F404833

General Info

Members Datasets Scaffolds Average Seq Length
318 171 636 186

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_34958_c1|nmdc:mga0k408_34958_c1_486_1100
Length 204
Sequence MRDAEVAVSFSIPHSAFSIPMDVLSRLLVLLGVGFLWVNVRTFGQFIRFLRIRSSALLTWPGQRPPFYPLLLSLGAVLAVLICVKLAVLKQHPKQVFGESMMLLYYAYALPLSMRIGRGFYQDGIWAESGFVPYSRIGGLTWREGEQITLVMMHRVRAFAQSLVVPERYYAASRRLLRDKIAAHDIHFTGKSLDLGAHDERDDV

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
104 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
119 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
120 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
121 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
141 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
142 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.12
Nodule 0
Rhizoplane 3.46
Rhizosphere 87.42
Stem 0
Stem Tuber 0
Unclassified 28.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_34958_c1 3300050493 Bacteria 2879
2 Ga0065715_10089557 3300005293 Bacteria 9477
3 Ga0065715_10202526 3300005293 Bacteria 1354
4 Ga0065707_10363065 3300005295 Unclassified 901
5 Ga0070676_10210165 3300005328 Bacteria 1280
6 Ga0070683_100116911 3300005329 Bacteria 2518
7 Ga0070683_100173371 3300005329 Bacteria 2048
8 Ga0070670_100455266 3300005331 Unclassified 1134
9 Ga0070677_10050157 3300005333 Unclassified 1684
10 Ga0070660_100565833 3300005339 Unclassified 949
11 Ga0070669_100778967 3300005353 Unclassified 812
12 Ga0070675_100167595 3300005354 Bacteria 1893
13 Ga0070675_100421697 3300005354 Unclassified 1193
14 Ga0070671_100053289 3300005355 Bacteria 3363
15 Ga0070674_100105970 3300005356 Bacteria 2056
16 Ga0070674_100203833 3300005356 Bacteria 1529
17 Ga0070674_100346794 3300005356 Bacteria 1198
18 Ga0070673_100309040 3300005364 Bacteria 1394
19 Ga0070659_100218949 3300005366 Bacteria 1571
20 Ga0070701_10181371 3300005438 Unclassified 1233
21 Ga0070700_100534749 3300005441 Bacteria 908
22 Ga0070694_100054955 3300005444 Bacteria 2699
23 Ga0070678_100232154 3300005456 Bacteria 1539
24 Ga0070678_100721387 3300005456 Unclassified 900
25 Ga0070662_100439703 3300005457 Unclassified 1081
26 Ga0068867_100335662 3300005459 Bacteria 1257
27 Ga0070706_100190244 3300005467 Bacteria 1918
28 Ga0070707_100131875 3300005468 Bacteria 2430
29 Ga0070684_100013066 3300005535 Bacteria 6681
30 Ga0070672_100043582 3300005543 Bacteria 3461
31 Ga0070672_100661004 3300005543 Bacteria 913
32 Ga0070695_100903709 3300005545 Unclassified 713
33 Ga0070665_101029150 3300005548 Bacteria 836
34 Ga0070664_100019151 3300005564 Bacteria 5628
35 Ga0070664_100785493 3300005564 Unclassified 890
36 Ga0068854_100672527 3300005578 Unclassified 891
37 Ga0068859_100028333 3300005617 Bacteria 5615
38 Ga0068864_100071519 3300005618 Bacteria 3021
39 Ga0068861_100030908 3300005719 Bacteria 3929
40 Ga0068862_100044058 3300005844 Bacteria 3806
41 Ga0081539_10034808 3300005985 Bacteria 3037
42 Ga0075368_10003029 3300006042 Bacteria 5558
43 Ga0075368_10146670 3300006042 Bacteria 985
44 Ga0075364_10037690 3300006051 Bacteria 3131
45 Ga0075364_10052212 3300006051 Bacteria 2671
46 Ga0075364_10086210 3300006051 Bacteria 2080
47 Ga0075367_10010866 3300006178 Bacteria 4797
48 Ga0075367_10021201 3300006178 Bacteria 3628
49 Ga0075367_10035319 3300006178 Bacteria 2893
50 Ga0075367_10465037 3300006178 Bacteria 802
51 Ga0075366_10015515 3300006195 Bacteria 4369
52 Ga0075366_10038528 3300006195 Bacteria 2823
53 Ga0075366_10145449 3300006195 Bacteria 1434
54 Ga0097621_100532159 3300006237 Unclassified 1068
55 Ga0075370_10157877 3300006353 Bacteria 1330
56 Ga0075428_100002126 3300006844 Bacteria 21387
57 Ga0075428_100010682 3300006844 Bacteria 10205
58 Ga0075428_100024491 3300006844 Bacteria 6680
59 Ga0075428_100031408 3300006844 Bacteria 5871
60 Ga0075428_101013394 3300006844 Bacteria 879
61 Ga0075430_100003552 3300006846 Bacteria 13057
62 Ga0075430_100008442 3300006846 Bacteria 8704
63 Ga0075430_100014971 3300006846 Bacteria 6605
64 Ga0075430_100586012 3300006846 Bacteria 920
65 Ga0075430_100770081 3300006846 Bacteria 793
66 Ga0075431_100001356 3300006847 Bacteria 22428
67 Ga0075431_100032697 3300006847 Bacteria 5361
68 Ga0075431_100035552 3300006847 Bacteria 5129
69 Ga0075431_100065845 3300006847 Bacteria 3741
70 Ga0075431_100089622 3300006847 Bacteria 3175
71 Ga0075431_100295022 3300006847 Bacteria 1639
72 Ga0075431_100635950 3300006847 Bacteria 1048
73 Ga0075433_10072937 3300006852 Bacteria 3019
74 Ga0075433_10397420 3300006852 Bacteria 1216
75 Ga0075433_10739027 3300006852 Unclassified 861
76 Ga0075429_100112330 3300006880 Unclassified 2381
77 Ga0075429_100252690 3300006880 Unclassified 1544
78 Ga0075429_100518285 3300006880 Unclassified 1045
79 Ga0075429_100728529 3300006880 Bacteria 869
80 Ga0075429_100760429 3300006880 Unclassified 849
81 Ga0068865_100388493 3300006881 Unclassified 1140
82 Ga0097620_100028333 3300006931 Bacteria 5615
83 Ga0111539_10238814 3300009094 Bacteria 2115
84 Ga0111539_11759394 3300009094 Unclassified 719
85 Ga0105245_11391415 3300009098 Bacteria 751
86 Ga0114129_10000986 3300009147 Bacteria 37220
87 Ga0114129_10006222 3300009147 Bacteria 16925
88 Ga0114129_10008685 3300009147 Bacteria 14482
89 Ga0114129_10016889 3300009147 Bacteria 10392
90 Ga0114129_10028209 3300009147 Bacteria 7954
91 Ga0114129_10292755 3300009147 Bacteria 2172
92 Ga0114129_10845688 3300009147 Bacteria 1164
93 Ga0114129_10908388 3300009147 Unclassified 1115
94 Ga0105248_10235521 3300009177 Bacteria 2061
95 Ga0105238_10470969 3300009551 Bacteria 1255
96 Ga0157373_10343982 3300013100 Bacteria 1063
97 Ga0157380_10006031 3300014326 Bacteria 8489
98 Ga0157380_10495368 3300014326 Bacteria 1185
99 Ga0157380_11731240 3300014326 Unclassified 683
100 Ga0157377_10089179 3300014745 Bacteria 1818
101 Ga0163161_10098540 3300017792 Unclassified 2173
102 Ga0207697_10024041 3300025315 Unclassified 2495
103 Ga0207645_10572119 3300025907 Bacteria 767
104 Ga0207643_10303754 3300025908 Unclassified 993
105 Ga0207684_10190291 3300025910 Bacteria 1770
106 Ga0207657_10228174 3300025919 Bacteria 1490
107 Ga0207649_10691836 3300025920 Bacteria 790
108 Ga0207646_10024380 3300025922 Bacteria 5541
109 Ga0207694_10619962 3300025924 Unclassified 910
110 Ga0207650_10056358 3300025925 Bacteria 2920
111 Ga0207659_10343240 3300025926 Unclassified 1237
112 Ga0207659_10537563 3300025926 Unclassified 992
113 Ga0207706_11123088 3300025933 Bacteria 656
114 Ga0207669_10028120 3300025937 Bacteria 3089
115 Ga0207669_10075187 3300025937 Bacteria 2139
116 Ga0207669_10653757 3300025937 Bacteria 860
117 Ga0207691_10074999 3300025940 Bacteria 3050
118 Ga0207691_10646897 3300025940 Bacteria 893
119 Ga0207711_10245087 3300025941 Unclassified 1644
120 Ga0207689_10016799 3300025942 Bacteria 6195
121 Ga0207661_10184960 3300025944 Bacteria 1823
122 Ga0207679_10020688 3300025945 Bacteria 4444
123 Ga0207667_10213442 3300025949 Bacteria 1978
124 Ga0207651_10687537 3300025960 Unclassified 900
125 Ga0207640_10630800 3300025981 Unclassified 911
126 Ga0207639_10801100 3300026041 Bacteria 878
127 Ga0207678_10010917 3300026067 Bacteria 7981
128 Ga0207641_10396631 3300026088 Unclassified 1324
129 Ga0207648_10415610 3300026089 Bacteria 1221
130 Ga0207676_10152299 3300026095 Unclassified 1993
131 Ga0207675_100061740 3300026118 Bacteria 3499
132 Ga0207675_100924254 3300026118 Unclassified 889
133 Ga0207683_10005258 3300026121 Bacteria 11110
134 Ga0207683_10241401 3300026121 Bacteria 1648
135 Ga0207683_10669122 3300026121 Bacteria 962
136 Ga0209971_1036699 3300027682 Bacteria 1180
137 Ga0209813_10006474 3300027866 Unclassified 2895
138 Ga0209813_10009593 3300027866 Bacteria 2482
139 Ga0207428_10006330 3300027907 Bacteria 10946
140 Ga0268266_10665182 3300028379 Bacteria 1003
141 Ga0307408_100006271 3300031548 Bacteria 7894
142 Ga0307408_100371899 3300031548 Unclassified 1219
143 Ga0307405_10224192 3300031731 Bacteria 1381
144 Ga0307413_10031382 3300031824 Bacteria 2998
145 Ga0307413_10195356 3300031824 Bacteria 1456
146 Ga0307413_10676891 3300031824 Unclassified 854
147 Ga0307410_10330399 3300031852 Bacteria 1212
148 Ga0307410_10543619 3300031852 Bacteria 962
149 Ga0307406_10999439 3300031901 Unclassified 718
150 Ga0307407_10011607 3300031903 Unclassified 4202
151 Ga0307412_10049725 3300031911 Bacteria 2763
152 Ga0307412_11145080 3300031911 Unclassified 694
153 Ga0307409_100344722 3300031995 Bacteria 1403
154 Ga0307416_100061124 3300032002 Bacteria 3072
155 Ga0307416_100397876 3300032002 Bacteria 1414
156 Ga0307416_100449509 3300032002 Bacteria 1341
157 Ga0307411_10118752 3300032005 Bacteria 1908
158 Ga0307411_10183663 3300032005 Bacteria 1590
159 Ga0307411_10493683 3300032005 Unclassified 1033
160 Ga0307411_10641814 3300032005 Unclassified 918
161 Ga0307415_100069485 3300032126 Bacteria 2470
162 Ga0307415_100638910 3300032126 Unclassified 952
163 Ga0439453_0005521 3300041408 Bacteria 1930
164 Ga0451797_1361887 3300041453 Bacteria 1212
165 Ga0451807_1293799 3300041486 Bacteria 1537
166 Ga0451807_1913233 3300041486 Unclassified 754
167 Ga0439443_044143 3300042003 Bacteria 767
168 Ga0439449_0053490 3300042007 Bacteria 1492
169 Ga0450920_002663 3300042122 Bacteria 3058
170 Ga0450898_014740 3300042134 Unclassified 1317
171 Ga0439446_0009560 3300042156 Bacteria 2597
172 Ga0439460_0085363 3300042461 Bacteria 996
173 Ga0439440_0159450 3300042993 Unclassified 650
174 Ga0495603_0078296 3300046455 Bacteria 1939
175 Ga0495594_0298645 3300046499 Bacteria 918
176 Ga0495632_0401986 3300046519 Unclassified 598
177 Ga0496101_0899191 3300048904 Bacteria 697
178 Ga0496102_0027514 3300048905 Bacteria 5078
179 Ga0496106_0270994 3300048909 Bacteria 1359
180 Ga0496108_0215178 3300048911 Unclassified 1669
181 Ga0496109_0064422 3300048912 Bacteria 3354
182 Ga0496109_0291035 3300048912 Bacteria 1540
183 Ga0496110_1284445 3300048913 Unclassified 641
184 Ga0496112_0039442 3300048915 Bacteria 4616
185 Ga0501290_040401 3300049513 Bacteria 697
186 Ga0501292_005423 3300049515 Bacteria 1777
187 Ga0501298_007072 3300049521 Bacteria 1854
188 Ga0501299_012396 3300049522 Bacteria 1454
189 Ga0501033_0063368 3300049570 Unclassified 2721
190 Ga0501036_0031504 3300049572 Bacteria 4481
191 Ga0501036_0492984 3300049572 Unclassified 1020
192 Ga0501036_0795151 3300049572 Bacteria 779
193 Ga0501038_0086764 3300049574 Bacteria 2629
194 Ga0501038_1015986 3300049574 Unclassified 608
195 Ga0501039_0075241 3300049575 Bacteria 2625
196 Ga0501039_0101370 3300049575 Bacteria 2247
197 Ga0501039_0125362 3300049575 Unclassified 2014
198 Ga0501040_0007049 3300049576 Bacteria 7284
199 Ga0501040_0193236 3300049576 Bacteria 1445
200 Ga0501040_0677781 3300049576 Bacteria 745
201 Ga0501040_1025862 3300049576 Unclassified 598
202 Ga0501041_0015049 3300049577 Bacteria 4595
203 Ga0501041_0468039 3300049577 Unclassified 801
204 Ga0501042_0002136 3300049578 Bacteria 12006
205 Ga0501042_0436003 3300049578 Bacteria 950
206 Ga0501046_0052383 3300049580 Unclassified 3216
207 Ga0501046_0161112 3300049580 Bacteria 1687
208 Ga0501048_0029622 3300049582 Bacteria 3968
209 Ga0501048_0030927 3300049582 Bacteria 3875
210 Ga0501048_0032220 3300049582 Unclassified 3788
211 Ga0501048_0117468 3300049582 Bacteria 1879
212 Ga0501068_0117576 3300049584 Bacteria 1656
213 Ga0501068_0314995 3300049584 Bacteria 1002
214 Ga0501069_0270100 3300049585 Bacteria 994
215 Ga0501071_0018569 3300049587 Bacteria 4817
216 Ga0501071_0041568 3300049587 Unclassified 3292
217 Ga0501071_0934352 3300049587 Bacteria 669
218 Ga0501071_0935413 3300049587 Bacteria 669
219 Ga0501072_0079189 3300049588 Unclassified 2602
220 Ga0501072_0106588 3300049588 Bacteria 2229
221 Ga0501072_0217198 3300049588 Bacteria 1524
222 Ga0501072_0222067 3300049588 Bacteria 1506
223 Ga0501072_0242641 3300049588 Unclassified 1435
224 Ga0501073_0266988 3300049589 Unclassified 1181
225 Ga0501073_0530885 3300049589 Bacteria 813
226 Ga0501074_0046328 3300049590 Bacteria 3144
227 Ga0501074_0074767 3300049590 Unclassified 2433
228 Ga0501074_0707786 3300049590 Unclassified 711
229 Ga0501075_0000848 3300049591 Bacteria 19246
230 Ga0501075_0051574 3300049591 Bacteria 3094
231 Ga0501075_0085181 3300049591 Bacteria 2394
232 Ga0501075_0296765 3300049591 Bacteria 1231
233 Ga0501075_0457009 3300049591 Unclassified 974
234 Ga0501075_0508560 3300049591 Unclassified 919
235 Ga0501075_0743583 3300049591 Bacteria 747
236 Ga0501076_0082920 3300049592 Bacteria 2574
237 Ga0501076_0636681 3300049592 Bacteria 880
238 Ga0501077_0349580 3300049593 Unclassified 943
239 Ga0501199_025608 3300049650 Bacteria 705
240 Ga0501208_001467 3300049655 Bacteria 2245
241 Ga0501209_134039 3300049656 Bacteria 740
242 Ga0501249_034219 3300049679 Unclassified 1139
243 Ga0501225_0010236 3300049705 Bacteria 2661
244 Ga0501234_003653 3300049707 Unclassified 2417
245 Ga0501079_0007687 3300049741 Bacteria 8159
246 Ga0501079_0370382 3300049741 Bacteria 1123
247 Ga0501079_0798144 3300049741 Unclassified 743
248 Ga0501080_0057534 3300049742 Unclassified 3620
249 Ga0501080_1096604 3300049742 Unclassified 687
250 Ga0501081_0000350 3300049743 Bacteria 24897
251 Ga0501081_0042208 3300049743 Bacteria 3125
252 Ga0501081_0042437 3300049743 Bacteria 3117
253 Ga0501081_0594444 3300049743 Unclassified 828
254 Ga0501083_0082183 3300049744 Bacteria 2135
255 Ga0501268_045068 3300049765 Bacteria 840
256 Ga0501035_0192921 3300049822 Unclassified 1751
257 Ga0501044_0688358 3300049823 Bacteria 909
258 Ga0501045_0004086 3300049824 Bacteria 10073
259 Ga0501045_0006768 3300049824 Bacteria 7938
260 Ga0501045_0086465 3300049824 Bacteria 2314
261 Ga0501045_0286085 3300049824 Unclassified 1227
262 nmdc:mga00v17_163152_c1 3300050491 Unclassified 1435
263 nmdc:mga00v17_41954_c1 3300050491 Bacteria 2750
264 nmdc:mga0yw44_775908_c1 3300050492 Unclassified 651
265 nmdc:mga0k408_108735_c1 3300050493 Bacteria 1638
266 nmdc:mga0k408_110380_c1 3300050493 Unclassified 1626
267 nmdc:mga06z11_10733_c1 3300050494 Bacteria 3917
268 nmdc:mga06z11_134504_c1 3300050494 Unclassified 1392
269 nmdc:mga06z11_16866_c1 3300050494 Bacteria 3301
270 nmdc:mga06z11_231441_c1 3300050494 Bacteria 1083
271 nmdc:mga06z11_368486_c1 3300050494 Bacteria 862
272 nmdc:mga04h51_7391_c1 3300050495 Unclassified 2897
273 nmdc:mga05p37_1694820_c1 3300050507 Bacteria 616
274 nmdc:mga05p37_17279_c1 3300050507 Bacteria 8701
275 nmdc:mga05p37_19046_c1 3300050507 Bacteria 8302
276 nmdc:mga05p37_1930_c2 3300050507 Bacteria 17588
277 nmdc:mga05p37_208917_c1 3300050507 Bacteria 2361
278 nmdc:mga05p37_4424_c1 3300050507 Bacteria 16417
279 nmdc:mga05p37_654598_c1 3300050507 Bacteria 1176
280 nmdc:mga05p37_697822_c1 3300050507 Bacteria 1128
281 nmdc:mga09592_1039708_c1 3300050508 Unclassified 683
282 nmdc:mga09592_198934_c1 3300050508 Unclassified 1735
283 nmdc:mga09592_288387_c1 3300050508 Unclassified 1423
284 nmdc:mga09592_5601_c1 3300050508 Bacteria 10235
285 nmdc:mga09592_5704_c1 3300050508 Bacteria 10156
286 nmdc:mga09592_696609_c1 3300050508 Bacteria 865
287 nmdc:mga0qj67_13145_c1 3300050509 Bacteria 6251
288 nmdc:mga0qj67_15738_c1 3300050509 Bacteria 5728
289 nmdc:mga0qj67_2191_c1 3300050509 Bacteria 13882
290 nmdc:mga0qj67_525183_c1 3300050509 Bacteria 950
291 nmdc:mga0qj67_70112_c1 3300050509 Bacteria 2796
292 nmdc:mga06r32_143593_c1 3300050510 Bacteria 2364
293 nmdc:mga06r32_199880_c1 3300050510 Bacteria 1987
294 nmdc:mga06r32_38963_c1 3300050510 Bacteria 4506
295 nmdc:mga06r32_474185_c1 3300050510 Unclassified 1230
296 nmdc:mga06r32_5660_c1 3300050510 Bacteria 11246
297 nmdc:mga06r32_86577_c1 3300050510 Bacteria 3056
298 nmdc:mga08y16_223734_c1 3300050511 Bacteria 1947
299 nmdc:mga08y16_227799_c1 3300050511 Unclassified 1928
300 nmdc:mga08y16_616870_c1 3300050511 Unclassified 1092
301 nmdc:mga08y16_68076_c1 3300050511 Bacteria 3713
302 nmdc:mga0a205_20972_c1 3300050515 Bacteria 6175
303 nmdc:mga0a205_80170_c1 3300050515 Bacteria 3155
304 Ga0500641_0003196 3300053096 Bacteria 5789
305 Ga0500568_0001163 3300053139 Bacteria 17593
306 Ga0501084_0010504 3300054114 Bacteria 7654
307 Ga0501084_0145940 3300054114 Bacteria 1993
308 Ga0501084_0362087 3300054114 Unclassified 1226
309 Ga0501084_1042436 3300054114 Unclassified 687
310 Ga0590071_000504 3300059421 Bacteria 11434
311 Ga0590075_000313 3300059424 Bacteria 13497
312 Ga0590077_002662 3300059426 Bacteria 3777
313 Ga0501082_0001008 3300060353 Bacteria 24890
314 Ga0501082_0449727 3300060353 Bacteria 1125
315 Ga0501082_0768508 3300060353 Unclassified 843
316 Ga0501082_1272264 3300060353 Unclassified 643
317 Ga0530510_0012702 3300061734 Bacteria 5922
318 Ga0530510_0508681 3300061734 Unclassified 913
319 nmdc:mga0k408_34958_c1
320 Ga0065715_10089557
321 Ga0065715_10202526
322 Ga0065707_10363065
323 Ga0070676_10210165
324 Ga0070683_100116911
325 Ga0070683_100173371
326 Ga0070670_100455266
327 Ga0070677_10050157
328 Ga0070660_100565833
329 Ga0070669_100778967
330 Ga0070675_100167595
331 Ga0070675_100421697
332 Ga0070671_100053289
333 Ga0070674_100105970
334 Ga0070674_100203833
335 Ga0070674_100346794
336 Ga0070673_100309040
337 Ga0070659_100218949
338 Ga0070701_10181371
339 Ga0070700_100534749
340 Ga0070694_100054955
341 Ga0070678_100232154
342 Ga0070678_100721387
343 Ga0070662_100439703
344 Ga0068867_100335662
345 Ga0070706_100190244
346 Ga0070707_100131875
347 Ga0070684_100013066
348 Ga0070672_100043582
349 Ga0070672_100661004
350 Ga0070695_100903709
351 Ga0070665_101029150
352 Ga0070664_100019151
353 Ga0070664_100785493
354 Ga0068854_100672527
355 Ga0068859_100028333
356 Ga0068864_100071519
357 Ga0068861_100030908
358 Ga0068862_100044058
359 Ga0081539_10034808
360 Ga0075368_10003029
361 Ga0075368_10146670
362 Ga0075364_10037690
363 Ga0075364_10052212
364 Ga0075364_10086210
365 Ga0075367_10010866
366 Ga0075367_10021201
367 Ga0075367_10035319
368 Ga0075367_10465037
369 Ga0075366_10015515
370 Ga0075366_10038528
371 Ga0075366_10145449
372 Ga0097621_100532159
373 Ga0075370_10157877
374 Ga0075428_100002126
375 Ga0075428_100010682
376 Ga0075428_100024491
377 Ga0075428_100031408
378 Ga0075428_101013394
379 Ga0075430_100003552
380 Ga0075430_100008442
381 Ga0075430_100014971
382 Ga0075430_100586012
383 Ga0075430_100770081
384 Ga0075431_100001356
385 Ga0075431_100032697
386 Ga0075431_100035552
387 Ga0075431_100065845
388 Ga0075431_100089622
389 Ga0075431_100295022
390 Ga0075431_100635950
391 Ga0075433_10072937
392 Ga0075433_10397420
393 Ga0075433_10739027
394 Ga0075429_100112330
395 Ga0075429_100252690
396 Ga0075429_100518285
397 Ga0075429_100728529
398 Ga0075429_100760429
399 Ga0068865_100388493
400 Ga0097620_100028333
401 Ga0111539_10238814
402 Ga0111539_11759394
403 Ga0105245_11391415
404 Ga0114129_10000986
405 Ga0114129_10006222
406 Ga0114129_10008685
407 Ga0114129_10016889
408 Ga0114129_10028209
409 Ga0114129_10292755
410 Ga0114129_10845688
411 Ga0114129_10908388
412 Ga0105248_10235521
413 Ga0105238_10470969
414 Ga0157373_10343982
415 Ga0157380_10006031
416 Ga0157380_10495368
417 Ga0157380_11731240
418 Ga0157377_10089179
419 Ga0163161_10098540
420 Ga0207697_10024041
421 Ga0207645_10572119
422 Ga0207643_10303754
423 Ga0207684_10190291
424 Ga0207657_10228174
425 Ga0207649_10691836
426 Ga0207646_10024380
427 Ga0207694_10619962
428 Ga0207650_10056358
429 Ga0207659_10343240
430 Ga0207659_10537563
431 Ga0207706_11123088
432 Ga0207669_10028120
433 Ga0207669_10075187
434 Ga0207669_10653757
435 Ga0207691_10074999
436 Ga0207691_10646897
437 Ga0207711_10245087
438 Ga0207689_10016799
439 Ga0207661_10184960
440 Ga0207679_10020688
441 Ga0207667_10213442
442 Ga0207651_10687537
443 Ga0207640_10630800
444 Ga0207639_10801100
445 Ga0207678_10010917
446 Ga0207641_10396631
447 Ga0207648_10415610
448 Ga0207676_10152299
449 Ga0207675_100061740
450 Ga0207675_100924254
451 Ga0207683_10005258
452 Ga0207683_10241401
453 Ga0207683_10669122
454 Ga0209971_1036699
455 Ga0209813_10006474
456 Ga0209813_10009593
457 Ga0207428_10006330
458 Ga0268266_10665182
459 Ga0307408_100006271
460 Ga0307408_100371899
461 Ga0307405_10224192
462 Ga0307413_10031382
463 Ga0307413_10195356
464 Ga0307413_10676891
465 Ga0307410_10330399
466 Ga0307410_10543619
467 Ga0307406_10999439
468 Ga0307407_10011607
469 Ga0307412_10049725
470 Ga0307412_11145080
471 Ga0307409_100344722
472 Ga0307416_100061124
473 Ga0307416_100397876
474 Ga0307416_100449509
475 Ga0307411_10118752
476 Ga0307411_10183663
477 Ga0307411_10493683
478 Ga0307411_10641814
479 Ga0307415_100069485
480 Ga0307415_100638910
481 Ga0439453_0005521
482 Ga0451797_1361887
483 Ga0451807_1293799
484 Ga0451807_1913233
485 Ga0439443_044143
486 Ga0439449_0053490
487 Ga0450920_002663
488 Ga0450898_014740
489 Ga0439446_0009560
490 Ga0439460_0085363
491 Ga0439440_0159450
492 Ga0495603_0078296
493 Ga0495594_0298645
494 Ga0495632_0401986
495 Ga0496101_0899191
496 Ga0496102_0027514
497 Ga0496106_0270994
498 Ga0496108_0215178
499 Ga0496109_0064422
500 Ga0496109_0291035
501 Ga0496110_1284445
502 Ga0496112_0039442
503 Ga0501290_040401
504 Ga0501292_005423
505 Ga0501298_007072
506 Ga0501299_012396
507 Ga0501033_0063368
508 Ga0501036_0031504
509 Ga0501036_0492984
510 Ga0501036_0795151
511 Ga0501038_0086764
512 Ga0501038_1015986
513 Ga0501039_0075241
514 Ga0501039_0101370
515 Ga0501039_0125362
516 Ga0501040_0007049
517 Ga0501040_0193236
518 Ga0501040_0677781
519 Ga0501040_1025862
520 Ga0501041_0015049
521 Ga0501041_0468039
522 Ga0501042_0002136
523 Ga0501042_0436003
524 Ga0501046_0052383
525 Ga0501046_0161112
526 Ga0501048_0029622
527 Ga0501048_0030927
528 Ga0501048_0032220
529 Ga0501048_0117468
530 Ga0501068_0117576
531 Ga0501068_0314995
532 Ga0501069_0270100
533 Ga0501071_0018569
534 Ga0501071_0041568
535 Ga0501071_0934352
536 Ga0501071_0935413
537 Ga0501072_0079189
538 Ga0501072_0106588
539 Ga0501072_0217198
540 Ga0501072_0222067
541 Ga0501072_0242641
542 Ga0501073_0266988
543 Ga0501073_0530885
544 Ga0501074_0046328
545 Ga0501074_0074767
546 Ga0501074_0707786
547 Ga0501075_0000848
548 Ga0501075_0051574
549 Ga0501075_0085181
550 Ga0501075_0296765
551 Ga0501075_0457009
552 Ga0501075_0508560
553 Ga0501075_0743583
554 Ga0501076_0082920
555 Ga0501076_0636681
556 Ga0501077_0349580
557 Ga0501199_025608
558 Ga0501208_001467
559 Ga0501209_134039
560 Ga0501249_034219
561 Ga0501225_0010236
562 Ga0501234_003653
563 Ga0501079_0007687
564 Ga0501079_0370382
565 Ga0501079_0798144
566 Ga0501080_0057534
567 Ga0501080_1096604
568 Ga0501081_0000350
569 Ga0501081_0042208
570 Ga0501081_0042437
571 Ga0501081_0594444
572 Ga0501083_0082183
573 Ga0501268_045068
574 Ga0501035_0192921
575 Ga0501044_0688358
576 Ga0501045_0004086
577 Ga0501045_0006768
578 Ga0501045_0086465
579 Ga0501045_0286085
580 nmdc:mga00v17_163152_c1
581 nmdc:mga00v17_41954_c1
582 nmdc:mga0yw44_775908_c1
583 nmdc:mga0k408_108735_c1
584 nmdc:mga0k408_110380_c1
585 nmdc:mga06z11_10733_c1
586 nmdc:mga06z11_134504_c1
587 nmdc:mga06z11_16866_c1
588 nmdc:mga06z11_231441_c1
589 nmdc:mga06z11_368486_c1
590 nmdc:mga04h51_7391_c1
591 nmdc:mga05p37_1694820_c1
592 nmdc:mga05p37_17279_c1
593 nmdc:mga05p37_19046_c1
594 nmdc:mga05p37_1930_c2
595 nmdc:mga05p37_208917_c1
596 nmdc:mga05p37_4424_c1
597 nmdc:mga05p37_654598_c1
598 nmdc:mga05p37_697822_c1
599 nmdc:mga09592_1039708_c1
600 nmdc:mga09592_198934_c1
601 nmdc:mga09592_288387_c1
602 nmdc:mga09592_5601_c1
603 nmdc:mga09592_5704_c1
604 nmdc:mga09592_696609_c1
605 nmdc:mga0qj67_13145_c1
606 nmdc:mga0qj67_15738_c1
607 nmdc:mga0qj67_2191_c1
608 nmdc:mga0qj67_525183_c1
609 nmdc:mga0qj67_70112_c1
610 nmdc:mga06r32_143593_c1
611 nmdc:mga06r32_199880_c1
612 nmdc:mga06r32_38963_c1
613 nmdc:mga06r32_474185_c1
614 nmdc:mga06r32_5660_c1
615 nmdc:mga06r32_86577_c1
616 nmdc:mga08y16_223734_c1
617 nmdc:mga08y16_227799_c1
618 nmdc:mga08y16_616870_c1
619 nmdc:mga08y16_68076_c1
620 nmdc:mga0a205_20972_c1
621 nmdc:mga0a205_80170_c1
622 Ga0500641_0003196
623 Ga0500568_0001163
624 Ga0501084_0010504
625 Ga0501084_0145940
626 Ga0501084_0362087
627 Ga0501084_1042436
628 Ga0590071_000504
629 Ga0590075_000313
630 Ga0590077_002662
631 Ga0501082_0001008
632 Ga0501082_0449727
633 Ga0501082_0768508
634 Ga0501082_1272264
635 Ga0530510_0012702
636 Ga0530510_0508681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zsa-assembly1.cif.gz_1 yeast rna polymerase ii transcription pre-initiation complex with the +1 nucleosome and ntp (complex b) 0.7706 113 167
7o4l-assembly1.cif.gz_1 yeast tfiih in the expanded state within the pre-initiation complex 0.753 113 167
3psc-assembly1.cif.gz_A bovine grk2 in complex with gbetagamma subunits 0.745 112 167
3cik-assembly1.cif.gz_A human grk2 in complex with gbetagamma subunits 0.741 112 167
1fb8-assembly1.cif.gz_A structure of the pleckstrin homology domain from dapp1/phish 0.7397 113 166
ID Description Score Start End Superfamily
af_F1QHP6_18_146_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8192 50 94 1.20.140.150
af_A8DYC7_1_174_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8097 49 94 1.20.140.150
af_A4HXE3_201_306_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7616 113 164 2.30.29.30
af_O16211_1_178_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7594 118 149 3.80.10.10
af_C0PG86_1_93_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7588 102 161 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A381X1R7-F1-model_v4 Uncharacterized protein 0.9602 1 108 GO:0016020
AF-A0A381X1R7-F1-model_v4 Uncharacterized protein 0.9433 1 108 GO:0016020
AF-A0A3D4FUL1-F1-model_v4 DUF5673 domain-containing protein 0.9304 1 165 GO:0016020
AF-A0A2V7XV58-F1-model_v4 DUF5673 domain-containing protein 0.9074 3 179 GO:0016020
AF-A0A2E9NJH8-F1-model_v4 DUF5673 domain-containing protein 0.8973 1 186 GO:0016020

Map