F404980

General Info

Members Datasets Scaffolds Average Seq Length
319 202 315 400

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100000751|Ga0070707_1000007515
Length 433
Sequence MPRQSFLLTITATLLLLATGIASSLTQPLAVVAQRTVSSGEIYYPGPGENWERRTPQQVGMDPGRLNEAMAFALAHEAKEPRDLELAHYQSFGREPFGDGVGPFRERGAPTGLILRRGYLVAEWGDPQRVDMTFSVTKSFLSSTVGLAYDRGLIRSLQDRVRDYMAPVVALAPDFRKNRAERLGESELLQPFETEHNRKITWDHLLRQTSDWEGTLWGKPDWADRPSNNPAEWRTRQRHEPGTIYKYNDVRVNALALAALNVWRRPLPQVLKEYVMDPIGASPTWRWYGYENSWVLIDGVAVQSVSGGGHWGGGMFISARDQARFGYLTLRRGKWKDRQILSEAWVRMALTPTPVQTTYGFMNWFLNTDRQLLPSAPAAAFAHLGNGTNMIYVDPEHDLVVVARWIERNAIDGLVQRVLTALASPPQSSQRRN

Samples

Sample ID Description Type Environment
1 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
2 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
3 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
197 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 0.63
Rhizoplane 1.57
Rhizosphere 83.39
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000001 3300002738 Bacteria 483450
2 JGI25153J46596_10000204 3300003215 Bacteria 54445
3 rootH1_10045256 3300003323 Bacteria 6148
4 rootH1_10096149 3300003323 Bacteria 5543
5 JGI25160J50197_1009023 3300003354 Unclassified 3739
6 Ga0055531_10000418 3300003794 Bacteria 40440
7 Ga0065165_1000473 3300005262 Bacteria 62722
8 Ga0065165_1001823 3300005262 Bacteria 20859
9 Ga0065712_10132503 3300005290 Unclassified 1533
10 Ga0070658_10008233 3300005327 Bacteria 8386
11 Ga0070658_10032869 3300005327 Bacteria 4171
12 Ga0070676_10116870 3300005328 Bacteria 1669
13 Ga0070683_100064020 3300005329 Unclassified 3422
14 Ga0070683_100086846 3300005329 Bacteria 2933
15 Ga0070670_100047919 3300005331 Unclassified 3678
16 Ga0070670_100063963 3300005331 Bacteria 3156
17 Ga0068869_100014723 3300005334 Bacteria 5231
18 Ga0070680_100176986 3300005336 Bacteria 1796
19 Ga0070689_100079593 3300005340 Bacteria 2571
20 Ga0070661_100030693 3300005344 Unclassified 3883
21 Ga0070668_100017813 3300005347 Bacteria 5327
22 Ga0070671_100107334 3300005355 Unclassified 2344
23 Ga0070674_100150110 3300005356 Bacteria 1758
24 Ga0070667_100057576 3300005367 Bacteria 3286
25 Ga0070667_100143441 3300005367 Bacteria 2093
26 Ga0070711_100106971 3300005439 Bacteria 2046
27 Ga0070705_100008518 3300005440 Bacteria 5080
28 Ga0070694_100019059 3300005444 Bacteria 4361
29 Ga0070708_100110846 3300005445 Bacteria 2522
30 Ga0070678_100017127 3300005456 Bacteria 4656
31 Ga0070662_100000442 3300005457 Bacteria 24498
32 Ga0070681_10022700 3300005458 Bacteria 6304
33 Ga0070681_10060667 3300005458 Bacteria 3758
34 Ga0070685_10001717 3300005466 Bacteria 11501
35 Ga0070707_100000751 3300005468 Bacteria 31983
36 Ga0070707_100003317 3300005468 Bacteria 15200
37 Ga0070698_100008092 3300005471 Bacteria 11370
38 Ga0070699_100000868 3300005518 Bacteria 28150
39 Ga0070699_100022576 3300005518 Bacteria 5423
40 Ga0070679_100022932 3300005530 Bacteria 6105
41 Ga0070679_100025791 3300005530 Bacteria 5769
42 Ga0070684_100066522 3300005535 Bacteria 3164
43 Ga0070697_100054032 3300005536 Bacteria 3264
44 Ga0070697_100101290 3300005536 Bacteria 2393
45 Ga0070697_100152478 3300005536 Bacteria 1948
46 Ga0070697_100357857 3300005536 Bacteria 1262
47 Ga0068853_100031045 3300005539 Bacteria 4517
48 Ga0068853_100121669 3300005539 Bacteria 2329
49 Ga0070672_100054224 3300005543 Bacteria 3138
50 Ga0070672_100256887 3300005543 Bacteria 1473
51 Ga0070686_100000079 3300005544 Bacteria 70778
52 Ga0070686_100011688 3300005544 Bacteria 4988
53 Ga0070695_100048905 3300005545 Bacteria 2706
54 Ga0070696_100007044 3300005546 Bacteria 7505
55 Ga0070665_100036080 3300005548 Bacteria 4975
56 Ga0070704_100049847 3300005549 Bacteria 2939
57 Ga0068855_100090547 3300005563 Bacteria 3530
58 Ga0070664_100005552 3300005564 Bacteria 10130
59 Ga0070664_100099519 3300005564 Bacteria 2527
60 Ga0068854_100015259 3300005578 Bacteria 5085
61 Ga0070702_100030570 3300005615 Bacteria 2937
62 Ga0068852_100038849 3300005616 Bacteria 4004
63 Ga0068852_100040269 3300005616 Bacteria 3941
64 Ga0068852_100086013 3300005616 Bacteria 2802
65 Ga0068852_100137201 3300005616 Bacteria 2259
66 Ga0068864_100083083 3300005618 Unclassified 2812
67 Ga0068861_100047384 3300005719 Bacteria 3244
68 Ga0068851_10036502 3300005834 Bacteria 2460
69 Ga0068863_100306907 3300005841 Bacteria 1540
70 Ga0081455_10009182 3300005937 Bacteria 10191
71 Ga0081455_10029988 3300005937 Unclassified 4950
72 Ga0081539_10000117 3300005985 Bacteria 185868
73 Ga0070716_100024457 3300006173 Bacteria 3215
74 Ga0070716_100127556 3300006173 Unclassified 1603
75 Ga0097621_100041684 3300006237 Bacteria 3696
76 Ga0097621_100063718 3300006237 Bacteria 3030
77 Ga0075428_100001150 3300006844 Bacteria 28261
78 Ga0075428_100002960 3300006844 Bacteria 18524
79 Ga0075428_100029163 3300006844 Bacteria 6106
80 Ga0075428_100280922 3300006844 Bacteria 1791
81 Ga0075430_100008469 3300006846 Bacteria 8689
82 Ga0075430_100031405 3300006846 Bacteria 4507
83 Ga0075430_100111654 3300006846 Bacteria 2279
84 Ga0075430_100155578 3300006846 Bacteria 1903
85 Ga0075430_100243085 3300006846 Bacteria 1491
86 Ga0075431_100001045 3300006847 Bacteria 24701
87 Ga0075431_100018320 3300006847 Bacteria 7128
88 Ga0075431_100108547 3300006847 Bacteria 2864
89 Ga0075433_10024618 3300006852 Bacteria 5084
90 Ga0075433_10069272 3300006852 Bacteria 3098
91 Ga0075434_100034205 3300006871 Bacteria 5017
92 Ga0075429_100093834 3300006880 Bacteria 2617
93 Ga0075429_100201100 3300006880 Bacteria 1745
94 Ga0075436_100041007 3300006914 Bacteria 3194
95 Ga0075436_100041140 3300006914 Bacteria 3189
96 Ga0075436_100105526 3300006914 Bacteria 1965
97 Ga0075436_100119005 3300006914 Bacteria 1847
98 Ga0075435_100068428 3300007076 Bacteria 2893
99 Ga0099794_10008534 3300007265 Bacteria 4262
100 Ga0099794_10014804 3300007265 Bacteria 3427
101 Ga0099794_10016251 3300007265 Bacteria 3296
102 Ga0099794_10061213 3300007265 Bacteria 1829
103 Ga0105240_10065674 3300009093 Bacteria 4503
104 Ga0111539_10004114 3300009094 Bacteria 19083
105 Ga0111539_10033488 3300009094 Bacteria 6238
106 Ga0111539_10092784 3300009094 Bacteria 3547
107 Ga0111539_10197528 3300009094 Bacteria 2346
108 Ga0114129_10007397 3300009147 Bacteria 15630
109 Ga0105238_10000015 3300009551 Bacteria 241590
110 Ga0105238_10024695 3300009551 Bacteria 6127
111 Ga0105238_10079774 3300009551 Bacteria 3262
112 Ga0105249_10377726 3300009553 Bacteria 1442
113 Ga0099796_10048148 3300010159 Bacteria 1469
114 Ga0105239_10204738 3300010375 Bacteria 2211
115 Ga0157370_10158836 3300013104 Bacteria 2104
116 Ga0157374_10094991 3300013296 Plasmid 2850
117 Ga0157374_10191107 3300013296 Bacteria 2003
118 Ga0157378_10001265 3300013297 Bacteria 22756
119 Ga0157378_10167858 3300013297 Bacteria 2057
120 Ga0157378_10285917 3300013297 Bacteria 1591
121 Ga0163162_10073305 3300013306 Bacteria 3479
122 Ga0157372_10064521 3300013307 Bacteria 4109
123 Ga0157372_10505845 3300013307 Bacteria 1409
124 Ga0157375_10092111 3300013308 Unclassified 3094
125 Ga0157376_10044185 3300014969 Bacteria 3661
126 Ga0163161_10091186 3300017792 Bacteria 2255
127 Ga0213875_10030293 3300021388 Bacteria 2562
128 Ga0209646_1000002 3300025246 Bacteria 1425781
129 Ga0209026_1002968 3300025250 Bacteria 5899
130 Ga0209233_1003245 3300025261 Bacteria 5765
131 Ga0209758_1000409 3300025297 Bacteria 73316
132 Ga0209050_1014222 3300025298 Bacteria 3449
133 Ga0209256_1015054 3300025299 Bacteria 2732
134 Ga0207426_1000190 3300025302 Bacteria 152568
135 Ga0209051_1003696 3300025303 Bacteria 9878
136 Ga0209257_1000007 3300025304 Bacteria 1564415
137 Ga0207684_10001931 3300025910 Bacteria 21489
138 Ga0207707_10042182 3300025912 Bacteria 3984
139 Ga0207695_10090897 3300025913 Bacteria 3067
140 Ga0207662_10030458 3300025918 Bacteria 3131
141 Ga0207662_10058790 3300025918 Bacteria 2302
142 Ga0207649_10043610 3300025920 Unclassified 2743
143 Ga0207652_10037298 3300025921 Bacteria 4114
144 Ga0207646_10000366 3300025922 Bacteria 60641
145 Ga0207646_10001192 3300025922 Bacteria 32725
146 Ga0207681_10120554 3300025923 Unclassified 1923
147 Ga0207694_10000017 3300025924 Bacteria 342100
148 Ga0207694_10034674 3300025924 Bacteria 3870
149 Ga0207650_10049492 3300025925 Bacteria 3103
150 Ga0207650_10195110 3300025925 Bacteria 1619
151 Ga0207659_10031512 3300025926 Bacteria 3630
152 Ga0207644_10022720 3300025931 Bacteria 4287
153 Ga0207644_10038392 3300025931 Bacteria 3373
154 Ga0207706_10000776 3300025933 Bacteria 33057
155 Ga0207706_10133412 3300025933 Bacteria 2184
156 Ga0207706_10277382 3300025933 Bacteria 1462
157 Ga0207686_10024613 3300025934 Bacteria 3491
158 Ga0207665_10137990 3300025939 Bacteria 1736
159 Ga0207691_10012280 3300025940 Bacteria 8210
160 Ga0207691_10060518 3300025940 Bacteria 3440
161 Ga0207689_10034235 3300025942 Bacteria 4219
162 Ga0207661_10337500 3300025944 Unclassified 1357
163 Ga0207679_10004163 3300025945 Bacteria 8990
164 Ga0207679_10184111 3300025945 Bacteria 1730
165 Ga0207667_10054723 3300025949 Bacteria 4197
166 Ga0207712_10085681 3300025961 Bacteria 2306
167 Ga0207640_10137967 3300025981 Bacteria 1773
168 Ga0207658_10075096 3300025986 Bacteria 2571
169 Ga0207677_10076937 3300026023 Unclassified 2377
170 Ga0207639_10044330 3300026041 Bacteria 3345
171 Ga0207639_10105909 3300026041 Bacteria 2282
172 Ga0207648_10074170 3300026089 Bacteria 2965
173 Ga0207648_10251914 3300026089 Bacteria 1574
174 Ga0207676_10243256 3300026095 Bacteria 1615
175 Ga0207683_10000366 3300026121 Bacteria 41419
176 Ga0207698_10005482 3300026142 Bacteria 7850
177 Ga0207698_10077524 3300026142 Bacteria 2665
178 Ga0210000_1001319 3300027462 Bacteria 3500
179 Ga0207428_10001022 3300027907 Bacteria 30984
180 Ga0207428_10035198 3300027907 Bacteria 4095
181 Ga0268266_10029092 3300028379 Bacteria 4696
182 Ga0268265_10112507 3300028380 Bacteria 2226
183 Ga0268265_10194860 3300028380 Unclassified 1753
184 Ga0307515_10000016 3300028794 Bacteria 554870
185 Ga0307515_10001521 3300028794 Bacteria 51888
186 Ga0307515_10109479 3300028794 Bacteria 3244
187 Ga0265338_10124214 3300028800 Bacteria 2051
188 Ga0265327_10008518 3300031251 Bacteria 7619
189 Ga0307408_100047264 3300031548 Unclassified 3081
190 Ga0316576_10012441 3300031727 Bacteria 5620
191 Ga0307405_10001000 3300031731 Bacteria 11399
192 Ga0307405_10062506 3300031731 Bacteria 2358
193 Ga0307413_10042623 3300031824 Bacteria 2669
194 Ga0307413_10045068 3300031824 Bacteria 2611
195 Ga0307413_10067887 3300031824 Bacteria 2231
196 Ga0307413_10080682 3300031824 Bacteria 2084
197 Ga0307413_10095071 3300031824 Bacteria 1952
198 Ga0307410_10019830 3300031852 Bacteria 4099
199 Ga0307410_10181058 3300031852 Bacteria 1595
200 Ga0307406_10043319 3300031901 Bacteria 2814
201 Ga0307406_10052019 3300031901 Bacteria 2603
202 Ga0307406_10072518 3300031901 Bacteria 2261
203 Ga0307406_10089739 3300031901 Bacteria 2066
204 Ga0307406_10120435 3300031901 Bacteria 1823
205 Ga0307407_10007085 3300031903 Bacteria 5051
206 Ga0307407_10123668 3300031903 Bacteria 1644
207 Ga0307412_10004216 3300031911 Bacteria 8017
208 Ga0307412_10007723 3300031911 Bacteria 6113
209 Ga0307409_100092706 3300031995 Bacteria 2479
210 Ga0307409_100113046 3300031995 Bacteria 2281
211 Ga0307409_100138837 3300031995 Bacteria 2090
212 Ga0307409_100249572 3300031995 Bacteria 1621
213 Ga0307416_100139779 3300032002 Bacteria 2199
214 Ga0307416_100334031 3300032002 Bacteria 1525
215 Ga0307416_100366769 3300032002 Bacteria 1464
216 Ga0307414_10013741 3300032004 Bacteria 4829
217 Ga0307414_10031949 3300032004 Bacteria 3460
218 Ga0307414_10041852 3300032004 Bacteria 3107
219 Ga0307414_10089532 3300032004 Bacteria 2281
220 Ga0307411_10000190 3300032005 Bacteria 19743
221 Ga0307411_10025132 3300032005 Bacteria 3563
222 Ga0307411_10094251 3300032005 Bacteria 2098
223 Ga0307411_10212224 3300032005 Bacteria 1495
224 Ga0307415_100002312 3300032126 Bacteria 9458
225 Ga0307415_100014224 3300032126 Bacteria 4670
226 Ga0307415_100245729 3300032126 Bacteria 1450
227 Ga0373930_0002240 3300034816 Bacteria 2980
228 Ga0373943_0057170 3300035170 Bacteria 1938
229 Ga0373924_0001366 3300035410 Bacteria 7875
230 Ga0373931_0124436 3300035691 Bacteria 1477
231 Ga0373935_0145429 3300035692 Bacteria 1605
232 Ga0316584_0024949 3300036712 Bacteria 4381
233 Ga0436364_0279494 3300037853 Bacteria 3960
234 Ga0436363_0019062 3300039450 Bacteria 6901
235 Ga0451577_0264991 3300042876 Unclassified 1556
236 Ga0453684_0002144 3300044712 Bacteria 49481
237 Ga0451576_0008103 3300045051 Bacteria 12384
238 Ga0451576_0244839 3300045051 Bacteria 1873
239 Ga0495638_0000004 3300046460 Bacteria 700795
240 Ga0495638_0015690 3300046460 Bacteria 5081
241 Ga0495638_0018304 3300046460 Bacteria 4655
242 Ga0495606_0017580 3300046507 Bacteria 5398
243 Ga0495610_0008483 3300046512 Bacteria 6648
244 Ga0495643_0000374 3300046522 Bacteria 60146
245 Ga0495648_0005451 3300046524 Bacteria 10561
246 Ga0495648_0007706 3300046524 Bacteria 8584
247 Ga0495648_0019674 3300046524 Bacteria 4735
248 Ga0495621_0074782 3300046539 Bacteria 1254
249 Ga0495611_0018808 3300046648 Bacteria 2964
250 Ga0495588_0106606 3300046674 Bacteria 1475
251 Ga0495669_0019191 3300046684 Bacteria 2949
252 Ga0495636_0035040 3300047318 Bacteria 2067
253 Ga0496104_0032318 3300048907 Bacteria 4870
254 Ga0496104_0309666 3300048907 Bacteria 1492
255 Ga0496108_0026533 3300048911 Bacteria 4779
256 Ga0496110_0045281 3300048913 Unclassified 3845
257 Ga0496111_0037217 3300048914 Unclassified 3483
258 Ga0495682_0006356 3300049460 Bacteria 4785
259 Ga0501036_0081508 3300049572 Bacteria 2735
260 Ga0501072_0000424 3300049588 Bacteria 30227
261 Ga0501074_0143244 3300049590 Bacteria 1709
262 Ga0501074_0211405 3300049590 Bacteria 1382
263 Ga0501076_0155508 3300049592 Bacteria 1861
264 Ga0501202_000669 3300049652 Bacteria 5085
265 Ga0501235_003830 3300049669 Bacteria 3249
266 Ga0501235_010189 3300049669 Bacteria 2054
267 Ga0501257_021490 3300049686 Unclassified 1522
268 Ga0501081_0022236 3300049743 Bacteria 4241
269 Ga0501045_0016580 3300049824 Bacteria 5235
270 nmdc:mga05p37_1568_c1 3300050507 Bacteria 26557
271 nmdc:mga09592_38180_c1 3300050508 Bacteria 4030
272 nmdc:mga0qj67_11476_c1 3300050509 Bacteria 6639
273 nmdc:mga0qj67_15523_c1 3300050509 Bacteria 5766
274 nmdc:mga0qj67_26234_c1 3300050509 Bacteria 4510
275 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
276 nmdc:mga06r32_17865_c1 3300050510 Bacteria 6482
277 nmdc:mga06r32_229643_c1 3300050510 Bacteria 1843
278 nmdc:mga06r32_30960_c1 3300050510 Bacteria 5022
279 nmdc:mga06r32_42847_c1 3300050510 Bacteria 4306
280 nmdc:mga08y16_1315_c1 3300050511 Bacteria 24687
281 nmdc:mga08y16_159172_c1 3300050511 Bacteria 2346
282 nmdc:mga08y16_32424_c1 3300050511 Bacteria 5493
283 nmdc:mga08y16_32701_c1 3300050511 Bacteria 5467
284 nmdc:mga08y16_3792_c1 3300050511 Bacteria 15742
285 nmdc:mga0n895_229096_c1 3300050512 Bacteria 1886
286 nmdc:mga0n895_86451_c1 3300050512 Bacteria 3132
287 nmdc:mga08x19_29462_c1 3300050514 Bacteria 3442
288 nmdc:mga08x19_33018_c1 3300050514 Bacteria 3265
289 nmdc:mga08x19_92258_c1 3300050514 Bacteria 2000
290 nmdc:mga0a205_19277_c1 3300050515 Bacteria 6428
291 nmdc:mga0a205_70534_c1 3300050515 Bacteria 3374
292 nmdc:mga0sz30_26676_c1 3300050516 Bacteria 2369
293 Ga0500651_0048476 3300053093 Bacteria 2669
294 Ga0500566_0000575 3300053094 Bacteria 20662
295 Ga0500641_0008789 3300053096 Bacteria 3616
296 Ga0500641_0051555 3300053096 Bacteria 1693
297 Ga0500555_002317 3300053103 Bacteria 5540
298 Ga0500556_0003753 3300053104 Bacteria 4408
299 Ga0500556_0008577 3300053104 Unclassified 2953
300 Ga0500628_000290 3300053129 Bacteria 9597
301 Ga0500642_0086467 3300053130 Bacteria 1445
302 Ga0500559_0000036 3300053136 Bacteria 110748
303 Ga0500568_0006666 3300053139 Bacteria 5774
304 Ga0500616_0000015 3300053153 Bacteria 633259
305 Ga0500616_0014872 3300053153 Bacteria 4460
306 Ga0500616_0083374 3300053153 Bacteria 1601
307 Ga0500622_0003943 3300053156 Bacteria 9589
308 Ga0500622_0010425 3300053156 Bacteria 5101
309 Ga0500645_021102 3300053730 Bacteria 2012
310 Ga0500599_003312 3300053736 Bacteria 1959
311 Ga0500601_000084 3300053737 Bacteria 19268
312 Ga0501084_0128146 3300054114 Bacteria 2136
313 Ga0500661_000898 3300055283 Bacteria 5578
314 Ga0590077_013364 3300059426 Bacteria 1707
315 Ga0501082_0117282 3300060353 Bacteria 2306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_10001717 Ga0070685_1000171713 313
2 3300005331 Ga0070670_100063963 Ga0070670_1000639632 336
3 3300025925 Ga0207650_10049492 Ga0207650_100494923 336
4 3300005458 Ga0070681_10060667 Ga0070681_100606672 344
5 3300005545 Ga0070695_100048905 Ga0070695_1000489053 349
6 3300045051 Ga0451576_0244839 Ga0451576_0244839_212_1375 349
7 3300006914 Ga0075436_100105526 Ga0075436_1001055263 350
8 3300046539 Ga0495621_0074782 Ga0495621_0074782_29_1093 351
9 3300048907 Ga0496104_0309666 Ga0496104_0309666_266_1453 354
10 3300048911 Ga0496108_0026533 Ga0496108_0026533_2734_3918 355
11 3300050515 nmdc:mga0a205_19277_c1 nmdc:mga0a205_19277_c1_1606_2778 357
12 3300048907 Ga0496104_0032318 Ga0496104_0032318_2452_3540 358
13 iso_pu_bacteria 2879099564 2879106905 358
14 3300005262 Ga0065165_1000473 Ga0065165_100047337 360
15 3300006846 Ga0075430_100155578 Ga0075430_1001555782 360
16 3300025261 Ga0209233_1003245 Ga0209233_10032454 360
17 3300005327 Ga0070658_10032869 Ga0070658_100328693 361
18 3300005985 Ga0081539_10000117 Ga0081539_10000117135 362
19 3300032005 Ga0307411_10212224 Ga0307411_102122241 362
20 3300007076 Ga0075435_100068428 Ga0075435_1000684283 364
21 3300031731 Ga0307405_10001000 Ga0307405_100010009 365
22 3300031824 Ga0307413_10095071 Ga0307413_100950712 365
23 3300031911 Ga0307412_10004216 Ga0307412_100042163 365
24 3300013104 Ga0157370_10158836 Ga0157370_101588362 366
25 3300039450 Ga0436363_0019062 Ga0436363_0019062_4951_6126 366
26 3300005539 Ga0068853_100031045 Ga0068853_1000310452 368
27 3300005539 Ga0068853_100121669 Ga0068853_1001216692 368
28 3300026041 Ga0207639_10044330 Ga0207639_100443302 368
29 3300026041 Ga0207639_10105909 Ga0207639_101059092 368
30 3300028380 Ga0268265_10112507 Ga0268265_101125072 368
31 3300013307 Ga0157372_10064521 Ga0157372_100645212 369
32 3300005334 Ga0068869_100014723 Ga0068869_1000147232 370
33 3300005347 Ga0070668_100017813 Ga0070668_1000178137 370
34 3300005719 Ga0068861_100047384 Ga0068861_1000473841 370
35 3300009553 Ga0105249_10377726 Ga0105249_103777261 370
36 3300025942 Ga0207689_10034235 Ga0207689_100342353 370
37 3300026089 Ga0207648_10251914 Ga0207648_102519141 370
38 3300028380 Ga0268265_10194860 Ga0268265_101948602 370
39 3300053153 Ga0500616_0083374 Ga0500616_0083374_190_1413 370
40 3300021388 Ga0213875_10030293 Ga0213875_100302932 373
41 3300046684 Ga0495669_0019191 Ga0495669_0019191_1482_2654 375
42 3300055283 Ga0500661_000898 Ga0500661_000898_3639_4856 376
43 3300005548 Ga0070665_100036080 Ga0070665_1000360802 377
44 3300006237 Ga0097621_100063718 Ga0097621_1000637182 377
45 3300025303 Ga0209051_1003696 Ga0209051_10036962 377
46 3300028379 Ga0268266_10029092 Ga0268266_100290921 377
47 3300046460 Ga0495638_0015690 Ga0495638_0015690_1663_2913 377
48 3300046512 Ga0495610_0008483 Ga0495610_0008483_2104_3321 377
49 3300053736 Ga0500599_003312 Ga0500599_003312_307_1524 377
50 3300007265 Ga0099794_10061213 Ga0099794_100612132 378
51 3300046524 Ga0495648_0005451 Ga0495648_0005451_373_1590 379
52 3300005468 Ga0070707_100003317 Ga0070707_1000033174 380
53 3300005471 Ga0070698_100008092 Ga0070698_1000080923 380
54 3300005518 Ga0070699_100000868 Ga0070699_10000086818 380
55 3300005536 Ga0070697_100357857 Ga0070697_1003578571 380
56 3300025910 Ga0207684_10001931 Ga0207684_1000193111 380
57 3300025922 Ga0207646_10001192 Ga0207646_1000119224 380
58 3300005290 Ga0065712_10132503 Ga0065712_101325031 381
59 3300005329 Ga0070683_100064020 Ga0070683_1000640202 381
60 3300005331 Ga0070670_100047919 Ga0070670_1000479195 381
61 3300005344 Ga0070661_100030693 Ga0070661_1000306934 381
62 3300005355 Ga0070671_100107334 Ga0070671_1001073343 381
63 3300005356 Ga0070674_100150110 Ga0070674_1001501102 381
64 3300005456 Ga0070678_100017127 Ga0070678_1000171272 381
65 3300005543 Ga0070672_100054224 Ga0070672_1000542242 381
66 3300005564 Ga0070664_100099519 Ga0070664_1000995193 381
67 3300005578 Ga0068854_100015259 Ga0068854_1000152593 381
68 3300005616 Ga0068852_100137201 Ga0068852_1001372011 381
69 3300005618 Ga0068864_100083083 Ga0068864_1000830834 381
70 3300005834 Ga0068851_10036502 Ga0068851_100365023 381
71 3300005841 Ga0068863_100306907 Ga0068863_1003069071 381
72 3300013296 Ga0157374_10094991 Ga0157374_100949912 381
73 3300013306 Ga0163162_10073305 Ga0163162_100733055 381
74 3300013308 Ga0157375_10092111 Ga0157375_100921112 381
75 3300014969 Ga0157376_10044185 Ga0157376_100441852 381
76 3300025920 Ga0207649_10043610 Ga0207649_100436103 381
77 3300025925 Ga0207650_10195110 Ga0207650_101951102 381
78 3300025931 Ga0207644_10038392 Ga0207644_100383923 381
79 3300025933 Ga0207706_10133412 Ga0207706_101334122 381
80 3300025940 Ga0207691_10060518 Ga0207691_100605182 381
81 3300025944 Ga0207661_10337500 Ga0207661_103375001 381
82 3300025945 Ga0207679_10004163 Ga0207679_100041638 381
83 3300025981 Ga0207640_10137967 Ga0207640_101379672 381
84 3300025986 Ga0207658_10075096 Ga0207658_100750963 381
85 3300026023 Ga0207677_10076937 Ga0207677_100769373 381
86 3300026095 Ga0207676_10243256 Ga0207676_102432562 381
87 3300026121 Ga0207683_10000366 Ga0207683_1000036645 381
88 3300048913 Ga0496110_0045281 Ga0496110_0045281_1412_2596 381
89 3300048914 Ga0496111_0037217 Ga0496111_0037217_2085_3269 381
90 3300050514 nmdc:mga08x19_92258_c1 nmdc:mga08x19_92258_c1_507_1670 381
91 3300006846 Ga0075430_100031405 Ga0075430_1000314052 382
92 3300035691 Ga0373931_0124436 Ga0373931_0124436_151_1320 382
93 3300037853 Ga0436364_0279494 Ga0436364_0279494_260_1525 382
94 3300050509 nmdc:mga0qj67_26234_c1 nmdc:mga0qj67_26234_c1_964_2142 382
95 3300005530 Ga0070679_100022932 Ga0070679_1000229323 383
96 3300005536 Ga0070697_100101290 Ga0070697_1001012902 383
97 3300025921 Ga0207652_10037298 Ga0207652_100372985 383
98 3300028800 Ga0265338_10124214 Ga0265338_101242142 383
99 3300031251 Ga0265327_10008518 Ga0265327_100085183 383
100 3300005440 Ga0070705_100008518 Ga0070705_1000085184 384
101 3300005444 Ga0070694_100019059 Ga0070694_1000190593 384
102 3300005445 Ga0070708_100110846 Ga0070708_1001108462 384
103 3300005536 Ga0070697_100152478 Ga0070697_1001524782 384
104 3300006173 Ga0070716_100024457 Ga0070716_1000244572 384
105 3300006914 Ga0075436_100041007 Ga0075436_1000410074 384
106 3300007265 Ga0099794_10014804 Ga0099794_100148045 384
107 3300031727 Ga0316576_10012441 Ga0316576_100124414 384
108 3300032002 Ga0307416_100139779 Ga0307416_1001397792 384
109 3300036712 Ga0316584_0024949 Ga0316584_0024949_1962_3191 384
110 3300005328 Ga0070676_10116870 Ga0070676_101168702 385
111 3300005549 Ga0070704_100049847 Ga0070704_1000498471 385
112 3300031824 Ga0307413_10080682 Ga0307413_100806822 385
113 3300031852 Ga0307410_10181058 Ga0307410_101810581 385
114 3300031995 Ga0307409_100249572 Ga0307409_1002495721 385
115 3300032004 Ga0307414_10041852 Ga0307414_100418522 385
116 3300005536 Ga0070697_100054032 Ga0070697_1000540323 386
117 3300006173 Ga0070716_100127556 Ga0070716_1001275562 386
118 3300006914 Ga0075436_100041140 Ga0075436_1000411402 386
119 3300006914 Ga0075436_100119005 Ga0075436_1001190052 386
120 3300007265 Ga0099794_10008534 Ga0099794_100085342 386
121 3300025939 Ga0207665_10137990 Ga0207665_101379902 386
122 3300032005 Ga0307411_10025132 Ga0307411_100251322 386
123 3300049572 Ga0501036_0081508 Ga0501036_0081508_1276_2538 386
124 3300049590 Ga0501074_0211405 Ga0501074_0211405_79_1341 386
125 3300049824 Ga0501045_0016580 Ga0501045_0016580_3354_4616 386
126 3300050514 nmdc:mga08x19_29462_c1 nmdc:mga08x19_29462_c1_2049_3266 386
127 3300050514 nmdc:mga08x19_33018_c1 nmdc:mga08x19_33018_c1_1097_2260 386
128 3300054114 Ga0501084_0128146 Ga0501084_0128146_830_2092 386
129 3300005439 Ga0070711_100106971 Ga0070711_1001069712 387
130 3300005616 Ga0068852_100086013 Ga0068852_1000860132 387
131 3300026089 Ga0207648_10074170 Ga0207648_100741704 387
132 3300026142 Ga0207698_10077524 Ga0207698_100775242 387
133 3300031901 Ga0307406_10043319 Ga0307406_100433191 387
134 3300031995 Ga0307409_100138837 Ga0307409_1001388372 387
135 3300032002 Ga0307416_100366769 Ga0307416_1003667691 387
136 3300032004 Ga0307414_10031949 Ga0307414_100319493 387
137 3300032005 Ga0307411_10094251 Ga0307411_100942512 387
138 3300032126 Ga0307415_100245729 Ga0307415_1002457291 387
139 3300053156 Ga0500622_0003943 Ga0500622_0003943_6288_7520 387
140 3300009551 Ga0105238_10079774 Ga0105238_100797743 388
141 3300028794 Ga0307515_10000016 Ga0307515_10000016329 388
142 3300034816 Ga0373930_0002240 Ga0373930_0002240_872_2107 388
143 iso_pu_bacteria 2935959822 2935965535 388
144 3300003323 rootH1_10096149 rootH1_100961495 389
145 3300003794 Ga0055531_10000418 Ga0055531_1000041810 389
146 3300005367 Ga0070667_100057576 Ga0070667_1000575762 389
147 3300005457 Ga0070662_100000442 Ga0070662_1000004421 389
148 3300005544 Ga0070686_100000079 Ga0070686_10000007930 389
149 3300005563 Ga0068855_100090547 Ga0068855_1000905473 389
150 3300006844 Ga0075428_100002960 Ga0075428_1000029607 389
151 3300006844 Ga0075428_100029163 Ga0075428_1000291635 389
152 3300007265 Ga0099794_10016251 Ga0099794_100162513 389
153 3300009093 Ga0105240_10065674 Ga0105240_100656744 389
154 3300009094 Ga0111539_10004114 Ga0111539_100041142 389
155 3300009094 Ga0111539_10033488 Ga0111539_100334885 389
156 3300013297 Ga0157378_10167858 Ga0157378_101678582 389
157 3300025298 Ga0209050_1014222 Ga0209050_10142223 389
158 3300025304 Ga0209257_1000007 Ga0209257_100000768 389
159 3300025933 Ga0207706_10000776 Ga0207706_1000077622 389
160 3300025949 Ga0207667_10054723 Ga0207667_100547231 389
161 3300035692 Ga0373935_0145429 Ga0373935_0145429_309_1553 389
162 3300050511 nmdc:mga08y16_32701_c1 nmdc:mga08y16_32701_c1_3035_4270 389
163 3300050511 nmdc:mga08y16_3792_c1 nmdc:mga08y16_3792_c1_5615_6805 389
164 3300009551 Ga0105238_10000015 Ga0105238_10000015188 390
165 3300025924 Ga0207694_10000017 Ga0207694_10000017122 390
166 3300005327 Ga0070658_10008233 Ga0070658_1000823310 391
167 3300025299 Ga0209256_1015054 Ga0209256_10150542 391
168 3300046507 Ga0495606_0017580 Ga0495606_0017580_1781_2998 391
169 3300046524 Ga0495648_0007706 Ga0495648_0007706_6798_8015 391
170 3300046524 Ga0495648_0019674 Ga0495648_0019674_631_1848 391
171 3300046648 Ga0495611_0018808 Ga0495611_0018808_127_1344 391
172 3300049460 Ga0495682_0006356 Ga0495682_0006356_1667_2884 391
173 3300050516 nmdc:mga0sz30_26676_c1 nmdc:mga0sz30_26676_c1_708_1925 391
174 3300053093 Ga0500651_0048476 Ga0500651_0048476_1005_2222 391
175 3300053094 Ga0500566_0000575 Ga0500566_0000575_12773_13990 391
176 3300053096 Ga0500641_0008789 Ga0500641_0008789_1780_2997 391
177 3300053103 Ga0500555_002317 Ga0500555_002317_3008_4225 391
178 3300053104 Ga0500556_0003753 Ga0500556_0003753_1575_2792 391
179 3300053130 Ga0500642_0086467 Ga0500642_0086467_175_1392 391
180 3300053136 Ga0500559_0000036 Ga0500559_0000036_97816_99033 391
181 3300053139 Ga0500568_0006666 Ga0500568_0006666_4521_5738 391
182 3300053153 Ga0500616_0014872 Ga0500616_0014872_166_1383 391
183 3300053156 Ga0500622_0010425 Ga0500622_0010425_3296_4513 391
184 3300053730 Ga0500645_021102 Ga0500645_021102_214_1431 391
185 3300053737 Ga0500601_000084 Ga0500601_000084_1424_2641 391
186 3300003215 JGI25153J46596_10000204 JGI25153J46596_1000020411 392
187 3300003354 JGI25160J50197_1009023 JGI25160J50197_10090233 392
188 3300025297 Ga0209758_1000409 Ga0209758_10004097 392
189 3300025302 Ga0207426_1000190 Ga0207426_100019088 392
190 3300028794 Ga0307515_10109479 Ga0307515_101094793 393
191 3300046460 Ga0495638_0000004 Ga0495638_0000004_284051_285283 393
192 3300049590 Ga0501074_0143244 Ga0501074_0143244_106_1311 393
193 3300053153 Ga0500616_0000015 Ga0500616_0000015_542396_543628 393
194 3300031548 Ga0307408_100047264 Ga0307408_1000472643 394
195 3300031731 Ga0307405_10062506 Ga0307405_100625063 394
196 3300031824 Ga0307413_10045068 Ga0307413_100450682 394
197 3300031852 Ga0307410_10019830 Ga0307410_100198306 394
198 3300031901 Ga0307406_10120435 Ga0307406_101204352 394
199 3300031911 Ga0307412_10007723 Ga0307412_100077233 394
200 3300031995 Ga0307409_100092706 Ga0307409_1000927063 394
201 3300032004 Ga0307414_10089532 Ga0307414_100895322 394
202 3300032005 Ga0307411_10000190 Ga0307411_1000019012 394
203 3300032126 Ga0307415_100014224 Ga0307415_1000142243 394
204 3300049592 Ga0501076_0155508 Ga0501076_0155508_522_1763 394
205 3300049669 Ga0501235_003830 Ga0501235_003830_657_1889 394
206 3300049686 Ga0501257_021490 Ga0501257_021490_149_1381 394
207 3300049743 Ga0501081_0022236 Ga0501081_0022236_67_1308 394
208 3300060353 Ga0501082_0117282 Ga0501082_0117282_854_2095 394
209 3300005336 Ga0070680_100176986 Ga0070680_1001769862 395
210 3300005458 Ga0070681_10022700 Ga0070681_100227002 395
211 3300005530 Ga0070679_100025791 Ga0070679_1000257912 395
212 3300005616 Ga0068852_100040269 Ga0068852_1000402694 395
213 3300006846 Ga0075430_100111654 Ga0075430_1001116542 395
214 3300006880 Ga0075429_100093834 Ga0075429_1000938342 395
215 3300025912 Ga0207707_10042182 Ga0207707_100421823 395
216 3300032002 Ga0307416_100334031 Ga0307416_1003340311 395
217 3300049588 Ga0501072_0000424 Ga0501072_0000424_12045_13259 395
218 3300050509 nmdc:mga0qj67_11476_c1 nmdc:mga0qj67_11476_c1_3546_4793 395
219 3300050510 nmdc:mga06r32_42847_c1 nmdc:mga06r32_42847_c1_2446_3693 395
220 3300047318 Ga0495636_0035040 Ga0495636_0035040_249_1475 396
221 3300003323 rootH1_10045256 rootH1_100452562 397
222 3300005329 Ga0070683_100086846 Ga0070683_1000868461 397
223 3300005535 Ga0070684_100066522 Ga0070684_1000665223 397
224 3300005937 Ga0081455_10009182 Ga0081455_100091824 397
225 3300009551 Ga0105238_10024695 Ga0105238_100246952 397
226 3300013297 Ga0157378_10285917 Ga0157378_102859171 397
227 3300013307 Ga0157372_10505845 Ga0157372_105058452 397
228 3300025913 Ga0207695_10090897 Ga0207695_100908973 397
229 3300025924 Ga0207694_10034674 Ga0207694_100346745 397
230 3300025933 Ga0207706_10277382 Ga0207706_102773821 397
231 3300025934 Ga0207686_10024613 Ga0207686_100246133 397
232 3300025961 Ga0207712_10085681 Ga0207712_100856813 397
233 3300046522 Ga0495643_0000374 Ga0495643_0000374_27383_28618 397
234 3300050510 nmdc:mga06r32_30960_c1 nmdc:mga06r32_30960_c1_414_1655 397
235 3300050512 nmdc:mga0n895_229096_c1 nmdc:mga0n895_229096_c1_610_1875 397
236 3300050515 nmdc:mga0a205_70534_c1 nmdc:mga0a205_70534_c1_367_1632 397
237 3300005543 Ga0070672_100256887 Ga0070672_1002568871 398
238 3300006237 Ga0097621_100041684 Ga0097621_1000416843 398
239 3300006847 Ga0075431_100108547 Ga0075431_1001085472 398
240 3300017792 Ga0163161_10091186 Ga0163161_100911862 398
241 3300025923 Ga0207681_10120554 Ga0207681_101205542 398
242 3300026142 Ga0207698_10005482 Ga0207698_100054825 398
243 3300027462 Ga0210000_1001319 Ga0210000_10013193 398
244 3300031824 Ga0307413_10042623 Ga0307413_100426232 398
245 3300031824 Ga0307413_10067887 Ga0307413_100678872 398
246 3300031901 Ga0307406_10052019 Ga0307406_100520192 398
247 3300031901 Ga0307406_10089739 Ga0307406_100897391 398
248 3300031903 Ga0307407_10007085 Ga0307407_100070852 398
249 3300031903 Ga0307407_10123668 Ga0307407_101236682 398
250 3300031995 Ga0307409_100113046 Ga0307409_1001130462 398
251 3300032004 Ga0307414_10013741 Ga0307414_100137413 398
252 3300035410 Ga0373924_0001366 Ga0373924_0001366_2737_3963 398
253 3300053129 Ga0500628_000290 Ga0500628_000290_5135_6361 398
254 3300005262 Ga0065165_1001823 Ga0065165_100182321 399
255 3300010159 Ga0099796_10048148 Ga0099796_100481481 399
256 3300025918 Ga0207662_10030458 Ga0207662_100304584 399
257 3300031901 Ga0307406_10072518 Ga0307406_100725182 399
258 3300035170 Ga0373943_0057170 Ga0373943_0057170_24_1265 399
259 3300059426 Ga0590077_013364 Ga0590077_013364_428_1657 399
260 iso_pu_bacteria 2929921140 2929922814 399
261 iso_pu_bacteria 8003151029 8003154613 399
262 3300005546 Ga0070696_100007044 Ga0070696_1000070442 400
263 3300005937 Ga0081455_10029988 Ga0081455_100299882 400
264 3300006844 Ga0075428_100001150 Ga0075428_10000115012 400
265 3300006844 Ga0075428_100280922 Ga0075428_1002809221 400
266 3300006846 Ga0075430_100243085 Ga0075430_1002430852 400
267 3300006847 Ga0075431_100001045 Ga0075431_1000010455 400
268 3300006852 Ga0075433_10024618 Ga0075433_100246183 400
269 3300006852 Ga0075433_10069272 Ga0075433_100692722 400
270 3300006871 Ga0075434_100034205 Ga0075434_1000342054 400
271 3300006880 Ga0075429_100201100 Ga0075429_1002011001 400
272 3300009094 Ga0111539_10092784 Ga0111539_100927842 400
273 3300009094 Ga0111539_10197528 Ga0111539_101975283 400
274 3300009147 Ga0114129_10007397 Ga0114129_100073977 400
275 3300027907 Ga0207428_10001022 Ga0207428_100010225 400
276 3300027907 Ga0207428_10035198 Ga0207428_100351984 400
277 3300028794 Ga0307515_10001521 Ga0307515_1000152142 400
278 3300042876 Ga0451577_0264991 Ga0451577_0264991_241_1467 400
279 3300044712 Ga0453684_0002144 Ga0453684_0002144_14363_15643 400
280 3300045051 Ga0451576_0008103 Ga0451576_0008103_4414_5694 400
281 3300046460 Ga0495638_0018304 Ga0495638_0018304_205_1476 400
282 3300050507 nmdc:mga05p37_1568_c1 nmdc:mga05p37_1568_c1_2361_3608 400
283 3300050508 nmdc:mga09592_38180_c1 nmdc:mga09592_38180_c1_1352_2599 400
284 3300050510 nmdc:mga06r32_134_c1 nmdc:mga06r32_134_c1_51996_53243 400
285 3300050510 nmdc:mga06r32_229643_c1 nmdc:mga06r32_229643_c1_348_1580 400
286 3300050511 nmdc:mga08y16_1315_c1 nmdc:mga08y16_1315_c1_3613_4908 400
287 3300050511 nmdc:mga08y16_159172_c1 nmdc:mga08y16_159172_c1_931_2163 400
288 3300050511 nmdc:mga08y16_32424_c1 nmdc:mga08y16_32424_c1_2339_3586 400
289 3300050512 nmdc:mga0n895_86451_c1 nmdc:mga0n895_86451_c1_95_1327 400
290 3300053096 Ga0500641_0051555 Ga0500641_0051555_200_1471 400
291 3300005340 Ga0070689_100079593 Ga0070689_1000795932 401
292 3300005367 Ga0070667_100143441 Ga0070667_1001434412 401
293 3300005468 Ga0070707_100000751 Ga0070707_1000007515 401
294 3300005518 Ga0070699_100022576 Ga0070699_1000225762 401
295 3300005544 Ga0070686_100011688 Ga0070686_1000116885 401
296 3300005564 Ga0070664_100005552 Ga0070664_10000555210 401
297 3300005615 Ga0070702_100030570 Ga0070702_1000305702 401
298 3300005616 Ga0068852_100038849 Ga0068852_1000388491 401
299 3300006846 Ga0075430_100008469 Ga0075430_1000084696 401
300 3300006847 Ga0075431_100018320 Ga0075431_1000183206 401
301 3300013296 Ga0157374_10191107 Ga0157374_101911071 401
302 3300013297 Ga0157378_10001265 Ga0157378_1000126527 401
303 3300025918 Ga0207662_10058790 Ga0207662_100587901 401
304 3300025922 Ga0207646_10000366 Ga0207646_100003665 401
305 3300025926 Ga0207659_10031512 Ga0207659_100315124 401
306 3300025931 Ga0207644_10022720 Ga0207644_100227203 401
307 3300025940 Ga0207691_10012280 Ga0207691_100122808 401
308 3300025945 Ga0207679_10184111 Ga0207679_101841113 401
309 3300032126 Ga0307415_100002312 Ga0307415_1000023122 401
310 3300046674 Ga0495588_0106606 Ga0495588_0106606_61_1329 401
311 3300049652 Ga0501202_000669 Ga0501202_000669_1770_2993 401
312 3300049669 Ga0501235_010189 Ga0501235_010189_406_1629 401
313 3300050509 nmdc:mga0qj67_15523_c1 nmdc:mga0qj67_15523_c1_2366_3604 401
314 3300050510 nmdc:mga06r32_17865_c1 nmdc:mga06r32_17865_c1_1038_2276 401
315 3300053104 Ga0500556_0008577 Ga0500556_0008577_1092_2318 401
316 3300002738 JGI25154J39366_1000001 JGI25154J39366_100000191 403
317 3300010375 Ga0105239_10204738 Ga0105239_102047382 403
318 3300025246 Ga0209646_1000002 Ga0209646_100000292 403
319 3300025250 Ga0209026_1002968 Ga0209026_10029683 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

126

405

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dc1-assembly1.cif.gz_A structural and biochemical characterization of l. interrogans lsa45 reveals a penicillin-binding protein with esterase activity 0.7505 29 400
3vwp-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/r187s/h266n/d370y mutant complexd with 6-aminohexanoate 0.7178 41 401
3a66-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/h266n/d370y mutant with substrate 0.7165 42 401
3vwl-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase g181d/r187s/h266n/d370y mutant 0.7141 41 401
2zm8-assembly1.cif.gz_A structure of 6-aminohexanoate-dimer hydrolase, s112a/d370y mutant complexed with 6-aminohexanoate-dimer 0.7085 41 401
ID Description Score Start End Superfamily
1wybA02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7315 66 401 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7298 92 401 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6955 92 401 3.40.710.10
af_I1LEN3_3_193_3.40.1000.50 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Repressor of RNA polymerase III transcription 0.6846 366 382 3.40.1000.50
5tgfD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6818 92 398 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2V7VSZ3-F1-model_v4 Serine hydrolase 0.982 219 400 GO:0016787
AF-A0A1M7BX96-F1-model_v4 Beta-lactamase 0.9788 18 401
AF-A0A1M3HR07-F1-model_v4 Serine hydrolase 0.9766 24 399 GO:0016787
AF-A0A838WCC2-F1-model_v4 Serine hydrolase 0.9753 24 400 GO:0016787
AF-A0A843RZ96-F1-model_v4 Serine hydrolase 0.9727 43 400 GO:0016787

Feature Viewer

pLDDT pTM Quality
91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map