga0a205_43086_c1 | 3300050515 | Bacteria | 4351 |
| 304 | nmdc:mga0a205_57675_c1 | 3300050515 | Bacteria | 3749 |
| 305 | Ga0495619_0028614 | 3300053085 | Bacteria | 3596 |
| 306 | Ga0500555_001470 | 3300053103 | Bacteria | 7183 |
| 307 | Ga0500568_0000807 | 3300053139 | Bacteria | 22061 |
| 308 | Ga0500616_0002987 | 3300053153 | Bacteria | 13383 |
| 309 | Ga0501084_0194695 | 3300054114 | Bacteria | 1710 |
| 310 | Ga0587073_0003888 | 3300059492 | Bacteria | 2095 |
| 311 | Ga0501082_0117197 | 3300060353 | Bacteria | 2307 |
| 312 | Ga0530510_0000127 | 3300061734 | Bacteria | 44086 |
| 313 | Ga0530510_0007244 | 3300061734 | Bacteria | 7716 |
| 314 | Ga0530510_0025265 | 3300061734 | Bacteria | 4246 |
| 315 | Ga0530510_0057836 | 3300061734 | Bacteria | 2803 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050508 | nmdc:mga09592_21688_c1 | nmdc:mga09592_21688_c1_3528_5033 | 393 |
| 2 | 3300046454 | Ga0495592_0131780 | Ga0495592_0131780_384_1679 | 399 |
| 3 | 3300049580 | Ga0501046_0143495 | Ga0501046_0143495_81_1460 | 446 |
| 4 | 3300049741 | Ga0501079_0070357 | Ga0501079_0070357_30_1532 | 446 |
| 5 | 3300005841 | Ga0068863_100000892 | Ga0068863_1000008922 | 449 |
| 6 | 3300005843 | Ga0068860_100000930 | Ga0068860_1000009305 | 449 |
| 7 | 3300048088 | Ga0495602_0190715 | Ga0495602_0190715_77_1477 | 449 |
| 8 | 3300049824 | Ga0501045_0057765 | Ga0501045_0057765_51_1439 | 449 |
| 9 | 3300050507 | nmdc:mga05p37_212051_c1 | nmdc:mga05p37_212051_c1_710_2260 | 452 |
| 10 | 3300031251 | Ga0265327_10005122 | Ga0265327_100051225 | 453 |
| 11 | 3300061734 | Ga0530510_0007244 | Ga0530510_0007244_5688_7106 | 455 |
| 12 | iso_pu_bacteria | 2684623219 | 2687234703 | 455 |
| 13 | iso_pu_bacteria | 2684623219 | 2687237532 | 455 |
| 14 | 3300025931 | Ga0207644_10017338 | Ga0207644_100173383 | 457 |
| 15 | 3300005614 | Ga0068856_100006423 | Ga0068856_1000064237 | 460 |
| 16 | 3300013100 | Ga0157373_10059726 | Ga0157373_100597262 | 460 |
| 17 | 3300013105 | Ga0157369_10031105 | Ga0157369_100311056 | 460 |
| 18 | 3300013296 | Ga0157374_10028939 | Ga0157374_100289396 | 460 |
| 19 | 3300013307 | Ga0157372_10044194 | Ga0157372_100441946 | 460 |
| 20 | 3300026078 | Ga0207702_10008530 | Ga0207702_100085306 | 460 |
| 21 | 3300006028 | Ga0070717_10052586 | Ga0070717_100525862 | 461 |
| 22 | 3300050509 | nmdc:mga0qj67_170821_c1 | nmdc:mga0qj67_170821_c1_189_1739 | 464 |
| 23 | 3300049575 | Ga0501039_0174040 | Ga0501039_0174040_21_1523 | 465 |
| 24 | 3300013308 | Ga0157375_10111867 | Ga0157375_101118672 | 466 |
| 25 | 3300048917 | Ga0496114_0014358 | Ga0496114_0014358_2313_3869 | 466 |
| 26 | 3300049571 | Ga0501034_0015219 | Ga0501034_0015219_5056_6678 | 467 |
| 27 | 3300049823 | Ga0501044_0072061 | Ga0501044_0072061_869_2410 | 467 |
| 28 | 3300005355 | Ga0070671_100008471 | Ga0070671_1000084716 | 469 |
| 29 | 3300006871 | Ga0075434_100041384 | Ga0075434_1000413843 | 469 |
| 30 | 3300025941 | Ga0207711_10064774 | Ga0207711_100647742 | 469 |
| 31 | 3300039437 | Ga0436365_0011257 | Ga0436365_0011257_208_1677 | 469 |
| 32 | 3300006844 | Ga0075428_100000801 | Ga0075428_10000080132 | 471 |
| 33 | 3300009094 | Ga0111539_10000901 | Ga0111539_1000090114 | 471 |
| 34 | 3300013104 | Ga0157370_10097253 | Ga0157370_100972532 | 471 |
| 35 | 3300027907 | Ga0207428_10094119 | Ga0207428_100941192 | 471 |
| 36 | 3300050511 | nmdc:mga08y16_41466_c1 | nmdc:mga08y16_41466_c1_3060_4580 | 471 |
| 37 | 3300005564 | Ga0070664_100066825 | Ga0070664_1000668252 | 472 |
| 38 | 3300028381 | Ga0268264_10085901 | Ga0268264_100859011 | 472 |
| 39 | 3300009147 | Ga0114129_10188090 | Ga0114129_101880901 | 473 |
| 40 | 3300050515 | nmdc:mga0a205_57675_c1 | nmdc:mga0a205_57675_c1_1236_2984 | 474 |
| 41 | 3300009147 | Ga0114129_10103907 | Ga0114129_101039072 | 475 |
| 42 | 3300050507 | nmdc:mga05p37_6679_c1 | nmdc:mga05p37_6679_c1_10320_11846 | 475 |
| 43 | 3300050508 | nmdc:mga09592_44802_c1 | nmdc:mga09592_44802_c1_466_1992 | 475 |
| 44 | 3300039450 | Ga0436363_1532402 | Ga0436363_1532402_620_2323 | 476 |
| 45 | 3300050507 | nmdc:mga05p37_151378_c1 | nmdc:mga05p37_151378_c1_501_1991 | 476 |
| 46 | 3300050507 | nmdc:mga05p37_83788_c1 | nmdc:mga05p37_83788_c1_870_2360 | 476 |
| 47 | 3300050508 | nmdc:mga09592_168716_c1 | nmdc:mga09592_168716_c1_230_1720 | 476 |
| 48 | 3300050510 | nmdc:mga06r32_49309_c1 | nmdc:mga06r32_49309_c1_1772_3268 | 476 |
| 49 | 3300050512 | nmdc:mga0n895_43960_c1 | nmdc:mga0n895_43960_c1_2661_4151 | 476 |
| 50 | 3300050515 | nmdc:mga0a205_43086_c1 | nmdc:mga0a205_43086_c1_165_1655 | 476 |
| 51 | 3300039450 | Ga0436363_1179741 | Ga0436363_1179741_9413_10951 | 477 |
| 52 | 3300031251 | Ga0265327_10015607 | Ga0265327_100156072 | 478 |
| 53 | 3300050509 | nmdc:mga0qj67_157150_c1 | nmdc:mga0qj67_157150_c1_221_1726 | 478 |
| 54 | 3300061734 | Ga0530510_0057836 | Ga0530510_0057836_1086_2600 | 478 |
| 55 | 3300005436 | Ga0070713_100200018 | Ga0070713_1002000181 | 479 |
| 56 | 3300005985 | Ga0081539_10043111 | Ga0081539_100431112 | 479 |
| 57 | 3300039438 | Ga0436360_1001598 | Ga0436360_1001598_15_1529 | 479 |
| 58 | iso_pu_bacteria | 8001522603 | 8001525579 | 479 |
| 59 | 3300014968 | Ga0157379_10008802 | Ga0157379_100088026 | 480 |
| 60 | 3300025928 | Ga0207700_10150004 | Ga0207700_101500041 | 480 |
| 61 | 3300060353 | Ga0501082_0117197 | Ga0501082_0117197_81_1649 | 480 |
| 62 | 3300005539 | Ga0068853_100007983 | Ga0068853_1000079832 | 481 |
| 63 | 3300005937 | Ga0081455_10018410 | Ga0081455_100184109 | 481 |
| 64 | 3300005981 | Ga0081538_10036357 | Ga0081538_100363573 | 481 |
| 65 | 3300006846 | Ga0075430_100038678 | Ga0075430_1000386784 | 481 |
| 66 | 3300006847 | Ga0075431_100011686 | Ga0075431_1000116864 | 481 |
| 67 | 3300013307 | Ga0157372_10161910 | Ga0157372_101619101 | 481 |
| 68 | 3300026041 | Ga0207639_10014920 | Ga0207639_100149208 | 481 |
| 69 | 3300031730 | Ga0307516_10000779 | Ga0307516_1000077926 | 481 |
| 70 | 3300005539 | Ga0068853_100000062 | Ga0068853_10000006240 | 482 |
| 71 | 3300007265 | Ga0099794_10012554 | Ga0099794_100125542 | 482 |
| 72 | 3300009177 | Ga0105248_10024202 | Ga0105248_100242023 | 482 |
| 73 | 3300025941 | Ga0207711_10103080 | Ga0207711_101030801 | 482 |
| 74 | 3300026041 | Ga0207639_10000053 | Ga0207639_1000005314 | 482 |
| 75 | 3300046529 | Ga0495652_0078195 | Ga0495652_0078195_683_2221 | 482 |
| 76 | 3300009545 | Ga0105237_10025885 | Ga0105237_100258853 | 483 |
| 77 | 3300013102 | Ga0157371_10052169 | Ga0157371_100521692 | 483 |
| 78 | 3300013307 | Ga0157372_10063265 | Ga0157372_100632651 | 483 |
| 79 | 3300025937 | Ga0207669_10004980 | Ga0207669_100049802 | 483 |
| 80 | 3300025940 | Ga0207691_10051213 | Ga0207691_100512132 | 483 |
| 81 | 3300045051 | Ga0451576_0040348 | Ga0451576_0040348_2690_4207 | 483 |
| 82 | 3300061734 | Ga0530510_0000127 | Ga0530510_0000127_2313_3818 | 483 |
| 83 | 3300009093 | Ga0105240_10004053 | Ga0105240_100040538 | 484 |
| 84 | 3300009094 | Ga0111539_10223811 | Ga0111539_102238111 | 484 |
| 85 | 3300009147 | Ga0114129_10000414 | Ga0114129_1000041454 | 484 |
| 86 | 3300010375 | Ga0105239_10026994 | Ga0105239_100269944 | 484 |
| 87 | 3300025913 | Ga0207695_10000436 | Ga0207695_1000043677 | 484 |
| 88 | 3300050507 | nmdc:mga05p37_2239_c1 | nmdc:mga05p37_2239_c1_2812_4314 | 484 |
| 89 | 3300061734 | Ga0530510_0025265 | Ga0530510_0025265_146_1690 | 484 |
| 90 | 3300013104 | Ga0157370_10215171 | Ga0157370_102151712 | 485 |
| 91 | 3300049569 | Ga0501032_0119579 | Ga0501032_0119579_161_1678 | 485 |
| 92 | 3300049573 | Ga0501037_0063624 | Ga0501037_0063624_108_1625 | 485 |
| 93 | 3300049574 | Ga0501038_0029720 | Ga0501038_0029720_143_1660 | 485 |
| 94 | 3300049579 | Ga0501043_0058381 | Ga0501043_0058381_436_1953 | 485 |
| 95 | 3300049581 | Ga0501047_0002159 | Ga0501047_0002159_8005_9522 | 485 |
| 96 | 3300049586 | Ga0501070_0023227 | Ga0501070_0023227_1367_2884 | 485 |
| 97 | 3300049823 | Ga0501044_0044995 | Ga0501044_0044995_100_1617 | 485 |
| 98 | 3300053085 | Ga0495619_0028614 | Ga0495619_0028614_265_1845 | 485 |
| 99 | 3300053103 | Ga0500555_001470 | Ga0500555_001470_3589_5139 | 485 |
| 100 | 3300053139 | Ga0500568_0000807 | Ga0500568_0000807_2164_3708 | 485 |
| 101 | 3300054114 | Ga0501084_0194695 | Ga0501084_0194695_118_1662 | 485 |
| 102 | 3300059492 | Ga0587073_0003888 | Ga0587073_0003888_82_1611 | 485 |
| 103 | 3300005339 | Ga0070660_100036842 | Ga0070660_1000368422 | 486 |
| 104 | 3300005354 | Ga0070675_100001385 | Ga0070675_10000138511 | 486 |
| 105 | 3300005364 | Ga0070673_100029669 | Ga0070673_1000296692 | 486 |
| 106 | 3300005367 | Ga0070667_100022937 | Ga0070667_1000229375 | 486 |
| 107 | 3300005458 | Ga0070681_10004719 | Ga0070681_100047193 | 486 |
| 108 | 3300005564 | Ga0070664_100165339 | Ga0070664_1001653391 | 486 |
| 109 | 3300005617 | Ga0068859_100010377 | Ga0068859_1000103775 | 486 |
| 110 | 3300006237 | Ga0097621_100021659 | Ga0097621_1000216592 | 486 |
| 111 | 3300006880 | Ga0075429_100045570 | Ga0075429_1000455702 | 486 |
| 112 | 3300006931 | Ga0097620_100010377 | Ga0097620_1000103775 | 486 |
| 113 | 3300009177 | Ga0105248_10075779 | Ga0105248_100757792 | 486 |
| 114 | 3300009177 | Ga0105248_10085539 | Ga0105248_100855393 | 486 |
| 115 | 3300013306 | Ga0163162_10005755 | Ga0163162_100057551 | 486 |
| 116 | 3300013308 | Ga0157375_10009126 | Ga0157375_100091265 | 486 |
| 117 | 3300014325 | Ga0163163_10008946 | Ga0163163_100089464 | 486 |
| 118 | 3300014968 | Ga0157379_10003537 | Ga0157379_100035375 | 486 |
| 119 | 3300020080 | Ga0206350_10263449 | Ga0206350_102634491 | 486 |
| 120 | 3300025914 | Ga0207671_10040355 | Ga0207671_100403551 | 486 |
| 121 | 3300025931 | Ga0207644_10008574 | Ga0207644_100085745 | 486 |
| 122 | 3300026088 | Ga0207641_10081046 | Ga0207641_100810462 | 486 |
| 123 | 3300026116 | Ga0207674_10090936 | Ga0207674_100909364 | 486 |
| 124 | 3300044656 | Ga0466969_0002629 | Ga0466969_0002629_3496_5052 | 486 |
| 125 | 3300044684 | Ga0466966_0022631 | Ga0466966_0022631_198_1754 | 486 |
| 126 | 3300045049 | Ga0466959_0032728 | Ga0466959_0032728_1848_3404 | 486 |
| 127 | 3300046515 | Ga0495620_0001937 | Ga0495620_0001937_10384_11919 | 486 |
| 128 | 3300048915 | Ga0496112_0183821 | Ga0496112_0183821_141_1889 | 486 |
| 129 | 3300004803 | Ga0058862_12829385 | Ga0058862_128293852 | 487 |
| 130 | 3300005331 | Ga0070670_100047928 | Ga0070670_1000479282 | 487 |
| 131 | 3300005354 | Ga0070675_100017214 | Ga0070675_1000172146 | 487 |
| 132 | 3300005468 | Ga0070707_100030018 | Ga0070707_1000300185 | 487 |
| 133 | 3300005543 | Ga0070672_100102043 | Ga0070672_1001020432 | 487 |
| 134 | 3300006173 | Ga0070716_100071959 | Ga0070716_1000719591 | 487 |
| 135 | 3300009094 | Ga0111539_10020636 | Ga0111539_100206367 | 487 |
| 136 | 3300013307 | Ga0157372_10279189 | Ga0157372_102791891 | 487 |
| 137 | 3300020069 | Ga0197907_11114090 | Ga0197907_111140901 | 487 |
| 138 | 3300020070 | Ga0206356_11859015 | Ga0206356_118590153 | 487 |
| 139 | 3300020078 | Ga0206352_10095980 | Ga0206352_100959801 | 487 |
| 140 | 3300021384 | Ga0213876_10011490 | Ga0213876_100114904 | 487 |
| 141 | 3300021388 | Ga0213875_10008913 | Ga0213875_100089132 | 487 |
| 142 | 3300022467 | Ga0224712_10009151 | Ga0224712_100091513 | 487 |
| 143 | 3300022467 | Ga0224712_10032823 | Ga0224712_100328231 | 487 |
| 144 | 3300022467 | Ga0224712_10038647 | Ga0224712_100386471 | 487 |
| 145 | 3300025915 | Ga0207693_10073211 | Ga0207693_100732112 | 487 |
| 146 | 3300025922 | Ga0207646_10016373 | Ga0207646_100163732 | 487 |
| 147 | 3300025926 | Ga0207659_10121733 | Ga0207659_101217331 | 487 |
| 148 | 3300025931 | Ga0207644_10165464 | Ga0207644_101654641 | 487 |
| 149 | 3300035111 | Ga0373923_0013673 | Ga0373923_0013673_1082_2644 | 487 |
| 150 | 3300035118 | Ga0373954_0004461 | Ga0373954_0004461_4411_5973 | 487 |
| 151 | 3300036401 | Ga0373937_0009399 | Ga0373937_0009399_4274_5836 | 487 |
| 152 | 3300036401 | Ga0373937_0101419 | Ga0373937_0101419_891_2408 | 487 |
| 153 | 3300037853 | Ga0436364_0996625 | Ga0436364_0996625_528_2084 | 487 |
| 154 | 3300039437 | Ga0436365_1610796 | Ga0436365_1610796_3980_5518 | 487 |
| 155 | 3300044673 | Ga0453683_0001015 | Ga0453683_0001015_17808_19340 | 487 |
| 156 | 3300049572 | Ga0501036_0085883 | Ga0501036_0085883_34_1602 | 487 |
| 157 | 3300049577 | Ga0501041_0099274 | Ga0501041_0099274_124_1692 | 487 |
| 158 | 3300049742 | Ga0501080_0040506 | Ga0501080_0040506_2351_3967 | 487 |
| 159 | 3300050508 | nmdc:mga09592_120139_c1 | nmdc:mga09592_120139_c1_36_1538 | 487 |
| 160 | 3300050510 | nmdc:mga06r32_30007_c1 | nmdc:mga06r32_30007_c1_821_2323 | 487 |
| 161 | 3300050511 | nmdc:mga08y16_14448_c1 | nmdc:mga08y16_14448_c1_5020_6561 | 487 |
| 162 | 3300053153 | Ga0500616_0002987 | Ga0500616_0002987_2652_4175 | 487 |
| 163 | 3300005563 | Ga0068855_100000294 | Ga0068855_1000002947 | 488 |
| 164 | 3300005617 | Ga0068859_100046774 | Ga0068859_1000467742 | 488 |
| 165 | 3300005985 | Ga0081539_10018712 | Ga0081539_100187123 | 488 |
| 166 | 3300006844 | Ga0075428_100041688 | Ga0075428_1000416883 | 488 |
| 167 | 3300006846 | Ga0075430_100001122 | Ga0075430_10000112216 | 488 |
| 168 | 3300006880 | Ga0075429_100001140 | Ga0075429_10000114010 | 488 |
| 169 | 3300006931 | Ga0097620_100046774 | Ga0097620_1000467742 | 488 |
| 170 | 3300020080 | Ga0206350_11013479 | Ga0206350_110134792 | 488 |
| 171 | 3300025926 | Ga0207659_10002561 | Ga0207659_1000256112 | 488 |
| 172 | 3300025949 | Ga0207667_10000787 | Ga0207667_1000078728 | 488 |
| 173 | 3300039437 | Ga0436365_0477873 | Ga0436365_0477873_40_1590 | 488 |
| 174 | 3300049568 | Ga0501031_0002260 | Ga0501031_0002260_7633_9186 | 488 |
| 175 | 3300049569 | Ga0501032_0000694 | Ga0501032_0000694_22749_24302 | 488 |
| 176 | 3300049569 | Ga0501032_0011706 | Ga0501032_0011706_3201_4754 | 488 |
| 177 | 3300049569 | Ga0501032_0045937 | Ga0501032_0045937_1145_2785 | 488 |
| 178 | 3300049570 | Ga0501033_0003250 | Ga0501033_0003250_4628_6181 | 488 |
| 179 | 3300049570 | Ga0501033_0004254 | Ga0501033_0004254_7090_8643 | 488 |
| 180 | 3300049571 | Ga0501034_0003641 | Ga0501034_0003641_2653_4206 | 488 |
| 181 | 3300049572 | Ga0501036_0001985 | Ga0501036_0001985_3120_4673 | 488 |
| 182 | 3300049572 | Ga0501036_0018925 | Ga0501036_0018925_1806_3359 | 488 |
| 183 | 3300049573 | Ga0501037_0005015 | Ga0501037_0005015_2680_4233 | 488 |
| 184 | 3300049573 | Ga0501037_0106073 | Ga0501037_0106073_231_1784 | 488 |
| 185 | 3300049574 | Ga0501038_0001457 | Ga0501038_0001457_3094_4647 | 488 |
| 186 | 3300049574 | Ga0501038_0008508 | Ga0501038_0008508_4249_5802 | 488 |
| 187 | 3300049575 | Ga0501039_0004783 | Ga0501039_0004783_128_1681 | 488 |
| 188 | 3300049576 | Ga0501040_0003339 | Ga0501040_0003339_6163_7716 | 488 |
| 189 | 3300049578 | Ga0501042_0064204 | Ga0501042_0064204_81_1625 | 488 |
| 190 | 3300049579 | Ga0501043_0003217 | Ga0501043_0003217_3075_4628 | 488 |
| 191 | 3300049579 | Ga0501043_0015607 | Ga0501043_0015607_714_2267 | 488 |
| 192 | 3300049580 | Ga0501046_0014688 | Ga0501046_0014688_1292_2845 | 488 |
| 193 | 3300049580 | Ga0501046_0021304 | Ga0501046_0021304_518_2071 | 488 |
| 194 | 3300049582 | Ga0501048_0012624 | Ga0501048_0012624_2006_3559 | 488 |
| 195 | 3300049584 | Ga0501068_0000701 | Ga0501068_0000701_10467_12020 | 488 |
| 196 | 3300049588 | Ga0501072_0104764 | Ga0501072_0104764_681_2234 | 488 |
| 197 | 3300049822 | Ga0501035_0000790 | Ga0501035_0000790_6673_8226 | 488 |
| 198 | 3300049822 | Ga0501035_0015556 | Ga0501035_0015556_2786_4339 | 488 |
| 199 | 3300049823 | Ga0501044_0002294 | Ga0501044_0002294_17163_18716 | 488 |
| 200 | 3300049823 | Ga0501044_0051346 | Ga0501044_0051346_1717_3270 | 488 |
| 201 | 3300049824 | Ga0501045_0003397 | Ga0501045_0003397_2786_4339 | 488 |
| 202 | 3300050508 | nmdc:mga09592_1954_c1 | nmdc:mga09592_1954_c1_8517_10037 | 488 |
| 203 | 3300050509 | nmdc:mga0qj67_41198_c1 | nmdc:mga0qj67_41198_c1_600_2120 | 488 |
| 204 | 3300050510 | nmdc:mga06r32_56023_c1 | nmdc:mga06r32_56023_c1_751_2271 | 488 |
| 205 | iso_pu_bacteria | 2889415604 | 2889420015 | 488 |
| 206 | 3300003203 | JGI25406J46586_10026262 | JGI25406J46586_100262622 | 489 |
| 207 | 3300005435 | Ga0070714_100098508 | Ga0070714_1000985082 | 489 |
| 208 | 3300005456 | Ga0070678_100155804 | Ga0070678_1001558041 | 489 |
| 209 | 3300005985 | Ga0081539_10009382 | Ga0081539_100093823 | 489 |
| 210 | 3300013104 | Ga0157370_10021825 | Ga0157370_100218252 | 489 |
| 211 | 3300021384 | Ga0213876_10077713 | Ga0213876_100777132 | 489 |
| 212 | 3300037471 | Ga0395905_0026019 | Ga0395905_0026019_465_1979 | 489 |
| 213 | 3300048911 | Ga0496108_0021799 | Ga0496108_0021799_3436_4986 | 489 |
| 214 | 3300048912 | Ga0496109_0031978 | Ga0496109_0031978_2598_4148 | 489 |
| 215 | 3300048917 | Ga0496114_0018635 | Ga0496114_0018635_591_2141 | 489 |
| 216 | 3300049570 | Ga0501033_0000119 | Ga0501033_0000119_52616_54172 | 489 |
| 217 | 3300049572 | Ga0501036_0003565 | Ga0501036_0003565_3543_5099 | 489 |
| 218 | 3300049574 | Ga0501038_0002378 | Ga0501038_0002378_13595_15151 | 489 |
| 219 | 3300049822 | Ga0501035_0014881 | Ga0501035_0014881_4645_6201 | 489 |
| 220 | 3300049823 | Ga0501044_0000093 | Ga0501044_0000093_65338_66894 | 489 |
| 221 | 3300049823 | Ga0501044_0008737 | Ga0501044_0008737_6076_7632 | 489 |
| 222 | 3300003349 | JGI26129J50193_1001425 | JGI26129J50193_10014251 | 490 |
| 223 | 3300005328 | Ga0070676_10001273 | Ga0070676_100012737 | 490 |
| 224 | 3300005331 | Ga0070670_100009839 | Ga0070670_1000098394 | 490 |
| 225 | 3300005334 | Ga0068869_100017210 | Ga0068869_1000172103 | 490 |
| 226 | 3300005336 | Ga0070680_100028522 | Ga0070680_1000285223 | 490 |
| 227 | 3300005337 | Ga0070682_100001964 | Ga0070682_1000019642 | 490 |
| 228 | 3300005339 | Ga0070660_100001376 | Ga0070660_1000013765 | 490 |
| 229 | 3300005340 | Ga0070689_100085284 | Ga0070689_1000852842 | 490 |
| 230 | 3300005345 | Ga0070692_10001557 | Ga0070692_100015577 | 490 |
| 231 | 3300005353 | Ga0070669_100071961 | Ga0070669_1000719612 | 490 |
| 232 | 3300005354 | Ga0070675_100096807 | Ga0070675_1000968071 | 490 |
| 233 | 3300005366 | Ga0070659_100002197 | Ga0070659_1000021977 | 490 |
| 234 | 3300005406 | Ga0070703_10002306 | Ga0070703_100023066 | 490 |
| 235 | 3300005438 | Ga0070701_10054785 | Ga0070701_100547852 | 490 |
| 236 | 3300005455 | Ga0070663_100000406 | Ga0070663_10000040620 | 490 |
| 237 | 3300005467 | Ga0070706_100034431 | Ga0070706_1000344312 | 490 |
| 238 | 3300005467 | Ga0070706_100064422 | Ga0070706_1000644221 | 490 |
| 239 | 3300005536 | Ga0070697_100002248 | Ga0070697_1000022483 | 490 |
| 240 | 3300005539 | Ga0068853_100102991 | Ga0068853_1001029912 | 490 |
| 241 | 3300005545 | Ga0070695_100005982 | Ga0070695_1000059826 | 490 |
| 242 | 3300005547 | Ga0070693_100001093 | Ga0070693_1000010936 | 490 |
| 243 | 3300005549 | Ga0070704_100004628 | Ga0070704_1000046282 | 490 |
| 244 | 3300005563 | Ga0068855_100062410 | Ga0068855_1000624103 | 490 |
| 245 | 3300005577 | Ga0068857_100040911 | Ga0068857_1000409114 | 490 |
| 246 | 3300005578 | Ga0068854_100015131 | Ga0068854_1000151314 | 490 |
| 247 | 3300005614 | Ga0068856_100019239 | Ga0068856_1000192397 | 490 |
| 248 | 3300005616 | Ga0068852_100121644 | Ga0068852_1001216441 | 490 |
| 249 | 3300005844 | Ga0068862_100026895 | Ga0068862_1000268953 | 490 |
| 250 | 3300005981 | Ga0081538_10008237 | Ga0081538_100082372 | 490 |
| 251 | 3300006844 | Ga0075428_100002581 | Ga0075428_10000258112 | 490 |
| 252 | 3300006847 | Ga0075431_100026767 | Ga0075431_1000267673 | 490 |
| 253 | 3300006852 | Ga0075433_10143571 | Ga0075433_101435712 | 490 |
| 254 | 3300006880 | Ga0075429_100139503 | Ga0075429_1001395032 | 490 |
| 255 | 3300007076 | Ga0075435_100106163 | Ga0075435_1001061631 | 490 |
| 256 | 3300007265 | Ga0099794_10002147 | Ga0099794_100021473 | 490 |
| 257 | 3300009545 | Ga0105237_10045954 | Ga0105237_100459545 | 490 |
| 258 | 3300011119 | Ga0105246_10019379 | Ga0105246_100193793 | 490 |
| 259 | 3300013104 | Ga0157370_10012606 | Ga0157370_100126063 | 490 |
| 260 | 3300013306 | Ga0163162_10020605 | Ga0163162_100206053 | 490 |
| 261 | 3300013307 | Ga0157372_10030475 | Ga0157372_100304755 | 490 |
| 262 | 3300013307 | Ga0157372_10082732 | Ga0157372_100827322 | 490 |
| 263 | 3300025885 | Ga0207653_10001805 | Ga0207653_100018056 | 490 |
| 264 | 3300025901 | Ga0207688_10030976 | Ga0207688_100309764 | 490 |
| 265 | 3300025907 | Ga0207645_10000582 | Ga0207645_1000058226 | 490 |
| 266 | 3300025908 | Ga0207643_10003639 | Ga0207643_100036395 | 490 |
| 267 | 3300025910 | Ga0207684_10085641 | Ga0207684_100856412 | 490 |
| 268 | 3300025914 | Ga0207671_10035174 | Ga0207671_100351744 | 490 |
| 269 | 3300025917 | Ga0207660_10000220 | Ga0207660_100002202 | 490 |
| 270 | 3300025919 | Ga0207657_10000730 | Ga0207657_1000073027 | 490 |
| 271 | 3300025920 | Ga0207649_10049325 | Ga0207649_100493252 | 490 |
| 272 | 3300025921 | Ga0207652_10059041 | Ga0207652_100590413 | 490 |
| 273 | 3300025922 | Ga0207646_10130279 | Ga0207646_101302792 | 490 |
| 274 | 3300025923 | Ga0207681_10028885 | Ga0207681_100288852 | 490 |
| 275 | 3300025926 | Ga0207659_10074807 | Ga0207659_100748072 | 490 |
| 276 | 3300025933 | Ga0207706_10005515 | Ga0207706_1000551511 | 490 |
| 277 | 3300025942 | Ga0207689_10000846 | Ga0207689_1000084626 | 490 |
| 278 | 3300025944 | Ga0207661_10235233 | Ga0207661_102352331 | 490 |
| 279 | 3300025945 | Ga0207679_10036638 | Ga0207679_100366383 | 490 |
| 280 | 3300025949 | Ga0207667_10086584 | Ga0207667_100865842 | 490 |
| 281 | 3300026078 | Ga0207702_10006797 | Ga0207702_100067975 | 490 |
| 282 | 3300026095 | Ga0207676_10010320 | Ga0207676_100103205 | 490 |
| 283 | 3300026116 | Ga0207674_10052804 | Ga0207674_100528041 | 490 |
| 284 | 3300027471 | Ga0209995_1000192 | Ga0209995_10001925 | 490 |
| 285 | 3300027614 | Ga0209970_1001750 | Ga0209970_10017502 | 490 |
| 286 | 3300027671 | Ga0209588_1000155 | Ga0209588_10001553 | 490 |
| 287 | 3300027671 | Ga0209588_1006813 | Ga0209588_10068132 | 490 |
| 288 | 3300027682 | Ga0209971_1000008 | Ga0209971_100000841 | 490 |
| 289 | 3300027695 | Ga0209966_1000290 | Ga0209966_10002906 | 490 |
| 290 | 3300027717 | Ga0209998_10000016 | Ga0209998_1000001661 | 490 |
| 291 | 3300027876 | Ga0209974_10000073 | Ga0209974_100000738 | 490 |
| 292 | 3300028380 | Ga0268265_10024994 | Ga0268265_100249942 | 490 |
| 293 | 3300031548 | Ga0307408_100011415 | Ga0307408_1000114156 | 490 |
| 294 | 3300031824 | Ga0307413_10011204 | Ga0307413_100112043 | 490 |
| 295 | 3300031852 | Ga0307410_10042107 | Ga0307410_100421073 | 490 |
| 296 | 3300031995 | Ga0307409_100007643 | Ga0307409_1000076436 | 490 |
| 297 | 3300032002 | Ga0307416_100008071 | Ga0307416_1000080716 | 490 |
| 298 | 3300032002 | Ga0307416_100015547 | Ga0307416_1000155474 | 490 |
| 299 | 3300032002 | Ga0307416_100018089 | Ga0307416_1000180894 | 490 |
| 300 | 3300032005 | Ga0307411_10035141 | Ga0307411_100351411 | 490 |
| 301 | 3300032126 | Ga0307415_100006644 | Ga0307415_1000066441 | 490 |
| 302 | 3300035115 | Ga0373941_0007363 | Ga0373941_0007363_767_2308 | 490 |
| 303 | 3300039453 | Ga0436362_0702035 | Ga0436362_0702035_614_2173 | 490 |
| 304 | 3300042005 | Ga0439448_0000257 | Ga0439448_0000257_2431_3972 | 490 |
| 305 | 3300042438 | Ga0439459_0000760 | Ga0439459_0000760_1550_3091 | 490 |
| 306 | 3300044712 | Ga0453684_0068052 | Ga0453684_0068052_2853_4394 | 490 |
| 307 | 3300045051 | Ga0451576_0116724 | Ga0451576_0116724_1111_2652 | 490 |
| 308 | 3300048913 | Ga0496110_0066678 | Ga0496110_0066678_679_2220 | 490 |
| 309 | 3300050512 | nmdc:mga0n895_150459_c1 | nmdc:mga0n895_150459_c1_409_1950 | 490 |
| 310 | 3300006844 | Ga0075428_100077538 | Ga0075428_1000775383 | 491 |
| 311 | 3300006847 | Ga0075431_100045887 | Ga0075431_1000458872 | 491 |
| 312 | 3300006880 | Ga0075429_100100618 | Ga0075429_1001006182 | 491 |
| 313 | 3300009147 | Ga0114129_10015155 | Ga0114129_1001515513 | 491 |
| 314 | 3300045051 | Ga0451576_0000214 | Ga0451576_0000214_58676_60256 | 491 |
| 315 | 3300045051 | Ga0451576_0003358 | Ga0451576_0003358_9052_10632 | 491 |
| 316 | 3300050507 | nmdc:mga05p37_38583_c1 | nmdc:mga05p37_38583_c1_64_1578 | 491 |
| 317 | 3300050512 | nmdc:mga0n895_153902_c1 | nmdc:mga0n895_153902_c1_767_2281 | 491 |
| 318 | 3300003203 | JGI25406J46586_10017637 | JGI25406J46586_100176372 | 492 |
| 319 | 3300005985 | Ga0081539_10000083 | Ga0081539_1000008355 | 492 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5c2w-assembly1.cif.gz_F | kuenenia stuttgartiensis hydrazine synthase pressurized with 20 bar xenon | 0.5818 | 354 | 489 |
| 2vhd-assembly1.cif.gz_B | crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form | 0.5699 | 341 | 489 |
| 3o5c-assembly2.cif.gz_D | cytochrome c peroxidase bccp of shewanella oneidensis | 0.563 | 335 | 488 |
| 3o5c-assembly2.cif.gz_C | cytochrome c peroxidase bccp of shewanella oneidensis | 0.5556 | 335 | 488 |
| 6e1c-assembly2.cif.gz_B | crystal structure of a maug-like protein associated with microbial copper homeostasis | 0.4355 | 201 | 489 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o5cC01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6099 | 377 | 488 | 1.10.760.10 |
| 3o5cC01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.4692 | 377 | 488 | 1.10.760.10 |
| af_Q95XQ4_532_917_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3138 | 323 | 366 | 1.25.10.10 |
| af_A0A0P0WSN8_58_197_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.2952 | 82 | 130 | 3.40.630.10 |
| af_P76578_1172_1439_1.50.10.20 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.1457 | 344 | 488 | 1.50.10.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538S2C5-F1-model_v4 | Cytochrome c domain-containing protein | 0.8603 | 371 | 489 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A436CJG0-F1-model_v4 | Cytochrome B6 | 0.837 | 365 | 489 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-Q0AGF7-F1-model_v4 | Cytochrome c peroxidase | 0.8327 | 81 | 489 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-Q0AGF7-F1-model_v4 | Cytochrome c peroxidase | 0.831 | 81 | 489 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A2G2MAJ6-F1-model_v4 | Cytochrome B6 | 0.812 | 68 | 489 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar