F404846

General Info

Members Datasets Scaffolds Average Seq Length
318 232 636 303

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000905|Ga0500616_0000905_27834_28748
Length 304
Sequence MSNDVVAPSLEAGPPASQVNYRELALRHGLSVSGSRTSLRDYVQQLWDRRHFILAFSKAKLTAQYSQAKLGQIWQVATPLLNAGVFYLVFGVLLAAKRGVADYIPFLVTGVFTWTYINSCVTAGVKAISGNLGLIRALHFPRASLPIALCIQQLQQLLYSLIVLFVILFSFGVPPTMHYFLMIPTLLLASGFSWGLALIVARAGSNTPDLAQLMPFLLRTWMYLSGVMYDLTTKAQHMPKEIRGLLPMNPAAVYIDLMRYSLIDSFHSSQLPPHVWPLALGWALLIGGGGFVYFWRAEETYGRG

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
21 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
22 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
23 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
26 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
32 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
37 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
38 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
39 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
40 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
41 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
42 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
43 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
44 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
45 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
46 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
47 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
48 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
49 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
73 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
158 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
159 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
163 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
164 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
165 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
166 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
167 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
168 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
169 2643221548 Streptomyces sp. Root55 Isolate Unclassified
170 2643221578 Streptomyces sp. Root63 Isolate Unclassified
171 2643221647 Streptomyces sp. Root369 Isolate Unclassified
172 2643221670 Streptomyces sp. Root431 Isolate Unclassified
173 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
174 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
175 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
176 2643221714 Streptomyces sp. Root264 Isolate Unclassified
177 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
178 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
179 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
180 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
181 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
182 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
183 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
184 2808606448 Streptomyces sp. 193411 Isolate Unclassified
185 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
186 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
187 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
188 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
189 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
190 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
191 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
192 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
193 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
194 2862574272 Streptomyces sp. AcE210 Isolate Nodule
195 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
196 2867428634 Streptomyces sp. RP5T Isolate Unclassified
197 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
198 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
199 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
200 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
201 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
202 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
203 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
204 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
205 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
206 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
207 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
208 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
209 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
210 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
211 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
212 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
213 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
214 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
215 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
216 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
217 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
218 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
219 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
220 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
221 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
222 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
223 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
224 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
225 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
226 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
227 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
228 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
229 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
230 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
231 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
232 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.73
Metatranscriptomes 0.63
Isolates 22.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 1.26
Rhizoplane 1.89
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000905 3300053153 Bacteria 32539
2 rootH1_10018221 3300003316 Bacteria 9288
3 rootH2_10003768 3300003320 Bacteria 12491
4 rootH1_10055552 3300003323 Bacteria 4675
5 rootH1_10055553 3300003323 Bacteria 1385
6 Ga0070682_100197421 3300005337 Bacteria 1417
7 Ga0068856_100123386 3300005614 Bacteria 2593
8 Ga0081455_10109536 3300005937 Bacteria 2198
9 Ga0075363_100000602 3300006048 Bacteria 11878
10 Ga0075367_10187747 3300006178 Bacteria 1289
11 Ga0099826_10059306 3300006948 Bacteria 2502
12 Ga0105251_10016495 3300009011 Bacteria 3989
13 Ga0105243_10313698 3300009148 Bacteria 1426
14 Ga0105239_10156333 3300010375 Bacteria 2546
15 Ga0157372_10289804 3300013307 Bacteria 1904
16 Ga0182008_10000665 3300014497 Bacteria 24929
17 Ga0182007_10001425 3300015262 Bacteria 12838
18 Ga0182005_1025886 3300015265 Bacteria 1601
19 Ga0207713_1022195 3300025735 Bacteria 3020
20 Ga0207647_10060302 3300025904 Bacteria 2319
21 Ga0307517_10006702 3300028786 Bacteria 16954
22 Ga0307515_10000163 3300028794 Bacteria 163159
23 Ga0307515_10140464 3300028794 Bacteria 2594
24 Ga0307511_10000150 3300030521 Bacteria 66178
25 Ga0307511_10140571 3300030521 Bacteria 1420
26 Ga0307512_10002523 3300030522 Bacteria 22925
27 Ga0307512_10028893 3300030522 Bacteria 4851
28 Ga0307513_10020326 3300031456 Bacteria 7879
29 Ga0307513_10091273 3300031456 Bacteria 3104
30 Ga0307509_10072727 3300031507 Bacteria 3581
31 Ga0307408_100358301 3300031548 Bacteria 1240
32 Ga0307508_10005082 3300031616 Bacteria 12622
33 Ga0307508_10026758 3300031616 Bacteria 5227
34 Ga0307508_10061713 3300031616 Bacteria 3311
35 Ga0307514_10025847 3300031649 Bacteria 4748
36 Ga0307514_10077440 3300031649 Bacteria 2473
37 Ga0307516_10002626 3300031730 Bacteria 23819
38 Ga0307516_10013194 3300031730 Bacteria 8823
39 Ga0307518_10109365 3300031838 Bacteria 1970
40 Ga0307510_10044446 3300033180 Bacteria 4811
41 Ga0307510_10053280 3300033180 Bacteria 4254
42 Ga0307510_10064068 3300033180 Bacteria 3736
43 Ga0395900_0031806 3300037418 Bacteria 5424
44 Ga0395898_0015938 3300037466 Bacteria 7702
45 Ga0395898_0023672 3300037466 Bacteria 6200
46 Ga0395898_0214654 3300037466 Bacteria 1835
47 Ga0395901_0023825 3300038443 Bacteria 6278
48 Ga0439436_0002576 3300041404 Bacteria 5454
49 Ga0451791_0118283 3300041451 Bacteria 1674
50 Ga0451795_1276844 3300041456 Bacteria 1139
51 Ga0451802_0028173 3300041460 Bacteria 1837
52 Ga0451851_0172658 3300041507 Bacteria 925
53 Ga0451853_0177550 3300041512 Bacteria 8101
54 Ga0451853_0751129 3300041512 Bacteria 2187
55 Ga0451853_0939466 3300041512 Bacteria 5254
56 Ga0439433_0002459 3300041999 Bacteria 3928
57 Ga0439433_0006466 3300041999 Bacteria 2521
58 Ga0439449_0001600 3300042007 Bacteria 8878
59 Ga0439449_0003189 3300042007 Bacteria 6390
60 Ga0439449_0036369 3300042007 Bacteria 1832
61 Ga0439450_005101 3300042008 Bacteria 2289
62 Ga0439457_000007 3300042014 Bacteria 43988
63 Ga0439457_003719 3300042014 Bacteria 4104
64 Ga0450896_002011 3300042133 Bacteria 2586
65 Ga0450899_000188 3300042135 Bacteria 6250
66 Ga0450903_000472 3300042138 Bacteria 8468
67 Ga0450906_000953 3300042145 Bacteria 6331
68 Ga0439458_0005054 3300042157 Bacteria 2980
69 Ga0439458_0011785 3300042157 Bacteria 1958
70 Ga0466969_0026882 3300044656 Bacteria 2949
71 Ga0466965_0002882 3300044683 Bacteria 7422
72 Ga0466966_0001953 3300044684 Bacteria 13346
73 Ga0466961_0005921 3300044693 Bacteria 7748
74 Ga0466963_0001746 3300044694 Bacteria 11838
75 Ga0466971_0000288 3300044719 Bacteria 19218
76 Ga0466971_0015111 3300044719 Bacteria 3396
77 Ga0466970_0000573 3300044765 Bacteria 17967
78 Ga0466970_0006787 3300044765 Bacteria 5731
79 Ga0466957_0005800 3300044842 Bacteria 6945
80 Ga0466957_0056001 3300044842 Bacteria 2410
81 Ga0466960_0001078 3300044901 Bacteria 9794
82 Ga0466960_0092782 3300044901 Bacteria 1542
83 Ga0466959_0001737 3300045049 Bacteria 13550
84 Ga0466958_0000978 3300045836 Bacteria 12915
85 Ga0466967_0001936 3300045976 Bacteria 12523
86 Ga0466967_0018954 3300045976 Bacteria 5520
87 Ga0466967_0094987 3300045976 Bacteria 2716
88 Ga0495627_074583 3300046453 Bacteria 988
89 Ga0495592_0009074 3300046454 Bacteria 7480
90 Ga0495592_0067820 3300046454 Bacteria 2605
91 Ga0495603_0001801 3300046455 Bacteria 12645
92 Ga0495603_0001820 3300046455 Bacteria 12588
93 Ga0495603_0008084 3300046455 Bacteria 6356
94 Ga0495629_0000446 3300046459 Bacteria 34452
95 Ga0495629_0005475 3300046459 Bacteria 9476
96 Ga0495629_0022644 3300046459 Bacteria 4477
97 Ga0495629_0069233 3300046459 Bacteria 2462
98 Ga0495629_0105488 3300046459 Bacteria 1966
99 Ga0495651_0004606 3300046462 Bacteria 10538
100 Ga0495651_0072846 3300046462 Bacteria 2608
101 Ga0495582_0107958 3300046473 Bacteria 1563
102 Ga0495605_0005625 3300046474 Bacteria 7284
103 Ga0495662_0000320 3300046476 Bacteria 20955
104 Ga0495664_0000381 3300046477 Bacteria 21601
105 Ga0495664_0096507 3300046477 Bacteria 1779
106 Ga0495594_0001106 3300046499 Bacteria 14069
107 Ga0495594_0019570 3300046499 Bacteria 3598
108 Ga0495594_0035226 3300046499 Bacteria 2726
109 Ga0495607_0025293 3300046501 Bacteria 3694
110 Ga0495583_0055776 3300046506 Bacteria 1784
111 Ga0495583_0070675 3300046506 Bacteria 1534
112 Ga0495606_0013139 3300046507 Bacteria 6572
113 Ga0495608_0125918 3300046511 Bacteria 1641
114 Ga0495616_0003832 3300046513 Bacteria 9587
115 Ga0495618_0041773 3300046514 Bacteria 2889
116 Ga0495620_0065420 3300046515 Bacteria 1500
117 Ga0495628_0004297 3300046516 Bacteria 12666
118 Ga0495630_0045757 3300046517 Bacteria 3270
119 Ga0495631_0029552 3300046518 Bacteria 2491
120 Ga0495643_0023015 3300046522 Bacteria 3546
121 Ga0495648_0051264 3300046524 Bacteria 2515
122 Ga0495648_0084901 3300046524 Bacteria 1790
123 Ga0495666_0063320 3300046526 Bacteria 1765
124 Ga0495642_0065522 3300046528 Bacteria 1513
125 Ga0495652_0040438 3300046529 Bacteria 4030
126 Ga0495652_0278018 3300046529 Bacteria 1227
127 Ga0495654_0057175 3300046530 Bacteria 1885
128 Ga0495665_0059166 3300046531 Bacteria 2023
129 Ga0495640_0015791 3300046533 Bacteria 5667
130 Ga0495587_0002014 3300046536 Bacteria 13538
131 Ga0495597_0050230 3300046542 Bacteria 1841
132 Ga0495597_0143979 3300046542 Bacteria 981
133 Ga0495645_0006649 3300046543 Bacteria 8033
134 Ga0495622_0012254 3300046557 Bacteria 3965
135 Ga0495622_0130419 3300046557 Bacteria 1145
136 Ga0495667_0154860 3300046559 Bacteria 1475
137 Ga0495667_0232784 3300046559 Bacteria 1175
138 Ga0495656_0111368 3300046615 Bacteria 1281
139 Ga0495668_0005061 3300046616 Bacteria 9084
140 Ga0495634_0003019 3300046642 Bacteria 13695
141 Ga0495634_0099483 3300046642 Bacteria 1880
142 Ga0495625_0010025 3300046660 Bacteria 7878
143 Ga0495625_0058832 3300046660 Bacteria 2728
144 Ga0495625_0067613 3300046660 Bacteria 2514
145 Ga0495635_0000258 3300046663 Bacteria 33989
146 Ga0495661_0119564 3300046665 Bacteria 1457
147 Ga0495588_0040614 3300046674 Bacteria 2373
148 Ga0495657_0005383 3300046675 Bacteria 10123
149 Ga0495657_0006967 3300046675 Bacteria 8775
150 Ga0495599_0110013 3300046678 Bacteria 1717
151 Ga0495623_0025493 3300046679 Bacteria 3809
152 Ga0495646_0000678 3300046680 Bacteria 18683
153 Ga0495613_0001528 3300046689 Bacteria 17617
154 Ga0495613_0006255 3300046689 Bacteria 8900
155 Ga0495624_0032500 3300046690 Bacteria 3383
156 Ga0495670_0026210 3300046691 Bacteria 2885
157 Ga0495671_0025001 3300046692 Bacteria 3106
158 Ga0495649_0038710 3300046694 Bacteria 2615
159 Ga0495589_0009491 3300046794 Bacteria 5059
160 Ga0495589_0016618 3300046794 Bacteria 3780
161 Ga0495589_0070833 3300046794 Bacteria 1704
162 Ga0495600_0010394 3300046809 Bacteria 5778
163 Ga0495660_0090666 3300046810 Bacteria 1589
164 Ga0495581_0236103 3300047315 Bacteria 1069
165 Ga0495604_0000243 3300047317 Bacteria 48550
166 Ga0495604_0025574 3300047317 Bacteria 4703
167 Ga0495636_0004369 3300047318 Bacteria 5545
168 Ga0495636_0023182 3300047318 Bacteria 2512
169 Ga0495636_0023531 3300047318 Bacteria 2494
170 Ga0495674_0113662 3300047319 Bacteria 2293
171 Ga0495676_0004614 3300047321 Bacteria 12619
172 Ga0495676_0010185 3300047321 Bacteria 8538
173 Ga0495676_0017899 3300047321 Bacteria 6254
174 Ga0495676_0029126 3300047321 Bacteria 4704
175 Ga0495680_0024008 3300047322 Bacteria 5063
176 Ga0495683_0023711 3300047323 Bacteria 3153
177 Ga0495687_024664 3300047443 Bacteria 2854
178 Ga0495675_0002940 3300047444 Bacteria 10236
179 Ga0495675_0019920 3300047444 Bacteria 4263
180 Ga0495675_0099557 3300047444 Bacteria 1820
181 Ga0495677_0003412 3300047445 Bacteria 6168
182 Ga0495685_004520 3300047447 Bacteria 4503
183 Ga0495685_009176 3300047447 Bacteria 3299
184 Ga0495685_010723 3300047447 Bacteria 3079
185 Ga0495685_025923 3300047447 Bacteria 2017
186 Ga0495681_0000311 3300047470 Bacteria 38913
187 Ga0495681_0022352 3300047470 Bacteria 3387
188 Ga0495684_0143699 3300047471 Bacteria 1788
189 Ga0495686_0134185 3300047472 Bacteria 1465
190 Ga0495593_0000841 3300047673 Bacteria 17847
191 Ga0495602_0098464 3300048088 Bacteria 2406
192 Ga0495614_0001085 3300048089 Bacteria 11639
193 Ga0495614_0044772 3300048089 Bacteria 1898
194 Ga0496106_0158901 3300048909 Bacteria 1787
195 Ga0496107_0075868 3300048910 Bacteria 2448
196 Ga0496109_0015548 3300048912 Bacteria 6635
197 Ga0501306_001907 3300049127 Bacteria 2049
198 Ga0501309_005968 3300049129 Bacteria 1470
199 Ga0501031_0087303 3300049568 Bacteria 2034
200 Ga0501032_0123802 3300049569 Bacteria 1708
201 Ga0501032_0138353 3300049569 Bacteria 1604
202 Ga0501033_0002003 3300049570 Bacteria 17735
203 Ga0501033_0003695 3300049570 Bacteria 12443
204 Ga0501033_0082865 3300049570 Bacteria 2351
205 Ga0501033_0114885 3300049570 Bacteria 1956
206 Ga0501034_0012461 3300049571 Bacteria 8781
207 Ga0501034_0071877 3300049571 Bacteria 3468
208 Ga0501034_0079153 3300049571 Bacteria 3290
209 Ga0501034_0257580 3300049571 Bacteria 1688
210 Ga0501034_0312182 3300049571 Bacteria 1506
211 Ga0501036_0000912 3300049572 Bacteria 22166
212 Ga0501036_0010185 3300049572 Bacteria 7746
213 Ga0501036_0102203 3300049572 Bacteria 2425
214 Ga0501036_0157361 3300049572 Bacteria 1916
215 Ga0501037_0025205 3300049573 Bacteria 4394
216 Ga0501037_0134148 3300049573 Bacteria 1774
217 Ga0501038_0018579 3300049574 Bacteria 6278
218 Ga0501038_0021147 3300049574 Bacteria 5845
219 Ga0501038_0121118 3300049574 Bacteria 2157
220 Ga0501039_0018119 3300049575 Bacteria 5404
221 Ga0501042_0138632 3300049578 Bacteria 1753
222 Ga0501043_0004583 3300049579 Bacteria 11213
223 Ga0501043_0147235 3300049579 Bacteria 1843
224 Ga0501046_0039856 3300049580 Bacteria 3757
225 Ga0501047_0008378 3300049581 Bacteria 9760
226 Ga0501047_0113698 3300049581 Bacteria 2589
227 Ga0501047_0118567 3300049581 Bacteria 2528
228 Ga0501047_0297005 3300049581 Bacteria 1458
229 Ga0501070_0030531 3300049586 Bacteria 4516
230 Ga0501074_0016230 3300049590 Bacteria 5409
231 Ga0501080_0027991 3300049742 Bacteria 5241
232 Ga0501035_0039857 3300049822 Bacteria 4248
233 Ga0501035_0097595 3300049822 Bacteria 2580
234 Ga0501044_0042523 3300049823 Bacteria 4725
235 Ga0501044_0097967 3300049823 Bacteria 2952
236 Ga0501044_0229044 3300049823 Bacteria 1806
237 nmdc:mga03n38_6810_c1 3300050490 Bacteria 4004
238 nmdc:mga06z11_32611_c1 3300050494 Bacteria 2542
239 nmdc:mga04h51_10473_c1 3300050495 Bacteria 2547
240 Ga0495612_0026973 3300053078 Bacteria 2309
241 Ga0500610_0139940 3300053079 Bacteria 1223
242 Ga0500583_0164722 3300053092 Bacteria 1104
243 Ga0500572_001912 3300053111 Bacteria 5227
244 Ga0500634_0087284 3300053161 Bacteria 1593
245 Ga0466962_0000514 3300061719 Bacteria 16895
246 Ga0466962_0122001 3300061719 Bacteria 1258
247 2547412170 2547132111 Bacteria 8013147
248 2554260847 2554235005 Bacteria 6457341
249 2585301941 2582581312 Bacteria 7308206
250 2585304070 2582581313 Bacteria 10042643
251 2585312058 2582581314 Bacteria 11452267
252 2616698972 2616644814 Bacteria 11555299
253 2616901260 2616644941 Bacteria 8510691
254 2643762365 2643221548 Bacteria 8053412
255 2643901707 2643221578 Bacteria 9213798
256 2644263833 2643221647 Bacteria 10741251
257 2644387870 2643221670 Bacteria 6497041
258 2644407853 2643221673 Bacteria 9196637
259 2644438159 2643221678 Bacteria 9540101
260 2644458856 2643221682 Bacteria 6743283
261 2644631849 2643221714 Bacteria 9015452
262 2784591927 2784132148 Bacteria 8627943
263 2785339788 2784746763 Bacteria 9783172
264 2785373155 2784746768 Bacteria 10036182
265 2786674883 2786546132 Bacteria 10419719
266 2804849128 2802429296 Bacteria 7227771
267 2808845293 2808606359 Bacteria 9866990
268 2808914993 2808606375 Bacteria 9466072
269 2809235537 2808606448 Bacteria 8656184
270 2811843223 2808606982 Bacteria 7791042
271 2812354414 2811994879 Bacteria 9313447
272 2812477393 2811994917 Bacteria 7761064
273 2812480888 2811994917 Bacteria 7761064
274 2819696225 2818991463 Bacteria 7948711
275 2852636038 2852635781 Bacteria 8251373
276 2862283078 2862281513 Bacteria 9621493
277 2862290946 2862290372 Bacteria 7471434
278 2862393001 2862382967 Bacteria 10317375
279 2862514915 2862507626 Bacteria 9425308
280 2862576227 2862574272 Bacteria 10567477
281 2863410232 2863404153 Bacteria 9672205
282 2867434276 2867428634 Bacteria 9590268
283 2873152653 2873151551 Bacteria 8625867
284 2875397899 2875391855 Bacteria 7600475
285 2877677746 2877676314 Bacteria 9512378
286 2912716034 2912715099 Bacteria 9460473
287 2912728987 2912723979 Bacteria 8557534
288 2912764082 2912757875 Bacteria 7940295
289 2919470917 2919468124 Bacteria 9133025
290 2935392945 2935390628 Bacteria 7043367
291 2946046594 2946045630 Bacteria 8527308
292 2946071288 2946064051 Bacteria 8957905
293 2946079121 2946072368 Bacteria 8999607
294 2947225459 2947224130 Bacteria 9938529
295 2954009673 2954002825 Bacteria 9173742
296 2954382528 2954380949 Bacteria 10050426
297 2954680518 2954673503 Bacteria 9685905
298 2954683635 2954682443 Bacteria 9862841
299 2954693328 2954691527 Bacteria 10720516
300 2954708421 2954701450 Bacteria 10834262
301 2954713035 2954711539 Bacteria 10867210
302 2954722994 2954721474 Bacteria 10456478
303 2954738835 2954731030 Bacteria 10243860
304 2954741904 2954740390 Bacteria 10229294
305 2954757693 2954749733 Bacteria 10366972
306 2954760881 2954759201 Bacteria 9358192
307 2966599571 2966598605 Bacteria 7676064
308 2990063408 2990059506 Bacteria 9321252
309 2997603686 2997600082 Bacteria 9896405
310 3006395572 3006393351 Bacteria 6615579
311 3006500069 3006493962 Bacteria 8825450
312 8008564228 8008558824 Bacteria 10610750
313 8008575901 8008574985 Bacteria 7815457
314 8023631420 8023623736 Bacteria 8593882
315 8025416380 8025413630 Bacteria 7014048
316 8025533402 8025530807 Bacteria 8495698
317 8048409647 8048406513 Bacteria 8936924
318 8056836078 8056829672 Bacteria 9045328
319 Ga0500616_0000905
320 rootH1_10018221
321 rootH2_10003768
322 rootH1_10055552
323 rootH1_10055553
324 Ga0070682_100197421
325 Ga0068856_100123386
326 Ga0081455_10109536
327 Ga0075363_100000602
328 Ga0075367_10187747
329 Ga0099826_10059306
330 Ga0105251_10016495
331 Ga0105243_10313698
332 Ga0105239_10156333
333 Ga0157372_10289804
334 Ga0182008_10000665
335 Ga0182007_10001425
336 Ga0182005_1025886
337 Ga0207713_1022195
338 Ga0207647_10060302
339 Ga0307517_10006702
340 Ga0307515_10000163
341 Ga0307515_10140464
342 Ga0307511_10000150
343 Ga0307511_10140571
344 Ga0307512_10002523
345 Ga0307512_10028893
346 Ga0307513_10020326
347 Ga0307513_10091273
348 Ga0307509_10072727
349 Ga0307408_100358301
350 Ga0307508_10005082
351 Ga0307508_10026758
352 Ga0307508_10061713
353 Ga0307514_10025847
354 Ga0307514_10077440
355 Ga0307516_10002626
356 Ga0307516_10013194
357 Ga0307518_10109365
358 Ga0307510_10044446
359 Ga0307510_10053280
360 Ga0307510_10064068
361 Ga0395900_0031806
362 Ga0395898_0015938
363 Ga0395898_0023672
364 Ga0395898_0214654
365 Ga0395901_0023825
366 Ga0439436_0002576
367 Ga0451791_0118283
368 Ga0451795_1276844
369 Ga0451802_0028173
370 Ga0451851_0172658
371 Ga0451853_0177550
372 Ga0451853_0751129
373 Ga0451853_0939466
374 Ga0439433_0002459
375 Ga0439433_0006466
376 Ga0439449_0001600
377 Ga0439449_0003189
378 Ga0439449_0036369
379 Ga0439450_005101
380 Ga0439457_000007
381 Ga0439457_003719
382 Ga0450896_002011
383 Ga0450899_000188
384 Ga0450903_000472
385 Ga0450906_000953
386 Ga0439458_0005054
387 Ga0439458_0011785
388 Ga0466969_0026882
389 Ga0466965_0002882
390 Ga0466966_0001953
391 Ga0466961_0005921
392 Ga0466963_0001746
393 Ga0466971_0000288
394 Ga0466971_0015111
395 Ga0466970_0000573
396 Ga0466970_0006787
397 Ga0466957_0005800
398 Ga0466957_0056001
399 Ga0466960_0001078
400 Ga0466960_0092782
401 Ga0466959_0001737
402 Ga0466958_0000978
403 Ga0466967_0001936
404 Ga0466967_0018954
405 Ga0466967_0094987
406 Ga0495627_074583
407 Ga0495592_0009074
408 Ga0495592_0067820
409 Ga0495603_0001801
410 Ga0495603_0001820
411 Ga0495603_0008084
412 Ga0495629_0000446
413 Ga0495629_0005475
414 Ga0495629_0022644
415 Ga0495629_0069233
416 Ga0495629_0105488
417 Ga0495651_0004606
418 Ga0495651_0072846
419 Ga0495582_0107958
420 Ga0495605_0005625
421 Ga0495662_0000320
422 Ga0495664_0000381
423 Ga0495664_0096507
424 Ga0495594_0001106
425 Ga0495594_0019570
426 Ga0495594_0035226
427 Ga0495607_0025293
428 Ga0495583_0055776
429 Ga0495583_0070675
430 Ga0495606_0013139
431 Ga0495608_0125918
432 Ga0495616_0003832
433 Ga0495618_0041773
434 Ga0495620_0065420
435 Ga0495628_0004297
436 Ga0495630_0045757
437 Ga0495631_0029552
438 Ga0495643_0023015
439 Ga0495648_0051264
440 Ga0495648_0084901
441 Ga0495666_0063320
442 Ga0495642_0065522
443 Ga0495652_0040438
444 Ga0495652_0278018
445 Ga0495654_0057175
446 Ga0495665_0059166
447 Ga0495640_0015791
448 Ga0495587_0002014
449 Ga0495597_0050230
450 Ga0495597_0143979
451 Ga0495645_0006649
452 Ga0495622_0012254
453 Ga0495622_0130419
454 Ga0495667_0154860
455 Ga0495667_0232784
456 Ga0495656_0111368
457 Ga0495668_0005061
458 Ga0495634_0003019
459 Ga0495634_0099483
460 Ga0495625_0010025
461 Ga0495625_0058832
462 Ga0495625_0067613
463 Ga0495635_0000258
464 Ga0495661_0119564
465 Ga0495588_0040614
466 Ga0495657_0005383
467 Ga0495657_0006967
468 Ga0495599_0110013
469 Ga0495623_0025493
470 Ga0495646_0000678
471 Ga0495613_0001528
472 Ga0495613_0006255
473 Ga0495624_0032500
474 Ga0495670_0026210
475 Ga0495671_0025001
476 Ga0495649_0038710
477 Ga0495589_0009491
478 Ga0495589_0016618
479 Ga0495589_0070833
480 Ga0495600_0010394
481 Ga0495660_0090666
482 Ga0495581_0236103
483 Ga0495604_0000243
484 Ga0495604_0025574
485 Ga0495636_0004369
486 Ga0495636_0023182
487 Ga0495636_0023531
488 Ga0495674_0113662
489 Ga0495676_0004614
490 Ga0495676_0010185
491 Ga0495676_0017899
492 Ga0495676_0029126
493 Ga0495680_0024008
494 Ga0495683_0023711
495 Ga0495687_024664
496 Ga0495675_0002940
497 Ga0495675_0019920
498 Ga0495675_0099557
499 Ga0495677_0003412
500 Ga0495685_004520
501 Ga0495685_009176
502 Ga0495685_010723
503 Ga0495685_025923
504 Ga0495681_0000311
505 Ga0495681_0022352
506 Ga0495684_0143699
507 Ga0495686_0134185
508 Ga0495593_0000841
509 Ga0495602_0098464
510 Ga0495614_0001085
511 Ga0495614_0044772
512 Ga0496106_0158901
513 Ga0496107_0075868
514 Ga0496109_0015548
515 Ga0501306_001907
516 Ga0501309_005968
517 Ga0501031_0087303
518 Ga0501032_0123802
519 Ga0501032_0138353
520 Ga0501033_0002003
521 Ga0501033_0003695
522 Ga0501033_0082865
523 Ga0501033_0114885
524 Ga0501034_0012461
525 Ga0501034_0071877
526 Ga0501034_0079153
527 Ga0501034_0257580
528 Ga0501034_0312182
529 Ga0501036_0000912
530 Ga0501036_0010185
531 Ga0501036_0102203
532 Ga0501036_0157361
533 Ga0501037_0025205
534 Ga0501037_0134148
535 Ga0501038_0018579
536 Ga0501038_0021147
537 Ga0501038_0121118
538 Ga0501039_0018119
539 Ga0501042_0138632
540 Ga0501043_0004583
541 Ga0501043_0147235
542 Ga0501046_0039856
543 Ga0501047_0008378
544 Ga0501047_0113698
545 Ga0501047_0118567
546 Ga0501047_0297005
547 Ga0501070_0030531
548 Ga0501074_0016230
549 Ga0501080_0027991
550 Ga0501035_0039857
551 Ga0501035_0097595
552 Ga0501044_0042523
553 Ga0501044_0097967
554 Ga0501044_0229044
555 nmdc:mga03n38_6810_c1
556 nmdc:mga06z11_32611_c1
557 nmdc:mga04h51_10473_c1
558 Ga0495612_0026973
559 Ga0500610_0139940
560 Ga0500583_0164722
561 Ga0500572_001912
562 Ga0500634_0087284
563 Ga0466962_0000514
564 Ga0466962_0122001
565 2547412170
566 2554260847
567 2585301941
568 2585304070
569 2585312058
570 2616698972
571 2616901260
572 2643762365
573 2643901707
574 2644263833
575 2644387870
576 2644407853
577 2644438159
578 2644458856
579 2644631849
580 2784591927
581 2785339788
582 2785373155
583 2786674883
584 2804849128
585 2808845293
586 2808914993
587 2809235537
588 2811843223
589 2812354414
590 2812477393
591 2812480888
592 2819696225
593 2852636038
594 2862283078
595 2862290946
596 2862393001
597 2862514915
598 2862576227
599 2863410232
600 2867434276
601 2873152653
602 2875397899
603 2877677746
604 2912716034
605 2912728987
606 2912764082
607 2919470917
608 2935392945
609 2946046594
610 2946071288
611 2946079121
612 2947225459
613 2954009673
614 2954382528
615 2954680518
616 2954683635
617 2954693328
618 2954708421
619 2954713035
620 2954722994
621 2954738835
622 2954741904
623 2954757693
624 2954760881
625 2966599571
626 2990063408
627 2997603686
628 3006395572
629 3006500069
630 8008564228
631 8008575901
632 8023631420
633 8025416380
634 8025533402
635 8048409647
636 8056836078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

51

263

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8764 44 293
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8435 44 293
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.8401 30 299
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.835 44 297
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.8343 30 299
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6261 95 287 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5943 96 287 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5799 76 287 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.438 76 287 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4376 95 287 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A4P6ERR9-F1-model_v4 Transport permease protein 0.9495 50 299 GO:0015920
GO:0043190
GO:0140359
AF-A0A6G3U9A6-F1-model_v4 Transport permease protein 0.9463 40 299 GO:0015920
GO:0043190
GO:0140359
AF-A0A1J7C2M8-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9413 23 299 GO:0015920
GO:0016020
GO:0140359
AF-A0A2H1L4H8-F1-model_v4 Transport permease protein 0.9413 17 299 GO:0005886
GO:0015920
GO:0140359
AF-A0A4P6ERR9-F1-model_v4 Transport permease protein 0.9384 50 299 GO:0015920
GO:0043190
GO:0140359

Map