F404970

General Info

Members Datasets Scaffolds Average Seq Length
319 217 638 314

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100194542|Ga0070678_1001945422
Length 345
Sequence VPGSADDTSAAGYRPLLFSIAYGMTGSVGDAEDIVQDAFLGLTRARQAGTTIADPKAYLTTAVTRLGINHLSSARVRRETYVGDWLPEPVVVPADRPGPAEHAELADSLSMAFLVLLEALSPVERAVFMLREVFGYSYPDVARIVGKTEVNCRQIFARARQRIAAGGQVRDSAPPSARRAEGEELARRFFEAAAGGDMDALLGMLAPDVVLHGDGGGKAGAVGKPLAGRQRVMRLLVGLLRRARILGVSLRLAWVNSQPGAVLYDAEGRVVSVVELDVADGVVQTIRAVVNPDKLGHLGPVSDVARLPEKKSDRGTPATPAGPGKRPGDRPPGRHRNTDEGQGDR

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
212 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
213 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
214 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
215 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
216 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
217 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 1.88
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 4.08
Rhizosphere 90.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100194542 3300005456 Bacteria 1669
2 JGI25406J46586_10005677 3300003203 Bacteria 5770
3 Ga0070658_10039443 3300005327 Bacteria 3810
4 Ga0070683_100270763 3300005329 Bacteria 1615
5 Ga0070666_10152997 3300005335 Bacteria 1610
6 Ga0070660_100094607 3300005339 Bacteria 2361
7 Ga0070675_100109818 3300005354 Bacteria 2331
8 Ga0070667_100162219 3300005367 Bacteria 1969
9 Ga0070709_10000701 3300005434 Bacteria 19084
10 Ga0070714_100000731 3300005435 Bacteria 23305
11 Ga0070714_100004064 3300005435 Bacteria 10996
12 Ga0070714_100036348 3300005435 Bacteria 4130
13 Ga0070714_100325658 3300005435 Bacteria 1438
14 Ga0070714_100338122 3300005435 Bacteria 1411
15 Ga0070713_100024057 3300005436 Bacteria 4738
16 Ga0070713_100040929 3300005436 Bacteria 3772
17 Ga0070713_100167982 3300005436 Bacteria 1963
18 Ga0070713_100241732 3300005436 Bacteria 1644
19 Ga0070710_10000411 3300005437 Bacteria 20167
20 Ga0070710_10043134 3300005437 Bacteria 2497
21 Ga0070710_10052727 3300005437 Bacteria 2288
22 Ga0070710_10125290 3300005437 Bacteria 1560
23 Ga0070711_100002526 3300005439 Bacteria 10461
24 Ga0070705_100066347 3300005440 Bacteria 2163
25 Ga0070700_100064259 3300005441 Bacteria 2324
26 Ga0070663_100017071 3300005455 Bacteria 4729
27 Ga0070681_10081969 3300005458 Bacteria 3181
28 Ga0070679_100094056 3300005530 Bacteria 2984
29 Ga0070679_100275532 3300005530 Bacteria 1636
30 Ga0070684_100134683 3300005535 Bacteria 2231
31 Ga0070684_100222306 3300005535 Bacteria 1723
32 Ga0070684_100309016 3300005535 Bacteria 1452
33 Ga0070697_100056683 3300005536 Bacteria 3188
34 Ga0070686_100065386 3300005544 Bacteria 2362
35 Ga0070704_100046635 3300005549 Bacteria 3024
36 Ga0068855_100151912 3300005563 Bacteria 2633
37 Ga0070664_100349548 3300005564 Bacteria 1344
38 Ga0068857_100153121 3300005577 Bacteria 2090
39 Ga0068857_100167421 3300005577 Bacteria 1997
40 Ga0068852_100034445 3300005616 Bacteria 4213
41 Ga0068864_100154999 3300005618 Bacteria 2078
42 Ga0068864_100176112 3300005618 Bacteria 1953
43 Ga0081455_10006096 3300005937 Bacteria 13034
44 Ga0081538_10002128 3300005981 Bacteria 19728
45 Ga0081538_10004340 3300005981 Bacteria 13095
46 Ga0081538_10030098 3300005981 Bacteria 3693
47 Ga0081540_1001418 3300005983 Bacteria 20736
48 Ga0081539_10001770 3300005985 Bacteria 34424
49 Ga0081539_10012815 3300005985 Bacteria 6401
50 Ga0075365_10239142 3300006038 Bacteria 1275
51 Ga0075364_10114736 3300006051 Bacteria 1800
52 Ga0075432_10003681 3300006058 Bacteria 5218
53 Ga0070715_10055364 3300006163 Bacteria 1722
54 Ga0070716_100000316 3300006173 Bacteria 19449
55 Ga0070716_100093379 3300006173 Bacteria 1826
56 Ga0070716_100121831 3300006173 Bacteria 1634
57 Ga0070716_100123927 3300006173 Bacteria 1622
58 Ga0070712_100001872 3300006175 Bacteria 12845
59 Ga0070712_100184916 3300006175 Bacteria 1626
60 Ga0097621_100127763 3300006237 Bacteria 2160
61 Ga0075428_100027356 3300006844 Bacteria 6310
62 Ga0075431_100023337 3300006847 Bacteria 6328
63 Ga0075433_10150907 3300006852 Bacteria 2067
64 Ga0075434_100177860 3300006871 Bacteria 2147
65 Ga0075436_100040973 3300006914 Bacteria 3195
66 Ga0111539_10011053 3300009094 Bacteria 11357
67 Ga0114129_10000301 3300009147 Bacteria 57373
68 Ga0105237_10165143 3300009545 Bacteria 2213
69 Ga0099796_10043335 3300010159 Bacteria 1532
70 Ga0157370_10027927 3300013104 Bacteria 5559
71 Ga0157369_10151784 3300013105 Bacteria 2448
72 Ga0157374_10616998 3300013296 Bacteria 1095
73 Ga0157375_10237189 3300013308 Bacteria 1983
74 Ga0163163_10016019 3300014325 Bacteria 6951
75 Ga0163163_10112265 3300014325 Bacteria 2755
76 Ga0182008_10125282 3300014497 Bacteria 1279
77 Ga0157376_10071250 3300014969 Bacteria 2953
78 Ga0197907_10400873 3300020069 Bacteria 1632
79 Ga0206356_10861745 3300020070 Bacteria 2349
80 Ga0206354_10053826 3300020081 Bacteria 1463
81 Ga0206353_10086265 3300020082 Bacteria 2676
82 Ga0206353_10409716 3300020082 Bacteria 2731
83 Ga0224712_10107451 3300022467 Bacteria 1192
84 Ga0224572_1002370 3300024225 Bacteria 3027
85 Ga0207692_10000708 3300025898 Bacteria 11730
86 Ga0207692_10012326 3300025898 Bacteria 3669
87 Ga0207688_10030401 3300025901 Bacteria 2978
88 Ga0207647_10179179 3300025904 Bacteria 1232
89 Ga0207699_10000918 3300025906 Bacteria 14073
90 Ga0207707_10044745 3300025912 Bacteria 3858
91 Ga0207693_10020439 3300025915 Bacteria 5267
92 Ga0207693_10098232 3300025915 Bacteria 2296
93 Ga0207693_10295481 3300025915 Bacteria 1269
94 Ga0207663_10020741 3300025916 Bacteria 3727
95 Ga0207663_10021902 3300025916 Bacteria 3645
96 Ga0207660_10101009 3300025917 Bacteria 2154
97 Ga0207662_10057823 3300025918 Bacteria 2319
98 Ga0207657_10044022 3300025919 Bacteria 3927
99 Ga0207657_10054406 3300025919 Bacteria 3461
100 Ga0207652_10138804 3300025921 Bacteria 2172
101 Ga0207681_10209500 3300025923 Bacteria 1502
102 Ga0207694_10215145 3300025924 Bacteria 1566
103 Ga0207700_10000662 3300025928 Bacteria 20159
104 Ga0207700_10013911 3300025928 Bacteria 5257
105 Ga0207700_10029268 3300025928 Bacteria 3884
106 Ga0207700_10089811 3300025928 Bacteria 2423
107 Ga0207700_10102033 3300025928 Bacteria 2290
108 Ga0207700_10156601 3300025928 Bacteria 1888
109 Ga0207700_10315657 3300025928 Bacteria 1353
110 Ga0207664_10001227 3300025929 Bacteria 16980
111 Ga0207664_10001823 3300025929 Bacteria 14044
112 Ga0207664_10020913 3300025929 Bacteria 4856
113 Ga0207664_10049535 3300025929 Bacteria 3307
114 Ga0207664_10054357 3300025929 Bacteria 3172
115 Ga0207664_10066155 3300025929 Bacteria 2896
116 Ga0207664_10072244 3300025929 Bacteria 2781
117 Ga0207664_10080461 3300025929 Bacteria 2648
118 Ga0207664_10159426 3300025929 Bacteria 1923
119 Ga0207665_10000242 3300025939 Bacteria 37438
120 Ga0207691_10048478 3300025940 Bacteria 3894
121 Ga0207689_10021663 3300025942 Bacteria 5405
122 Ga0207661_10023876 3300025944 Bacteria 4626
123 Ga0207679_10109172 3300025945 Bacteria 2180
124 Ga0207667_10145682 3300025949 Bacteria 2438
125 Ga0207651_10228823 3300025960 Bacteria 1508
126 Ga0207658_10168311 3300025986 Bacteria 1803
127 Ga0207678_10001935 3300026067 Bacteria 18899
128 Ga0207678_10009944 3300026067 Bacteria 8344
129 Ga0207678_10039329 3300026067 Bacteria 4106
130 Ga0207708_10072058 3300026075 Bacteria 2647
131 Ga0207702_10114478 3300026078 Bacteria 2403
132 Ga0207674_10024106 3300026116 Bacteria 6506
133 Ga0207674_10049494 3300026116 Bacteria 4298
134 Ga0207674_10103990 3300026116 Bacteria 2819
135 Ga0207675_100104332 3300026118 Bacteria 2672
136 Ga0268265_10332878 3300028380 Bacteria 1380
137 Ga0265337_1000845 3300028556 Bacteria 16051
138 Ga0265326_10016248 3300028558 Bacteria 2152
139 Ga0265319_1001569 3300028563 Bacteria 13415
140 Ga0265334_10000262 3300028573 Bacteria 29692
141 Ga0265318_10034807 3300028577 Bacteria 1939
142 Ga0265323_10003554 3300028653 Bacteria 6861
143 Ga0265336_10003088 3300028666 Bacteria 6633
144 Ga0265338_10002395 3300028800 Bacteria 28217
145 Ga0265332_10001394 3300031238 Bacteria 13616
146 Ga0265320_10003062 3300031240 Bacteria 11348
147 Ga0265325_10015707 3300031241 Bacteria 4250
148 Ga0265340_10001263 3300031247 Bacteria 14536
149 Ga0265339_10026547 3300031249 Bacteria 3316
150 Ga0265316_10005820 3300031344 Bacteria 11887
151 Ga0307408_100050050 3300031548 Bacteria 3003
152 Ga0265314_10009063 3300031711 Bacteria 8451
153 Ga0265342_10004830 3300031712 Bacteria 10451
154 Ga0307405_10033530 3300031731 Bacteria 3047
155 Ga0307410_10144617 3300031852 Bacteria 1763
156 Ga0307410_10191796 3300031852 Bacteria 1554
157 Ga0307406_10050013 3300031901 Bacteria 2647
158 Ga0307406_10304124 3300031901 Bacteria 1226
159 Ga0307407_10021806 3300031903 Bacteria 3311
160 Ga0307407_10042746 3300031903 Bacteria 2543
161 Ga0307409_100024271 3300031995 Bacteria 4225
162 Ga0307409_100220047 3300031995 Bacteria 1713
163 Ga0307416_100027312 3300032002 Bacteria 4224
164 Ga0307416_100330512 3300032002 Bacteria 1531
165 Ga0307414_10197498 3300032004 Bacteria 1633
166 Ga0307415_100034522 3300032126 Bacteria 3294
167 Ga0307415_100090180 3300032126 Bacteria 2216
168 Ga0307415_100120599 3300032126 Bacteria 1965
169 Ga0307415_100189038 3300032126 Bacteria 1623
170 Ga0373958_0027108 3300034819 Bacteria 1102
171 Ga0373926_0000133 3300035083 Bacteria 15545
172 Ga0373928_0010069 3300035084 Bacteria 1853
173 Ga0373944_0000812 3300035089 Bacteria 7654
174 Ga0373951_0027377 3300035091 Bacteria 1331
175 Ga0373952_0003020 3300035092 Bacteria 3037
176 Ga0373923_0066454 3300035111 Bacteria 1541
177 Ga0373936_0000122 3300035113 Bacteria 27464
178 Ga0373936_0081869 3300035113 Bacteria 1344
179 Ga0373945_0000671 3300035116 Bacteria 9901
180 Ga0373953_0065001 3300035117 Bacteria 1497
181 Ga0373956_0154511 3300035119 Bacteria 1080
182 Ga0373960_0035227 3300035121 Bacteria 1420
183 Ga0373943_0000374 3300035170 Bacteria 18868
184 Ga0373946_0000106 3300035171 Bacteria 23756
185 Ga0373955_0063365 3300035172 Bacteria 2047
186 Ga0373961_0073183 3300035241 Bacteria 1064
187 Ga0373962_0019986 3300035242 Bacteria 1755
188 Ga0373935_0000428 3300035692 Bacteria 21914
189 Ga0373935_0112455 3300035692 Bacteria 1809
190 Ga0373927_0001916 3300035695 Bacteria 15375
191 Ga0373933_0030911 3300035724 Bacteria 3103
192 Ga0373933_0046341 3300035724 Bacteria 2581
193 Ga0373947_0000482 3300035725 Bacteria 22909
194 Ga0373947_0032354 3300035725 Bacteria 3082
195 Ga0373937_0078623 3300036401 Bacteria 3048
196 Ga0373937_0153248 3300036401 Bacteria 2159
197 Ga0373937_0171232 3300036401 Bacteria 2037
198 Ga0373925_0000009 3300037068 Bacteria 243099
199 Ga0373925_0003478 3300037068 Bacteria 12185
200 Ga0373925_0007632 3300037068 Bacteria 7876
201 Ga0395905_0096370 3300037471 Bacteria 2777
202 Ga0436364_0342126 3300037853 Bacteria 7266
203 Ga0436364_1305532 3300037853 Bacteria 4648
204 Ga0395901_0030797 3300038443 Bacteria 5528
205 Ga0395901_0281462 3300038443 Bacteria 1728
206 Ga0436363_0889997 3300039450 Bacteria 1993
207 Ga0436363_0914108 3300039450 Bacteria 1100
208 Ga0436363_1015974 3300039450 Bacteria 1457
209 Ga0451853_1448748 3300041512 Bacteria 1545
210 Ga0439448_0026823 3300042005 Bacteria 1813
211 Ga0439460_0046205 3300042461 Bacteria 1293
212 Ga0466963_0012189 3300044694 Bacteria 5257
213 Ga0495592_0057575 3300046454 Bacteria 2868
214 Ga0495641_0002970 3300046461 Bacteria 13038
215 Ga0495651_0004509 3300046462 Bacteria 10656
216 Ga0495653_0013450 3300046463 Bacteria 6667
217 Ga0495639_0034959 3300046475 Bacteria 2248
218 Ga0495664_0028122 3300046477 Bacteria 3282
219 Ga0495664_0062071 3300046477 Bacteria 2225
220 Ga0495608_0115829 3300046511 Bacteria 1720
221 Ga0495618_0062657 3300046514 Bacteria 2360
222 Ga0495628_0099297 3300046516 Bacteria 2248
223 Ga0495628_0104632 3300046516 Bacteria 2181
224 Ga0495628_0179736 3300046516 Bacteria 1601
225 Ga0495652_0249619 3300046529 Bacteria 1315
226 Ga0495640_0001256 3300046533 Bacteria 19903
227 Ga0495587_0137375 3300046536 Bacteria 1396
228 Ga0495645_0015540 3300046543 Bacteria 5414
229 Ga0495667_0033746 3300046559 Bacteria 3424
230 Ga0495667_0109760 3300046559 Bacteria 1782
231 Ga0495667_0159841 3300046559 Bacteria 1449
232 Ga0495635_0000480 3300046663 Bacteria 25170
233 Ga0495635_0021884 3300046663 Bacteria 4456
234 Ga0495635_0053587 3300046663 Bacteria 2779
235 Ga0495635_0146690 3300046663 Bacteria 1606
236 Ga0495657_0076012 3300046675 Bacteria 2182
237 Ga0495657_0090319 3300046675 Bacteria 1966
238 Ga0495599_0004397 3300046678 Bacteria 8347
239 Ga0495623_0081654 3300046679 Bacteria 1999
240 Ga0495624_0027280 3300046690 Bacteria 3739
241 Ga0495600_0024290 3300046809 Bacteria 3901
242 Ga0495600_0133201 3300046809 Bacteria 1615
243 Ga0495674_0000991 3300047319 Bacteria 27284
244 Ga0495674_0197174 3300047319 Bacteria 1672
245 Ga0495676_0007968 3300047321 Bacteria 9710
246 Ga0495680_0014159 3300047322 Bacteria 6925
247 Ga0495680_0026879 3300047322 Bacteria 4737
248 Ga0495680_0055047 3300047322 Bacteria 3086
249 Ga0495675_0047537 3300047444 Bacteria 2730
250 Ga0495684_0002006 3300047471 Bacteria 16371
251 Ga0495684_0019775 3300047471 Bacteria 5188
252 Ga0495684_0043769 3300047471 Bacteria 3428
253 Ga0495593_0071873 3300047673 Bacteria 1797
254 Ga0496100_0026503 3300048903 Bacteria 3554
255 Ga0496102_0143394 3300048905 Bacteria 2241
256 Ga0496104_0052538 3300048907 Bacteria 3849
257 Ga0496105_0014495 3300048908 Bacteria 6275
258 Ga0496108_0019913 3300048911 Bacteria 5511
259 Ga0496109_0026192 3300048912 Bacteria 5199
260 Ga0496109_0121600 3300048912 Bacteria 2432
261 Ga0496109_0289195 3300048912 Bacteria 1545
262 Ga0496112_0104776 3300048915 Bacteria 2798
263 Ga0496112_0162426 3300048915 Bacteria 2200
264 Ga0496113_0075697 3300048916 Bacteria 2569
265 Ga0496114_0068809 3300048917 Bacteria 2972
266 Ga0496115_0071811 3300048918 Bacteria 2807
267 Ga0496120_0063284 3300048923 Bacteria 2059
268 Ga0496126_0053824 3300048929 Bacteria 3649
269 Ga0501031_0010678 3300049568 Bacteria 5982
270 Ga0501031_0012594 3300049568 Bacteria 5524
271 Ga0501031_0163656 3300049568 Bacteria 1454
272 Ga0501036_0000074 3300049572 Bacteria 61249
273 Ga0501037_0006547 3300049573 Bacteria 8525
274 Ga0501037_0149460 3300049573 Bacteria 1670
275 Ga0501038_0006080 3300049574 Bacteria 11169
276 Ga0501038_0041451 3300049574 Bacteria 4015
277 Ga0501039_0001467 3300049575 Bacteria 17352
278 Ga0501039_0007204 3300049575 Bacteria 8477
279 Ga0501040_0003987 3300049576 Bacteria 9590
280 Ga0501040_0019488 3300049576 Bacteria 4512
281 Ga0501040_0024541 3300049576 Bacteria 4046
282 Ga0501041_0001166 3300049577 Bacteria 14379
283 Ga0501041_0085592 3300049577 Bacteria 1944
284 Ga0501042_0000549 3300049578 Bacteria 19751
285 Ga0501042_0008556 3300049578 Bacteria 6765
286 Ga0501046_0002381 3300049580 Bacteria 17663
287 Ga0501046_0117343 3300049580 Bacteria 2027
288 Ga0501047_0102872 3300049581 Bacteria 2736
289 Ga0501048_0000131 3300049582 Bacteria 44396
290 Ga0501071_0003807 3300049587 Bacteria 9484
291 Ga0501071_0011211 3300049587 Bacteria 6030
292 Ga0501072_0001196 3300049588 Bacteria 19369
293 Ga0501074_0003519 3300049590 Bacteria 11116
294 Ga0501074_0079000 3300049590 Bacteria 2361
295 Ga0501075_0001756 3300049591 Bacteria 14249
296 Ga0501075_0005538 3300049591 Bacteria 8641
297 Ga0501076_0002006 3300049592 Bacteria 13924
298 Ga0501076_0003228 3300049592 Bacteria 11401
299 Ga0501077_0000389 3300049593 Bacteria 26381
300 Ga0501079_0001319 3300049741 Bacteria 17438
301 Ga0501081_0032005 3300049743 Bacteria 3566
302 Ga0501045_0003116 3300049824 Bacteria 11341
303 nmdc:mga00v17_174854_c1 3300050491 Bacteria 1385
304 nmdc:mga05p37_1227_c2 3300050507 Bacteria 26179
305 nmdc:mga05p37_2029_c1 3300050507 Bacteria 23607
306 nmdc:mga06r32_5402_c1 3300050510 Bacteria 11498
307 nmdc:mga08y16_18374_c1 3300050511 Bacteria 7370
308 Ga0501084_0000315 3300054114 Bacteria 36761
309 Ga0501084_0156883 3300054114 Bacteria 1919
310 Ga0501082_0056341 3300060353 Bacteria 3385
311 Ga0530510_0000933 3300061734 Bacteria 19320
312 Ga0530510_0086324 3300061734 Bacteria 2286
313 2884695308 2884693830 Bacteria 11273186
314 2895435015 2895427314 Bacteria 13147766
315 2895445984 2895442618 Bacteria 11027144
316 8008491065 8008485437 Bacteria 7198341
317 8025530394 8025524527 Bacteria 7197316
318 8033689467 8033684223 Bacteria 6906479
319 8056830259 8056829672 Bacteria 9045328
320 Ga0070678_100194542
321 JGI25406J46586_10005677
322 Ga0070658_10039443
323 Ga0070683_100270763
324 Ga0070666_10152997
325 Ga0070660_100094607
326 Ga0070675_100109818
327 Ga0070667_100162219
328 Ga0070709_10000701
329 Ga0070714_100000731
330 Ga0070714_100004064
331 Ga0070714_100036348
332 Ga0070714_100325658
333 Ga0070714_100338122
334 Ga0070713_100024057
335 Ga0070713_100040929
336 Ga0070713_100167982
337 Ga0070713_100241732
338 Ga0070710_10000411
339 Ga0070710_10043134
340 Ga0070710_10052727
341 Ga0070710_10125290
342 Ga0070711_100002526
343 Ga0070705_100066347
344 Ga0070700_100064259
345 Ga0070663_100017071
346 Ga0070681_10081969
347 Ga0070679_100094056
348 Ga0070679_100275532
349 Ga0070684_100134683
350 Ga0070684_100222306
351 Ga0070684_100309016
352 Ga0070697_100056683
353 Ga0070686_100065386
354 Ga0070704_100046635
355 Ga0068855_100151912
356 Ga0070664_100349548
357 Ga0068857_100153121
358 Ga0068857_100167421
359 Ga0068852_100034445
360 Ga0068864_100154999
361 Ga0068864_100176112
362 Ga0081455_10006096
363 Ga0081538_10002128
364 Ga0081538_10004340
365 Ga0081538_10030098
366 Ga0081540_1001418
367 Ga0081539_10001770
368 Ga0081539_10012815
369 Ga0075365_10239142
370 Ga0075364_10114736
371 Ga0075432_10003681
372 Ga0070715_10055364
373 Ga0070716_100000316
374 Ga0070716_100093379
375 Ga0070716_100121831
376 Ga0070716_100123927
377 Ga0070712_100001872
378 Ga0070712_100184916
379 Ga0097621_100127763
380 Ga0075428_100027356
381 Ga0075431_100023337
382 Ga0075433_10150907
383 Ga0075434_100177860
384 Ga0075436_100040973
385 Ga0111539_10011053
386 Ga0114129_10000301
387 Ga0105237_10165143
388 Ga0099796_10043335
389 Ga0157370_10027927
390 Ga0157369_10151784
391 Ga0157374_10616998
392 Ga0157375_10237189
393 Ga0163163_10016019
394 Ga0163163_10112265
395 Ga0182008_10125282
396 Ga0157376_10071250
397 Ga0197907_10400873
398 Ga0206356_10861745
399 Ga0206354_10053826
400 Ga0206353_10086265
401 Ga0206353_10409716
402 Ga0224712_10107451
403 Ga0224572_1002370
404 Ga0207692_10000708
405 Ga0207692_10012326
406 Ga0207688_10030401
407 Ga0207647_10179179
408 Ga0207699_10000918
409 Ga0207707_10044745
410 Ga0207693_10020439
411 Ga0207693_10098232
412 Ga0207693_10295481
413 Ga0207663_10020741
414 Ga0207663_10021902
415 Ga0207660_10101009
416 Ga0207662_10057823
417 Ga0207657_10044022
418 Ga0207657_10054406
419 Ga0207652_10138804
420 Ga0207681_10209500
421 Ga0207694_10215145
422 Ga0207700_10000662
423 Ga0207700_10013911
424 Ga0207700_10029268
425 Ga0207700_10089811
426 Ga0207700_10102033
427 Ga0207700_10156601
428 Ga0207700_10315657
429 Ga0207664_10001227
430 Ga0207664_10001823
431 Ga0207664_10020913
432 Ga0207664_10049535
433 Ga0207664_10054357
434 Ga0207664_10066155
435 Ga0207664_10072244
436 Ga0207664_10080461
437 Ga0207664_10159426
438 Ga0207665_10000242
439 Ga0207691_10048478
440 Ga0207689_10021663
441 Ga0207661_10023876
442 Ga0207679_10109172
443 Ga0207667_10145682
444 Ga0207651_10228823
445 Ga0207658_10168311
446 Ga0207678_10001935
447 Ga0207678_10009944
448 Ga0207678_10039329
449 Ga0207708_10072058
450 Ga0207702_10114478
451 Ga0207674_10024106
452 Ga0207674_10049494
453 Ga0207674_10103990
454 Ga0207675_100104332
455 Ga0268265_10332878
456 Ga0265337_1000845
457 Ga0265326_10016248
458 Ga0265319_1001569
459 Ga0265334_10000262
460 Ga0265318_10034807
461 Ga0265323_10003554
462 Ga0265336_10003088
463 Ga0265338_10002395
464 Ga0265332_10001394
465 Ga0265320_10003062
466 Ga0265325_10015707
467 Ga0265340_10001263
468 Ga0265339_10026547
469 Ga0265316_10005820
470 Ga0307408_100050050
471 Ga0265314_10009063
472 Ga0265342_10004830
473 Ga0307405_10033530
474 Ga0307410_10144617
475 Ga0307410_10191796
476 Ga0307406_10050013
477 Ga0307406_10304124
478 Ga0307407_10021806
479 Ga0307407_10042746
480 Ga0307409_100024271
481 Ga0307409_100220047
482 Ga0307416_100027312
483 Ga0307416_100330512
484 Ga0307414_10197498
485 Ga0307415_100034522
486 Ga0307415_100090180
487 Ga0307415_100120599
488 Ga0307415_100189038
489 Ga0373958_0027108
490 Ga0373926_0000133
491 Ga0373928_0010069
492 Ga0373944_0000812
493 Ga0373951_0027377
494 Ga0373952_0003020
495 Ga0373923_0066454
496 Ga0373936_0000122
497 Ga0373936_0081869
498 Ga0373945_0000671
499 Ga0373953_0065001
500 Ga0373956_0154511
501 Ga0373960_0035227
502 Ga0373943_0000374
503 Ga0373946_0000106
504 Ga0373955_0063365
505 Ga0373961_0073183
506 Ga0373962_0019986
507 Ga0373935_0000428
508 Ga0373935_0112455
509 Ga0373927_0001916
510 Ga0373933_0030911
511 Ga0373933_0046341
512 Ga0373947_0000482
513 Ga0373947_0032354
514 Ga0373937_0078623
515 Ga0373937_0153248
516 Ga0373937_0171232
517 Ga0373925_0000009
518 Ga0373925_0003478
519 Ga0373925_0007632
520 Ga0395905_0096370
521 Ga0436364_0342126
522 Ga0436364_1305532
523 Ga0395901_0030797
524 Ga0395901_0281462
525 Ga0436363_0889997
526 Ga0436363_0914108
527 Ga0436363_1015974
528 Ga0451853_1448748
529 Ga0439448_0026823
530 Ga0439460_0046205
531 Ga0466963_0012189
532 Ga0495592_0057575
533 Ga0495641_0002970
534 Ga0495651_0004509
535 Ga0495653_0013450
536 Ga0495639_0034959
537 Ga0495664_0028122
538 Ga0495664_0062071
539 Ga0495608_0115829
540 Ga0495618_0062657
541 Ga0495628_0099297
542 Ga0495628_0104632
543 Ga0495628_0179736
544 Ga0495652_0249619
545 Ga0495640_0001256
546 Ga0495587_0137375
547 Ga0495645_0015540
548 Ga0495667_0033746
549 Ga0495667_0109760
550 Ga0495667_0159841
551 Ga0495635_0000480
552 Ga0495635_0021884
553 Ga0495635_0053587
554 Ga0495635_0146690
555 Ga0495657_0076012
556 Ga0495657_0090319
557 Ga0495599_0004397
558 Ga0495623_0081654
559 Ga0495624_0027280
560 Ga0495600_0024290
561 Ga0495600_0133201
562 Ga0495674_0000991
563 Ga0495674_0197174
564 Ga0495676_0007968
565 Ga0495680_0014159
566 Ga0495680_0026879
567 Ga0495680_0055047
568 Ga0495675_0047537
569 Ga0495684_0002006
570 Ga0495684_0019775
571 Ga0495684_0043769
572 Ga0495593_0071873
573 Ga0496100_0026503
574 Ga0496102_0143394
575 Ga0496104_0052538
576 Ga0496105_0014495
577 Ga0496108_0019913
578 Ga0496109_0026192
579 Ga0496109_0121600
580 Ga0496109_0289195
581 Ga0496112_0104776
582 Ga0496112_0162426
583 Ga0496113_0075697
584 Ga0496114_0068809
585 Ga0496115_0071811
586 Ga0496120_0063284
587 Ga0496126_0053824
588 Ga0501031_0010678
589 Ga0501031_0012594
590 Ga0501031_0163656
591 Ga0501036_0000074
592 Ga0501037_0006547
593 Ga0501037_0149460
594 Ga0501038_0006080
595 Ga0501038_0041451
596 Ga0501039_0001467
597 Ga0501039_0007204
598 Ga0501040_0003987
599 Ga0501040_0019488
600 Ga0501040_0024541
601 Ga0501041_0001166
602 Ga0501041_0085592
603 Ga0501042_0000549
604 Ga0501042_0008556
605 Ga0501046_0002381
606 Ga0501046_0117343
607 Ga0501047_0102872
608 Ga0501048_0000131
609 Ga0501071_0003807
610 Ga0501071_0011211
611 Ga0501072_0001196
612 Ga0501074_0003519
613 Ga0501074_0079000
614 Ga0501075_0001756
615 Ga0501075_0005538
616 Ga0501076_0002006
617 Ga0501076_0003228
618 Ga0501077_0000389
619 Ga0501079_0001319
620 Ga0501081_0032005
621 Ga0501045_0003116
622 nmdc:mga00v17_174854_c1
623 nmdc:mga05p37_1227_c2
624 nmdc:mga05p37_2029_c1
625 nmdc:mga06r32_5402_c1
626 nmdc:mga08y16_18374_c1
627 Ga0501084_0000315
628 Ga0501084_0156883
629 Ga0501082_0056341
630 Ga0530510_0000933
631 Ga0530510_0086324
632 2884695308
633 2895435015
634 2895445984
635 8008491065
636 8025530394
637 8033689467
638 8056830259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

110

163

0.95

PF04542

Sigma70_r2

Sigma-70 region 2

10

77

0.93

PF12680

SnoaL_2

SnoaL-like domain

186

291

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9566 113 165
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.941 109 165
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.924 113 166
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9157 118 164
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9131 123 161
ID Description Score Start End Superfamily
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9368 123 161 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 113 164 1.10.10.10
4l5iD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9182 123 161 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9174 110 165 1.10.10.10
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9131 123 161 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9X3I2-F1-model_v4 Uncharacterized protein 0.9639 181 272 GO:0016987
AF-A0A7V3BSZ6-F1-model_v4 DUF4440 domain-containing protein 0.9467 165 266 GO:0016987
AF-A0A7W3ZLP2-F1-model_v4 RNA polymerase sigma-70 factor 0.9409 165 266 GO:0016987
AF-A0A7Y4HW88-F1-model_v4 Uncharacterized protein 0.8798 164 284 GO:0016987
AF-A0A5C7MY28-F1-model_v4 RNA polymerase subunit sigma-24 0.8714 164 276 GO:0016987

Map