F404956

General Info

Members Datasets Scaffolds Average Seq Length
319 225 638 163

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000406|Ga0070709_100004066
Length 171
Sequence MVKLMGQAMPKPALRPFLPADTPVLAAIFAAAVEELTGDDYSEAQQEAWAAIAEDEDAFGKKLASELTLIATLQSAPVGFASLKGKDHIDMLYVHPGAAGQGVASMLLDALEKLAGSRGAENLTVDASDNAQTFFAKRGYVAKQRNSVTVNGEWLANTTMQKTLSNGGNKP

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
223 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
224 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
225 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.31
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 1.25
Rhizoplane 5.64
Rhizosphere 82.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10000406 3300005434 Bacteria 26303
2 rootL2_10179953 3300003322 Bacteria 1351
3 Ga0070676_10496416 3300005328 Bacteria 866
4 Ga0070683_100245111 3300005329 Bacteria 1704
5 Ga0070680_100181270 3300005336 Bacteria 1774
6 Ga0070660_100356499 3300005339 Bacteria 1205
7 Ga0070661_101155065 3300005344 Bacteria 646
8 Ga0070709_10449308 3300005434 Bacteria 971
9 Ga0070714_100039388 3300005435 Bacteria 3979
10 Ga0070714_101767616 3300005435 Bacteria 604
11 Ga0070713_100037169 3300005436 Bacteria 3936
12 Ga0070710_10005899 3300005437 Bacteria 5850
13 Ga0070711_100010476 3300005439 Bacteria 5740
14 Ga0070711_100039421 3300005439 Bacteria 3182
15 Ga0070711_100548478 3300005439 Bacteria 959
16 Ga0070678_100198468 3300005456 Bacteria 1654
17 Ga0070681_10009544 3300005458 Bacteria 9549
18 Ga0070681_10138518 3300005458 Bacteria 2363
19 Ga0070681_10322094 3300005458 Bacteria 1455
20 Ga0070706_101783500 3300005467 Bacteria 560
21 Ga0070679_100097496 3300005530 Bacteria 2927
22 Ga0070679_100462363 3300005530 Bacteria 1213
23 Ga0070684_100315590 3300005535 Bacteria 1435
24 Ga0068853_100386060 3300005539 Bacteria 1308
25 Ga0070686_100625829 3300005544 Bacteria 851
26 Ga0068854_100945773 3300005578 Bacteria 760
27 Ga0068854_101781911 3300005578 Bacteria 564
28 Ga0068856_100093920 3300005614 Bacteria 2986
29 Ga0068852_100212271 3300005616 Bacteria 1837
30 Ga0068852_101048510 3300005616 Bacteria 835
31 Ga0068852_101429501 3300005616 Bacteria 714
32 Ga0068864_101408865 3300005618 Bacteria 699
33 Ga0068866_10087762 3300005718 Bacteria 1686
34 Ga0068861_101693741 3300005719 Bacteria 625
35 Ga0068860_100001463 3300005843 Bacteria 25530
36 Ga0068860_100042694 3300005843 Bacteria 4329
37 Ga0081455_10209286 3300005937 Bacteria 1454
38 Ga0081540_1007977 3300005983 Bacteria 7458
39 Ga0081540_1016287 3300005983 Bacteria 4659
40 Ga0081540_1032066 3300005983 Bacteria 2875
41 Ga0081539_10000148 3300005985 Bacteria 163442
42 Ga0081539_10019020 3300005985 Bacteria 4728
43 Ga0081539_10068476 3300005985 Bacteria 1914
44 Ga0070717_10037157 3300006028 Bacteria 3954
45 Ga0070717_10923321 3300006028 Bacteria 795
46 Ga0075363_100050961 3300006048 Bacteria 2206
47 Ga0070712_100076524 3300006175 Bacteria 2410
48 Ga0070712_100217048 3300006175 Bacteria 1512
49 Ga0075433_10305364 3300006852 Bacteria 1409
50 Ga0075435_100734443 3300007076 Bacteria 859
51 Ga0105250_10232452 3300009092 Bacteria 784
52 Ga0105240_10056536 3300009093 Bacteria 4909
53 Ga0105240_10197146 3300009093 Bacteria 2363
54 Ga0105240_10249559 3300009093 Bacteria 2053
55 Ga0105240_10274075 3300009093 Bacteria 1941
56 Ga0105240_11349074 3300009093 Bacteria 751
57 Ga0105245_10930233 3300009098 Bacteria 912
58 Ga0105241_10076461 3300009174 Bacteria 2611
59 Ga0105248_10973028 3300009177 Bacteria 958
60 Ga0105237_10315977 3300009545 Bacteria 1565
61 Ga0105238_10053272 3300009551 Bacteria 4066
62 Ga0105238_10149675 3300009551 Bacteria 2309
63 Ga0105238_10604945 3300009551 Bacteria 1104
64 Ga0105238_10985050 3300009551 Bacteria 864
65 Ga0105239_10615037 3300010375 Bacteria 1240
66 Ga0157315_1010479 3300012508 Bacteria 818
67 Ga0157370_10219655 3300013104 Bacteria 1760
68 Ga0157370_10279313 3300013104 Bacteria 1543
69 Ga0157369_10432567 3300013105 Bacteria 1363
70 Ga0157369_10441786 3300013105 Bacteria 1347
71 Ga0157369_10630344 3300013105 Bacteria 1106
72 Ga0157369_12013532 3300013105 Bacteria 586
73 Ga0157374_10663344 3300013296 Bacteria 1055
74 Ga0157374_11220740 3300013296 Bacteria 773
75 Ga0157374_11230501 3300013296 Bacteria 770
76 Ga0157378_11969331 3300013297 Bacteria 634
77 Ga0163162_12062011 3300013306 Bacteria 654
78 Ga0157372_10951727 3300013307 Bacteria 995
79 Ga0157375_10291108 3300013308 Bacteria 1796
80 Ga0157380_10702413 3300014326 Bacteria 1016
81 Ga0157380_10844355 3300014326 Bacteria 937
82 Ga0157376_11119443 3300014969 Bacteria 814
83 Ga0157376_11380103 3300014969 Bacteria 736
84 Ga0206354_11130219 3300020081 Bacteria 1186
85 Ga0213876_10008286 3300021384 Bacteria 5624
86 Ga0213871_10026904 3300021441 Bacteria 1474
87 Ga0209758_1006093 3300025297 Bacteria 8858
88 Ga0207696_1054942 3300025711 Bacteria 1131
89 Ga0207692_10000854 3300025898 Bacteria 10952
90 Ga0207642_10145963 3300025899 Bacteria 1253
91 Ga0207688_10086246 3300025901 Bacteria 1799
92 Ga0207688_10583369 3300025901 Bacteria 704
93 Ga0207685_10334793 3300025905 Bacteria 759
94 Ga0207699_10055553 3300025906 Bacteria 2356
95 Ga0207699_10124660 3300025906 Bacteria 1671
96 Ga0207699_10163458 3300025906 Bacteria 1484
97 Ga0207699_10185681 3300025906 Bacteria 1400
98 Ga0207643_10126047 3300025908 Bacteria 1520
99 Ga0207707_10000795 3300025912 Bacteria 30937
100 Ga0207707_10020220 3300025912 Bacteria 5813
101 Ga0207707_10197231 3300025912 Bacteria 1756
102 Ga0207707_10353145 3300025912 Bacteria 1267
103 Ga0207707_10439109 3300025912 Bacteria 1117
104 Ga0207695_10086785 3300025913 Bacteria 3154
105 Ga0207695_10233054 3300025913 Bacteria 1745
106 Ga0207695_10236703 3300025913 Bacteria 1728
107 Ga0207671_10913908 3300025914 Bacteria 694
108 Ga0207693_10007171 3300025915 Bacteria 9182
109 Ga0207693_10009756 3300025915 Bacteria 7817
110 Ga0207693_10204934 3300025915 Bacteria 1551
111 Ga0207663_10031222 3300025916 Bacteria 3151
112 Ga0207663_10446160 3300025916 Bacteria 997
113 Ga0207663_10471057 3300025916 Bacteria 972
114 Ga0207660_10161158 3300025917 Bacteria 1731
115 Ga0207660_10221164 3300025917 Bacteria 1486
116 Ga0207657_10317298 3300025919 Bacteria 1233
117 Ga0207652_10024650 3300025921 Bacteria 4992
118 Ga0207652_10326983 3300025921 Bacteria 1384
119 Ga0207681_10301500 3300025923 Bacteria 1268
120 Ga0207694_10902843 3300025924 Bacteria 747
121 Ga0207694_11169005 3300025924 Bacteria 651
122 Ga0207700_10014844 3300025928 Bacteria 5116
123 Ga0207700_10191729 3300025928 Bacteria 1718
124 Ga0207700_10192052 3300025928 Bacteria 1716
125 Ga0207664_10052232 3300025929 Bacteria 3232
126 Ga0207664_10988080 3300025929 Bacteria 754
127 Ga0207664_11032898 3300025929 Bacteria 736
128 Ga0207706_10699283 3300025933 Bacteria 866
129 Ga0207669_10455237 3300025937 Bacteria 1015
130 Ga0207665_10009230 3300025939 Bacteria 6475
131 Ga0207665_10046805 3300025939 Bacteria 2898
132 Ga0207689_10065164 3300025942 Bacteria 2997
133 Ga0207661_10015005 3300025944 Bacteria 5689
134 Ga0207661_10121793 3300025944 Bacteria 2221
135 Ga0207661_10296494 3300025944 Bacteria 1448
136 Ga0207667_10468778 3300025949 Bacteria 1279
137 Ga0207667_10480127 3300025949 Bacteria 1262
138 Ga0207712_10456388 3300025961 Bacteria 1085
139 Ga0207640_10072132 3300025981 Bacteria 2328
140 Ga0207640_11470252 3300025981 Bacteria 612
141 Ga0207639_10576920 3300026041 Bacteria 1035
142 Ga0207678_10250926 3300026067 Bacteria 1515
143 Ga0207702_10047141 3300026078 Bacteria 3630
144 Ga0207702_12201775 3300026078 Bacteria 540
145 Ga0207648_11590244 3300026089 Bacteria 614
146 Ga0207674_10058081 3300026116 Bacteria 3921
147 Ga0207674_10219658 3300026116 Bacteria 1849
148 Ga0207675_100596772 3300026118 Bacteria 1107
149 Ga0207675_101171133 3300026118 Bacteria 789
150 Ga0207698_10352203 3300026142 Bacteria 1391
151 Ga0207698_10639950 3300026142 Bacteria 1052
152 Ga0207698_11072566 3300026142 Bacteria 818
153 Ga0268266_10124711 3300028379 Bacteria 2296
154 Ga0268266_10420339 3300028379 Bacteria 1267
155 Ga0268266_11378171 3300028379 Bacteria 681
156 Ga0268264_10000065 3300028381 Bacteria 298403
157 Ga0265318_10154631 3300028577 Bacteria 841
158 Ga0265320_10114837 3300031240 Bacteria 1231
159 Ga0265340_10065338 3300031247 Bacteria 1732
160 Ga0307509_10119163 3300031507 Bacteria 2621
161 Ga0307408_100139875 3300031548 Bacteria 1899
162 Ga0307508_10752296 3300031616 Bacteria 588
163 Ga0307516_10130941 3300031730 Bacteria 2287
164 Ga0307410_10618553 3300031852 Bacteria 905
165 Ga0307406_10301080 3300031901 Bacteria 1232
166 Ga0307510_10016778 3300033180 Bacteria 8639
167 Ga0373926_0008981 3300035083 Bacteria 3333
168 Ga0373944_0233478 3300035089 Bacteria 675
169 Ga0373923_0013993 3300035111 Bacteria 3004
170 Ga0373936_0074367 3300035113 Bacteria 1405
171 Ga0373953_0070133 3300035117 Bacteria 1445
172 Ga0373953_0101546 3300035117 Bacteria 1211
173 Ga0373954_0094809 3300035118 Bacteria 1436
174 Ga0373956_0353543 3300035119 Bacteria 700
175 Ga0373946_0355046 3300035171 Bacteria 733
176 Ga0373955_0060145 3300035172 Bacteria 2094
177 Ga0373924_0023452 3300035410 Bacteria 2421
178 Ga0373931_0520743 3300035691 Bacteria 769
179 Ga0373935_0073667 3300035692 Bacteria 2206
180 Ga0373927_0016163 3300035695 Bacteria 4924
181 Ga0373927_0083368 3300035695 Bacteria 2072
182 Ga0373927_0870252 3300035695 Bacteria 595
183 Ga0373933_0088923 3300035724 Bacteria 1903
184 Ga0373947_0020449 3300035725 Bacteria 3821
185 Ga0373947_0167498 3300035725 Bacteria 1424
186 Ga0373947_0614748 3300035725 Bacteria 741
187 Ga0373937_0787654 3300036401 Bacteria 898
188 Ga0373925_0034252 3300037068 Bacteria 3742
189 Ga0395900_0363174 3300037418 Bacteria 1419
190 Ga0395898_0072398 3300037466 Bacteria 3330
191 Ga0395901_1167757 3300038443 Bacteria 737
192 Ga0436365_0509169 3300039437 Bacteria 16434
193 Ga0436365_1129372 3300039437 Bacteria 1602
194 Ga0436365_1240829 3300039437 Bacteria 1218
195 Ga0436363_0268581 3300039450 Bacteria 1359
196 Ga0436363_0597459 3300039450 Bacteria 806
197 Ga0436362_0292706 3300039453 Bacteria 1090
198 Ga0451791_0689873 3300041451 Bacteria 564
199 Ga0451847_0787587 3300041503 Bacteria 778
200 Ga0466965_0304943 3300044683 Bacteria 865
201 Ga0466963_0017577 3300044694 Bacteria 4460
202 Ga0466964_0110495 3300044706 Bacteria 1225
203 Ga0466957_0317505 3300044842 Bacteria 1050
204 Ga0466959_0073458 3300045049 Bacteria 2474
205 Ga0466967_0347649 3300045976 Bacteria 1435
206 Ga0495617_176100 3300046452 Bacteria 674
207 Ga0495603_0051556 3300046455 Bacteria 2445
208 Ga0495603_0090086 3300046455 Bacteria 1794
209 Ga0495629_0062388 3300046459 Bacteria 2604
210 Ga0495653_0604479 3300046463 Bacteria 674
211 Ga0495580_0002861 3300046472 Bacteria 14858
212 Ga0495582_0107716 3300046473 Bacteria 1564
213 Ga0495605_0113269 3300046474 Bacteria 1236
214 Ga0495605_0356479 3300046474 Bacteria 613
215 Ga0495639_0007706 3300046475 Bacteria 4631
216 Ga0495662_0006361 3300046476 Bacteria 5903
217 Ga0495664_0111453 3300046477 Bacteria 1651
218 Ga0495584_0157497 3300046491 Bacteria 1154
219 Ga0495585_0131308 3300046492 Bacteria 1318
220 Ga0495594_0060959 3300046499 Bacteria 2087
221 Ga0495606_0181765 3300046507 Bacteria 1212
222 Ga0495618_0023712 3300046514 Bacteria 3797
223 Ga0495628_0112773 3300046516 Bacteria 2090
224 Ga0495648_0126920 3300046524 Bacteria 1362
225 Ga0495654_0308213 3300046530 Bacteria 645
226 Ga0495665_0060292 3300046531 Bacteria 2003
227 Ga0495640_0115795 3300046533 Bacteria 1746
228 Ga0495587_0539424 3300046536 Bacteria 644
229 Ga0495609_0214045 3300046538 Bacteria 802
230 Ga0495609_0449781 3300046538 Bacteria 512
231 Ga0495645_0019429 3300046543 Bacteria 4892
232 Ga0495667_0714611 3300046559 Bacteria 620
233 Ga0495656_0535754 3300046615 Bacteria 623
234 Ga0495611_0127038 3300046648 Bacteria 1189
235 Ga0495625_0238804 3300046660 Bacteria 1184
236 Ga0495625_0845682 3300046660 Bacteria 529
237 Ga0495635_0020750 3300046663 Bacteria 4577
238 Ga0495659_0064203 3300046664 Bacteria 1363
239 Ga0495659_0350080 3300046664 Bacteria 631
240 Ga0495661_0113527 3300046665 Bacteria 1507
241 Ga0495599_0066008 3300046678 Bacteria 2261
242 Ga0495599_0132060 3300046678 Bacteria 1550
243 Ga0495647_0126244 3300046681 Bacteria 1080
244 Ga0495658_0106536 3300046683 Bacteria 1680
245 Ga0495658_0681625 3300046683 Bacteria 658
246 Ga0495613_0294327 3300046689 Bacteria 1125
247 Ga0495624_0066800 3300046690 Bacteria 2244
248 Ga0495670_0216039 3300046691 Bacteria 1018
249 Ga0495670_0422839 3300046691 Bacteria 721
250 Ga0495671_0399427 3300046692 Bacteria 658
251 Ga0495600_0264480 3300046809 Bacteria 1092
252 Ga0495581_0032877 3300047315 Bacteria 3002
253 Ga0495604_0776903 3300047317 Bacteria 604
254 Ga0495636_0166882 3300047318 Bacteria 994
255 Ga0495674_0360335 3300047319 Bacteria 1179
256 Ga0495676_0360373 3300047321 Bacteria 971
257 Ga0495676_0942501 3300047321 Bacteria 552
258 Ga0495684_0056224 3300047471 Bacteria 3000
259 Ga0495686_0136724 3300047472 Bacteria 1449
260 Ga0495686_0315128 3300047472 Bacteria 859
261 Ga0495593_0022718 3300047673 Bacteria 3490
262 Ga0495614_0290981 3300048089 Bacteria 753
263 Ga0496100_0176345 3300048903 Bacteria 1543
264 Ga0496102_1009881 3300048905 Bacteria 752
265 Ga0496105_0099148 3300048908 Bacteria 2406
266 Ga0496106_0015378 3300048909 Bacteria 5664
267 Ga0496107_0028812 3300048910 Bacteria 3947
268 Ga0496108_0001546 3300048911 Bacteria 18202
269 Ga0496109_0000492 3300048912 Bacteria 33814
270 Ga0496109_0224619 3300048912 Bacteria 1766
271 Ga0496110_0040671 3300048913 Bacteria 4052
272 Ga0496110_0101602 3300048913 Bacteria 2578
273 Ga0496111_0238896 3300048914 Bacteria 1349
274 Ga0496111_0282394 3300048914 Bacteria 1231
275 Ga0496112_0039870 3300048915 Bacteria 4590
276 Ga0496113_0170933 3300048916 Bacteria 1721
277 Ga0496114_1064203 3300048917 Bacteria 693
278 Ga0496115_0106398 3300048918 Bacteria 2303
279 Ga0496115_0591856 3300048918 Bacteria 883
280 Ga0496116_0340558 3300048919 Bacteria 692
281 Ga0496118_0339830 3300048921 Bacteria 805
282 Ga0496121_0151084 3300048924 Bacteria 1709
283 Ga0496124_0000722 3300048927 Bacteria 54175
284 Ga0496125_0742366 3300048928 Bacteria 515
285 Ga0496126_0006670 3300048929 Bacteria 12833
286 Ga0496126_0115090 3300048929 Bacteria 2339
287 Ga0501047_0007800 3300049581 Bacteria 10076
288 Ga0501073_0185430 3300049589 Bacteria 1440
289 Ga0501074_0073207 3300049590 Bacteria 2462
290 Ga0501080_0006459 3300049742 Bacteria 10532
291 Ga0501044_0337064 3300049823 Bacteria 1430
292 nmdc:mga00v17_551335_c1 3300050491 Bacteria 745
293 nmdc:mga0k408_253488_c1 3300050493 Bacteria 1051
294 nmdc:mga06z11_346664_c1 3300050494 Bacteria 889
295 nmdc:mga06z11_499435_c1 3300050494 Bacteria 737
296 nmdc:mga06z11_771810_c1 3300050494 Bacteria 586
297 nmdc:mga07m45_709050_c1 3300050496 Bacteria 578
298 nmdc:mga0rr50_115103_c1 3300050513 Bacteria 2133
299 nmdc:mga0rr50_569502_c1 3300050513 Bacteria 965
300 nmdc:mga0a205_1595546_c1 3300050515 Bacteria 501
301 nmdc:mga0a205_463114_c1 3300050515 Bacteria 1127
302 nmdc:mga0sz30_160304_c1 3300050516 Bacteria 996
303 Ga0495601_0090006 3300053077 Bacteria 1974
304 Ga0495612_0011357 3300053078 Bacteria 3590
305 Ga0495612_0016214 3300053078 Bacteria 2986
306 Ga0495612_0031706 3300053078 Bacteria 2132
307 Ga0495595_0268780 3300053084 Bacteria 855
308 Ga0495619_0465488 3300053085 Bacteria 871
309 Ga0500566_0186381 3300053094 Bacteria 1060
310 Ga0500648_064855 3300053097 Bacteria 2069
311 Ga0500595_000802 3300053119 Bacteria 18212
312 Ga0500573_0027902 3300053140 Bacteria 3247
313 Ga0500589_103054 3300053147 Bacteria 1236
314 Ga0466962_0472018 3300061719 Bacteria 633
315 Ga0530510_0361817 3300061734 Bacteria 1091
316 2509151454 2508501128 Bacteria 8613869
317 2513696752 2513237101 Bacteria 7952346
318 2922391349 2922386360 Bacteria 7017218
319 8007000830 8006994254 Bacteria 8309700
320 Ga0070709_10000406
321 rootL2_10179953
322 Ga0070676_10496416
323 Ga0070683_100245111
324 Ga0070680_100181270
325 Ga0070660_100356499
326 Ga0070661_101155065
327 Ga0070709_10449308
328 Ga0070714_100039388
329 Ga0070714_101767616
330 Ga0070713_100037169
331 Ga0070710_10005899
332 Ga0070711_100010476
333 Ga0070711_100039421
334 Ga0070711_100548478
335 Ga0070678_100198468
336 Ga0070681_10009544
337 Ga0070681_10138518
338 Ga0070681_10322094
339 Ga0070706_101783500
340 Ga0070679_100097496
341 Ga0070679_100462363
342 Ga0070684_100315590
343 Ga0068853_100386060
344 Ga0070686_100625829
345 Ga0068854_100945773
346 Ga0068854_101781911
347 Ga0068856_100093920
348 Ga0068852_100212271
349 Ga0068852_101048510
350 Ga0068852_101429501
351 Ga0068864_101408865
352 Ga0068866_10087762
353 Ga0068861_101693741
354 Ga0068860_100001463
355 Ga0068860_100042694
356 Ga0081455_10209286
357 Ga0081540_1007977
358 Ga0081540_1016287
359 Ga0081540_1032066
360 Ga0081539_10000148
361 Ga0081539_10019020
362 Ga0081539_10068476
363 Ga0070717_10037157
364 Ga0070717_10923321
365 Ga0075363_100050961
366 Ga0070712_100076524
367 Ga0070712_100217048
368 Ga0075433_10305364
369 Ga0075435_100734443
370 Ga0105250_10232452
371 Ga0105240_10056536
372 Ga0105240_10197146
373 Ga0105240_10249559
374 Ga0105240_10274075
375 Ga0105240_11349074
376 Ga0105245_10930233
377 Ga0105241_10076461
378 Ga0105248_10973028
379 Ga0105237_10315977
380 Ga0105238_10053272
381 Ga0105238_10149675
382 Ga0105238_10604945
383 Ga0105238_10985050
384 Ga0105239_10615037
385 Ga0157315_1010479
386 Ga0157370_10219655
387 Ga0157370_10279313
388 Ga0157369_10432567
389 Ga0157369_10441786
390 Ga0157369_10630344
391 Ga0157369_12013532
392 Ga0157374_10663344
393 Ga0157374_11220740
394 Ga0157374_11230501
395 Ga0157378_11969331
396 Ga0163162_12062011
397 Ga0157372_10951727
398 Ga0157375_10291108
399 Ga0157380_10702413
400 Ga0157380_10844355
401 Ga0157376_11119443
402 Ga0157376_11380103
403 Ga0206354_11130219
404 Ga0213876_10008286
405 Ga0213871_10026904
406 Ga0209758_1006093
407 Ga0207696_1054942
408 Ga0207692_10000854
409 Ga0207642_10145963
410 Ga0207688_10086246
411 Ga0207688_10583369
412 Ga0207685_10334793
413 Ga0207699_10055553
414 Ga0207699_10124660
415 Ga0207699_10163458
416 Ga0207699_10185681
417 Ga0207643_10126047
418 Ga0207707_10000795
419 Ga0207707_10020220
420 Ga0207707_10197231
421 Ga0207707_10353145
422 Ga0207707_10439109
423 Ga0207695_10086785
424 Ga0207695_10233054
425 Ga0207695_10236703
426 Ga0207671_10913908
427 Ga0207693_10007171
428 Ga0207693_10009756
429 Ga0207693_10204934
430 Ga0207663_10031222
431 Ga0207663_10446160
432 Ga0207663_10471057
433 Ga0207660_10161158
434 Ga0207660_10221164
435 Ga0207657_10317298
436 Ga0207652_10024650
437 Ga0207652_10326983
438 Ga0207681_10301500
439 Ga0207694_10902843
440 Ga0207694_11169005
441 Ga0207700_10014844
442 Ga0207700_10191729
443 Ga0207700_10192052
444 Ga0207664_10052232
445 Ga0207664_10988080
446 Ga0207664_11032898
447 Ga0207706_10699283
448 Ga0207669_10455237
449 Ga0207665_10009230
450 Ga0207665_10046805
451 Ga0207689_10065164
452 Ga0207661_10015005
453 Ga0207661_10121793
454 Ga0207661_10296494
455 Ga0207667_10468778
456 Ga0207667_10480127
457 Ga0207712_10456388
458 Ga0207640_10072132
459 Ga0207640_11470252
460 Ga0207639_10576920
461 Ga0207678_10250926
462 Ga0207702_10047141
463 Ga0207702_12201775
464 Ga0207648_11590244
465 Ga0207674_10058081
466 Ga0207674_10219658
467 Ga0207675_100596772
468 Ga0207675_101171133
469 Ga0207698_10352203
470 Ga0207698_10639950
471 Ga0207698_11072566
472 Ga0268266_10124711
473 Ga0268266_10420339
474 Ga0268266_11378171
475 Ga0268264_10000065
476 Ga0265318_10154631
477 Ga0265320_10114837
478 Ga0265340_10065338
479 Ga0307509_10119163
480 Ga0307408_100139875
481 Ga0307508_10752296
482 Ga0307516_10130941
483 Ga0307410_10618553
484 Ga0307406_10301080
485 Ga0307510_10016778
486 Ga0373926_0008981
487 Ga0373944_0233478
488 Ga0373923_0013993
489 Ga0373936_0074367
490 Ga0373953_0070133
491 Ga0373953_0101546
492 Ga0373954_0094809
493 Ga0373956_0353543
494 Ga0373946_0355046
495 Ga0373955_0060145
496 Ga0373924_0023452
497 Ga0373931_0520743
498 Ga0373935_0073667
499 Ga0373927_0016163
500 Ga0373927_0083368
501 Ga0373927_0870252
502 Ga0373933_0088923
503 Ga0373947_0020449
504 Ga0373947_0167498
505 Ga0373947_0614748
506 Ga0373937_0787654
507 Ga0373925_0034252
508 Ga0395900_0363174
509 Ga0395898_0072398
510 Ga0395901_1167757
511 Ga0436365_0509169
512 Ga0436365_1129372
513 Ga0436365_1240829
514 Ga0436363_0268581
515 Ga0436363_0597459
516 Ga0436362_0292706
517 Ga0451791_0689873
518 Ga0451847_0787587
519 Ga0466965_0304943
520 Ga0466963_0017577
521 Ga0466964_0110495
522 Ga0466957_0317505
523 Ga0466959_0073458
524 Ga0466967_0347649
525 Ga0495617_176100
526 Ga0495603_0051556
527 Ga0495603_0090086
528 Ga0495629_0062388
529 Ga0495653_0604479
530 Ga0495580_0002861
531 Ga0495582_0107716
532 Ga0495605_0113269
533 Ga0495605_0356479
534 Ga0495639_0007706
535 Ga0495662_0006361
536 Ga0495664_0111453
537 Ga0495584_0157497
538 Ga0495585_0131308
539 Ga0495594_0060959
540 Ga0495606_0181765
541 Ga0495618_0023712
542 Ga0495628_0112773
543 Ga0495648_0126920
544 Ga0495654_0308213
545 Ga0495665_0060292
546 Ga0495640_0115795
547 Ga0495587_0539424
548 Ga0495609_0214045
549 Ga0495609_0449781
550 Ga0495645_0019429
551 Ga0495667_0714611
552 Ga0495656_0535754
553 Ga0495611_0127038
554 Ga0495625_0238804
555 Ga0495625_0845682
556 Ga0495635_0020750
557 Ga0495659_0064203
558 Ga0495659_0350080
559 Ga0495661_0113527
560 Ga0495599_0066008
561 Ga0495599_0132060
562 Ga0495647_0126244
563 Ga0495658_0106536
564 Ga0495658_0681625
565 Ga0495613_0294327
566 Ga0495624_0066800
567 Ga0495670_0216039
568 Ga0495670_0422839
569 Ga0495671_0399427
570 Ga0495600_0264480
571 Ga0495581_0032877
572 Ga0495604_0776903
573 Ga0495636_0166882
574 Ga0495674_0360335
575 Ga0495676_0360373
576 Ga0495676_0942501
577 Ga0495684_0056224
578 Ga0495686_0136724
579 Ga0495686_0315128
580 Ga0495593_0022718
581 Ga0495614_0290981
582 Ga0496100_0176345
583 Ga0496102_1009881
584 Ga0496105_0099148
585 Ga0496106_0015378
586 Ga0496107_0028812
587 Ga0496108_0001546
588 Ga0496109_0000492
589 Ga0496109_0224619
590 Ga0496110_0040671
591 Ga0496110_0101602
592 Ga0496111_0238896
593 Ga0496111_0282394
594 Ga0496112_0039870
595 Ga0496113_0170933
596 Ga0496114_1064203
597 Ga0496115_0106398
598 Ga0496115_0591856
599 Ga0496116_0340558
600 Ga0496118_0339830
601 Ga0496121_0151084
602 Ga0496124_0000722
603 Ga0496125_0742366
604 Ga0496126_0006670
605 Ga0496126_0115090
606 Ga0501047_0007800
607 Ga0501073_0185430
608 Ga0501074_0073207
609 Ga0501080_0006459
610 Ga0501044_0337064
611 nmdc:mga00v17_551335_c1
612 nmdc:mga0k408_253488_c1
613 nmdc:mga06z11_346664_c1
614 nmdc:mga06z11_499435_c1
615 nmdc:mga06z11_771810_c1
616 nmdc:mga07m45_709050_c1
617 nmdc:mga0rr50_115103_c1
618 nmdc:mga0rr50_569502_c1
619 nmdc:mga0a205_1595546_c1
620 nmdc:mga0a205_463114_c1
621 nmdc:mga0sz30_160304_c1
622 Ga0495601_0090006
623 Ga0495612_0011357
624 Ga0495612_0016214
625 Ga0495612_0031706
626 Ga0495595_0268780
627 Ga0495619_0465488
628 Ga0500566_0186381
629 Ga0500648_064855
630 Ga0500595_000802
631 Ga0500573_0027902
632 Ga0500589_103054
633 Ga0466962_0472018
634 Ga0530510_0361817
635 2509151454
636 2513696752
637 2922391349
638 8007000830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

64

142

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

37

164

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

30

140

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiw-assembly1.cif.gz_A crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris 0.9516 1 160
2fiw-assembly1.cif.gz_A crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris 0.9457 1 160
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8989 62 159
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8897 62 161
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8779 62 159
ID Description Score Start End Superfamily
2fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9737 5 160 3.40.630.30
af_Q47158_1_148_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9553 5 159 3.40.630.30
2fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9552 5 160 3.40.630.30
af_Q47158_1_148_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9429 5 159 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8874 66 140 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A846DGZ9-F1-model_v4 GNAT family N-acetyltransferase 0.984 9 161 GO:0016747
AF-A0A522GPH4-F1-model_v4 GNAT family N-acetyltransferase 0.9828 1 165 GO:0016747
AF-A0A0B4XLZ9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9787 7 163 GO:0016747
AF-F4L6C5-F1-model_v4 GCN5-related N-acetyltransferase 0.9783 9 160 GO:0016747
AF-A0A2E1CV90-F1-model_v4 GNAT family N-acetyltransferase 0.9782 9 160 GO:0016747

Map