F404652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 318 | 216 | 305 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300026035|Ga0207703_10037429|Ga0207703_100374293 |
| Length | 363 |
| Sequence | MESFGIYGSRLSLRSAGMTAVLAALGRGDSRALTRLCAPVSSTQMLDVLNLALPYFGLIFLGLLCGKLKQIPDTGLAWMNFFLIYVSLPCLFYRVLAQTPLEQLNNPRFIVATILATATMFALSFAVGWLFRRHMGEATIAGLSGAYGNIGYMGPGLALATLGPAANVPVALIFCFDTLLLFALVPFLMTLAAPRREGIAATAFEVGRRIVLHPFIIATVLGVASAAIHFEPPVALDRLMQFLQNAAAPCALFVLGVTVALRPVQKMPWEVPVTITAKLIVHPFVVLTLLSLLGPFDPTWVYTAVLMAALPPALNVFIMARQYDTWVAQASGSVLFGTFVSVVTLTATMWLVKTGALPVSLFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 3 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 4 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 5 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 6 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 7 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 8 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 9 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 10 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 11 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 12 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 105 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 108 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 113 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 127 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 168 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 169 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 190 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 195 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 205 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 207 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 208 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 209 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 210 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 213 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 216 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.91 |
| Metatranscriptomes | 0 |
| Isolates | 4.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.26 |
| Nodule | 1.57 |
| Rhizoplane | 3.14 |
| Rhizosphere | 79.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1010031 | 3300002987 | Bacteria | 2448 |
| 2 | JGI25406J46586_10008160 | 3300003203 | Bacteria | 4756 |
| 3 | Ga0065165_1000089 | 3300005262 | Bacteria | 150859 |
| 4 | Ga0070658_10043726 | 3300005327 | Bacteria | 3619 |
| 5 | Ga0070658_10059765 | 3300005327 | Bacteria | 3104 |
| 6 | Ga0070658_10194323 | 3300005327 | Bacteria | 1711 |
| 7 | Ga0070670_100157527 | 3300005331 | Bacteria | 1967 |
| 8 | Ga0068869_100042065 | 3300005334 | Bacteria | 3274 |
| 9 | Ga0070660_100072922 | 3300005339 | Bacteria | 2683 |
| 10 | Ga0070661_100128530 | 3300005344 | Bacteria | 1902 |
| 11 | Ga0070675_100171812 | 3300005354 | Bacteria | 1869 |
| 12 | Ga0070688_100201495 | 3300005365 | Bacteria | 1393 |
| 13 | Ga0070667_100102800 | 3300005367 | Bacteria | 2469 |
| 14 | Ga0070714_100048797 | 3300005435 | Bacteria | 3601 |
| 15 | Ga0070714_100270793 | 3300005435 | Bacteria | 1575 |
| 16 | Ga0070713_100003732 | 3300005436 | Bacteria | 10083 |
| 17 | Ga0070711_100082736 | 3300005439 | Bacteria | 2291 |
| 18 | Ga0070711_100273806 | 3300005439 | Bacteria | 1333 |
| 19 | Ga0070663_100114080 | 3300005455 | Bacteria | 2034 |
| 20 | Ga0070678_100296512 | 3300005456 | Bacteria | 1372 |
| 21 | Ga0070662_100335661 | 3300005457 | Bacteria | 1235 |
| 22 | Ga0070681_10052609 | 3300005458 | Bacteria | 4062 |
| 23 | Ga0070681_10359862 | 3300005458 | Bacteria | 1365 |
| 24 | Ga0070679_100020929 | 3300005530 | Bacteria | 6382 |
| 25 | Ga0070679_100055203 | 3300005530 | Bacteria | 3956 |
| 26 | Ga0070679_100169261 | 3300005530 | Bacteria | 2158 |
| 27 | Ga0070696_100206150 | 3300005546 | Bacteria | 1470 |
| 28 | Ga0068855_100012274 | 3300005563 | Bacteria | 10352 |
| 29 | Ga0068855_100062526 | 3300005563 | Bacteria | 4346 |
| 30 | Ga0068855_100161591 | 3300005563 | Bacteria | 2542 |
| 31 | Ga0068859_100063479 | 3300005617 | Bacteria | 3724 |
| 32 | Ga0068859_100524824 | 3300005617 | Bacteria | 1279 |
| 33 | Ga0068860_100108763 | 3300005843 | Bacteria | 2650 |
| 34 | Ga0081540_1000257 | 3300005983 | Bacteria | 55989 |
| 35 | Ga0081539_10000800 | 3300005985 | Bacteria | 61179 |
| 36 | Ga0070717_10107564 | 3300006028 | Bacteria | 2375 |
| 37 | Ga0075365_10010543 | 3300006038 | Bacteria | 5387 |
| 38 | Ga0075368_10007349 | 3300006042 | Bacteria | 3884 |
| 39 | Ga0075363_100010411 | 3300006048 | Bacteria | 4417 |
| 40 | Ga0075364_10024325 | 3300006051 | Bacteria | 3844 |
| 41 | Ga0075364_10076994 | 3300006051 | Bacteria | 2201 |
| 42 | Ga0075362_10178810 | 3300006177 | Bacteria | 1027 |
| 43 | Ga0075367_10053478 | 3300006178 | Bacteria | 2392 |
| 44 | Ga0075367_10092424 | 3300006178 | Bacteria | 1842 |
| 45 | Ga0075369_10020779 | 3300006186 | Bacteria | 2690 |
| 46 | Ga0075366_10040756 | 3300006195 | Bacteria | 2747 |
| 47 | Ga0075366_10064955 | 3300006195 | Bacteria | 2170 |
| 48 | Ga0075366_10118833 | 3300006195 | Bacteria | 1592 |
| 49 | Ga0097621_100188337 | 3300006237 | Bacteria | 1786 |
| 50 | Ga0075370_10060254 | 3300006353 | Bacteria | 2162 |
| 51 | Ga0068865_100281574 | 3300006881 | Bacteria | 1324 |
| 52 | Ga0075436_100022391 | 3300006914 | Bacteria | 4340 |
| 53 | Ga0097620_100063484 | 3300006931 | Bacteria | 3724 |
| 54 | Ga0097620_100524720 | 3300006931 | Bacteria | 1279 |
| 55 | Ga0105240_10023458 | 3300009093 | Bacteria | 8157 |
| 56 | Ga0105245_10024222 | 3300009098 | Bacteria | 5329 |
| 57 | Ga0105243_10066877 | 3300009148 | Bacteria | 2892 |
| 58 | Ga0105241_10171352 | 3300009174 | Bacteria | 1793 |
| 59 | Ga0105238_10091855 | 3300009551 | Bacteria | 3023 |
| 60 | Ga0105238_10193998 | 3300009551 | Bacteria | 2007 |
| 61 | Ga0163162_10336489 | 3300013306 | Bacteria | 1642 |
| 62 | Ga0157380_10361652 | 3300014326 | Bacteria | 1362 |
| 63 | Ga0209130_1000087 | 3300025284 | Bacteria | 155407 |
| 64 | Ga0209025_1003588 | 3300025294 | Bacteria | 14488 |
| 65 | Ga0209025_1080154 | 3300025294 | Bacteria | 1113 |
| 66 | Ga0207426_1003682 | 3300025302 | Bacteria | 8045 |
| 67 | Ga0207682_10021895 | 3300025893 | Bacteria | 2516 |
| 68 | Ga0207692_10035405 | 3300025898 | Bacteria | 2425 |
| 69 | Ga0207699_10064858 | 3300025906 | Bacteria | 2212 |
| 70 | Ga0207645_10191058 | 3300025907 | Bacteria | 1346 |
| 71 | Ga0207705_10044728 | 3300025909 | Bacteria | 3182 |
| 72 | Ga0207654_10053666 | 3300025911 | Bacteria | 2328 |
| 73 | Ga0207707_10013826 | 3300025912 | Bacteria | 7038 |
| 74 | Ga0207663_10009641 | 3300025916 | Bacteria | 5109 |
| 75 | Ga0207663_10213601 | 3300025916 | Bacteria | 1400 |
| 76 | Ga0207660_10059995 | 3300025917 | Bacteria | 2733 |
| 77 | Ga0207657_10067345 | 3300025919 | Bacteria | 3045 |
| 78 | Ga0207652_10025311 | 3300025921 | Bacteria | 4932 |
| 79 | Ga0207652_10118848 | 3300025921 | Bacteria | 2350 |
| 80 | Ga0207694_10050082 | 3300025924 | Bacteria | 3233 |
| 81 | Ga0207659_10077185 | 3300025926 | Bacteria | 2451 |
| 82 | Ga0207687_10020034 | 3300025927 | Bacteria | 4435 |
| 83 | Ga0207664_10073686 | 3300025929 | Bacteria | 2756 |
| 84 | Ga0207706_10395256 | 3300025933 | Bacteria | 1199 |
| 85 | Ga0207669_10141131 | 3300025937 | Bacteria | 1672 |
| 86 | Ga0207691_10008505 | 3300025940 | Bacteria | 9857 |
| 87 | Ga0207711_10047782 | 3300025941 | Bacteria | 3660 |
| 88 | Ga0207711_10173555 | 3300025941 | Bacteria | 1957 |
| 89 | Ga0207711_10197670 | 3300025941 | Bacteria | 1834 |
| 90 | Ga0207667_10012374 | 3300025949 | Bacteria | 9836 |
| 91 | Ga0207667_10041317 | 3300025949 | Bacteria | 4905 |
| 92 | Ga0207667_10178634 | 3300025949 | Bacteria | 2180 |
| 93 | Ga0207677_10328064 | 3300026023 | Bacteria | 1274 |
| 94 | Ga0207703_10034453 | 3300026035 | Bacteria | 4017 |
| 95 | Ga0207703_10037429 | 3300026035 | Bacteria | 3865 |
| 96 | Ga0207639_10076992 | 3300026041 | Bacteria | 2628 |
| 97 | Ga0207708_10197585 | 3300026075 | Bacteria | 1603 |
| 98 | Ga0207702_10524352 | 3300026078 | Bacteria | 1157 |
| 99 | Ga0207641_10268799 | 3300026088 | Bacteria | 1599 |
| 100 | Ga0207676_10054915 | 3300026095 | Bacteria | 3123 |
| 101 | Ga0207683_10012783 | 3300026121 | Bacteria | 7164 |
| 102 | Ga0207683_10207941 | 3300026121 | Bacteria | 1780 |
| 103 | Ga0207698_10096863 | 3300026142 | Bacteria | 2433 |
| 104 | Ga0209813_10019671 | 3300027866 | Bacteria | 1879 |
| 105 | Ga0268266_10466690 | 3300028379 | Bacteria | 1202 |
| 106 | Ga0265338_10215590 | 3300028800 | Bacteria | 1437 |
| 107 | Ga0265330_10023626 | 3300031235 | Bacteria | 2791 |
| 108 | Ga0265340_10023254 | 3300031247 | Bacteria | 3161 |
| 109 | Ga0265339_10063799 | 3300031249 | Bacteria | 1977 |
| 110 | Ga0265331_10040607 | 3300031250 | Bacteria | 2263 |
| 111 | Ga0265316_10113232 | 3300031344 | Bacteria | 2053 |
| 112 | Ga0265313_10023309 | 3300031595 | Bacteria | 3336 |
| 113 | Ga0316579_10011992 | 3300031691 | Bacteria | 3698 |
| 114 | Ga0265314_10005122 | 3300031711 | Bacteria | 11925 |
| 115 | Ga0265314_10026124 | 3300031711 | Bacteria | 4393 |
| 116 | Ga0265314_10061077 | 3300031711 | Bacteria | 2569 |
| 117 | Ga0265314_10142661 | 3300031711 | Bacteria | 1479 |
| 118 | Ga0265342_10004840 | 3300031712 | Bacteria | 10435 |
| 119 | Ga0307405_10031189 | 3300031731 | Bacteria | 3135 |
| 120 | Ga0373926_0045235 | 3300035083 | Bacteria | 1578 |
| 121 | Ga0373934_0082038 | 3300035086 | Bacteria | 1296 |
| 122 | Ga0373923_0000216 | 3300035111 | Bacteria | 11993 |
| 123 | Ga0373936_0000683 | 3300035113 | Bacteria | 11820 |
| 124 | Ga0373936_0013398 | 3300035113 | Bacteria | 3130 |
| 125 | Ga0373945_0001832 | 3300035116 | Bacteria | 6566 |
| 126 | Ga0373945_0069210 | 3300035116 | Bacteria | 1332 |
| 127 | Ga0373953_0016093 | 3300035117 | Bacteria | 2725 |
| 128 | Ga0373954_0004093 | 3300035118 | Bacteria | 6250 |
| 129 | Ga0373956_0004320 | 3300035119 | Bacteria | 5703 |
| 130 | Ga0373957_0011195 | 3300035120 | Bacteria | 2988 |
| 131 | Ga0373943_0036037 | 3300035170 | Bacteria | 2368 |
| 132 | Ga0373943_0080037 | 3300035170 | Bacteria | 1673 |
| 133 | Ga0373955_0000426 | 3300035172 | Bacteria | 17789 |
| 134 | Ga0373955_0001523 | 3300035172 | Bacteria | 9899 |
| 135 | Ga0373961_0001648 | 3300035241 | Bacteria | 6258 |
| 136 | Ga0373924_0000597 | 3300035410 | Bacteria | 11136 |
| 137 | Ga0373931_0070518 | 3300035691 | Bacteria | 1907 |
| 138 | Ga0373935_0000088 | 3300035692 | Bacteria | 40092 |
| 139 | Ga0373927_0194344 | 3300035695 | Bacteria | 1331 |
| 140 | Ga0373933_0006652 | 3300035724 | Bacteria | 6296 |
| 141 | Ga0373947_0002738 | 3300035725 | Bacteria | 10562 |
| 142 | Ga0373937_0000124 | 3300036401 | Bacteria | 73933 |
| 143 | Ga0373937_0012121 | 3300036401 | Bacteria | 7568 |
| 144 | Ga0373937_0270483 | 3300036401 | Bacteria | 1604 |
| 145 | Ga0373925_0000929 | 3300037068 | Bacteria | 26669 |
| 146 | Ga0237819_05234 | 3300038705 | Bacteria | 2051 |
| 147 | Ga0436365_0255420 | 3300039437 | Bacteria | 6473 |
| 148 | Ga0436365_1126455 | 3300039437 | Bacteria | 19004 |
| 149 | Ga0436365_1741712 | 3300039437 | Bacteria | 4479 |
| 150 | Ga0436363_0921248 | 3300039450 | Bacteria | 1367 |
| 151 | Ga0436362_0556235 | 3300039453 | Bacteria | 2188 |
| 152 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 153 | Ga0495592_0024541 | 3300046454 | Bacteria | 4582 |
| 154 | Ga0495603_0007829 | 3300046455 | Bacteria | 6441 |
| 155 | Ga0495629_0045295 | 3300046459 | Bacteria | 3086 |
| 156 | Ga0495629_0133809 | 3300046459 | Bacteria | 1726 |
| 157 | Ga0495651_0001798 | 3300046462 | Bacteria | 16533 |
| 158 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 159 | Ga0495653_0084599 | 3300046463 | Bacteria | 2336 |
| 160 | Ga0495639_0119806 | 3300046475 | Bacteria | 1255 |
| 161 | Ga0495662_0001688 | 3300046476 | Bacteria | 11019 |
| 162 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 163 | Ga0495664_0016826 | 3300046477 | Bacteria | 4174 |
| 164 | Ga0495664_0135785 | 3300046477 | Bacteria | 1490 |
| 165 | Ga0495608_0000560 | 3300046511 | Bacteria | 25606 |
| 166 | Ga0495618_0000059 | 3300046514 | Bacteria | 79623 |
| 167 | Ga0495618_0027234 | 3300046514 | Bacteria | 3558 |
| 168 | Ga0495628_0000530 | 3300046516 | Bacteria | 34897 |
| 169 | Ga0495628_0001927 | 3300046516 | Bacteria | 18830 |
| 170 | Ga0495630_0002351 | 3300046517 | Bacteria | 13117 |
| 171 | Ga0495652_0001393 | 3300046529 | Bacteria | 26853 |
| 172 | Ga0495652_0015699 | 3300046529 | Bacteria | 6778 |
| 173 | Ga0495652_0145379 | 3300046529 | Bacteria | 1859 |
| 174 | Ga0495665_0095142 | 3300046531 | Bacteria | 1564 |
| 175 | Ga0495640_0000029 | 3300046533 | Bacteria | 79567 |
| 176 | Ga0495640_0020173 | 3300046533 | Bacteria | 4909 |
| 177 | Ga0495586_0066283 | 3300046535 | Bacteria | 1969 |
| 178 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 179 | Ga0495587_0042135 | 3300046536 | Bacteria | 2723 |
| 180 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 181 | Ga0495645_0023203 | 3300046543 | Bacteria | 4492 |
| 182 | Ga0495667_0000061 | 3300046559 | Bacteria | 94650 |
| 183 | Ga0495634_0000345 | 3300046642 | Bacteria | 44890 |
| 184 | Ga0495634_0163765 | 3300046642 | Bacteria | 1401 |
| 185 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 186 | Ga0495635_0050144 | 3300046663 | Bacteria | 2878 |
| 187 | Ga0495657_0002787 | 3300046675 | Bacteria | 14535 |
| 188 | Ga0495599_0000066 | 3300046678 | Bacteria | 72412 |
| 189 | Ga0495599_0009859 | 3300046678 | Bacteria | 5848 |
| 190 | Ga0495623_0000428 | 3300046679 | Bacteria | 27653 |
| 191 | Ga0495646_0000108 | 3300046680 | Bacteria | 40754 |
| 192 | Ga0495646_0128091 | 3300046680 | Bacteria | 1431 |
| 193 | Ga0495647_0096480 | 3300046681 | Bacteria | 1219 |
| 194 | Ga0495613_0157153 | 3300046689 | Bacteria | 1619 |
| 195 | Ga0495624_0039009 | 3300046690 | Bacteria | 3047 |
| 196 | Ga0495600_0000030 | 3300046809 | Bacteria | 89424 |
| 197 | Ga0495600_0001326 | 3300046809 | Bacteria | 13661 |
| 198 | Ga0495581_0015790 | 3300047315 | Bacteria | 4385 |
| 199 | Ga0495604_0000501 | 3300047317 | Bacteria | 34507 |
| 200 | Ga0495674_0001027 | 3300047319 | Bacteria | 26811 |
| 201 | Ga0495674_0047567 | 3300047319 | Bacteria | 3802 |
| 202 | Ga0495680_0024077 | 3300047322 | Bacteria | 5054 |
| 203 | Ga0495680_0044564 | 3300047322 | Bacteria | 3507 |
| 204 | Ga0495675_0000056 | 3300047444 | Bacteria | 77625 |
| 205 | Ga0495675_0116447 | 3300047444 | Unclassified | 1666 |
| 206 | Ga0495684_0000056 | 3300047471 | Bacteria | 79718 |
| 207 | Ga0495684_0440336 | 3300047471 | Bacteria | 907 |
| 208 | Ga0495593_0023880 | 3300047673 | Bacteria | 3393 |
| 209 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 210 | Ga0495602_0024466 | 3300048088 | Bacteria | 5858 |
| 211 | Ga0496100_0367881 | 3300048903 | Bacteria | 1089 |
| 212 | Ga0496102_0041646 | 3300048905 | Bacteria | 4160 |
| 213 | Ga0496103_0183004 | 3300048906 | Bacteria | 1347 |
| 214 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 215 | Ga0496105_0069997 | 3300048908 | Bacteria | 2900 |
| 216 | Ga0496106_0066563 | 3300048909 | Bacteria | 2744 |
| 217 | Ga0496107_0066871 | 3300048910 | Bacteria | 2606 |
| 218 | Ga0496108_0235999 | 3300048911 | Bacteria | 1591 |
| 219 | Ga0496115_0010308 | 3300048918 | Bacteria | 6977 |
| 220 | Ga0496115_0053290 | 3300048918 | Bacteria | 3246 |
| 221 | Ga0501031_0005509 | 3300049568 | Bacteria | 8242 |
| 222 | Ga0501031_0116458 | 3300049568 | Bacteria | 1746 |
| 223 | Ga0501032_0032382 | 3300049569 | Bacteria | 3582 |
| 224 | Ga0501032_0125815 | 3300049569 | Bacteria | 1693 |
| 225 | Ga0501033_0004953 | 3300049570 | Bacteria | 10591 |
| 226 | Ga0501033_0012284 | 3300049570 | Bacteria | 6536 |
| 227 | Ga0501034_0000852 | 3300049571 | Bacteria | 45151 |
| 228 | Ga0501034_0009488 | 3300049571 | Bacteria | 10186 |
| 229 | Ga0501034_0176364 | 3300049571 | Bacteria | 2103 |
| 230 | Ga0501034_0179219 | 3300049571 | Bacteria | 2084 |
| 231 | Ga0501036_0006505 | 3300049572 | Bacteria | 9494 |
| 232 | Ga0501037_0242311 | 3300049573 | Bacteria | 1263 |
| 233 | Ga0501038_0023935 | 3300049574 | Bacteria | 5453 |
| 234 | Ga0501039_0144967 | 3300049575 | Bacteria | 1866 |
| 235 | Ga0501039_0180121 | 3300049575 | Bacteria | 1662 |
| 236 | Ga0501046_0006709 | 3300049580 | Bacteria | 10165 |
| 237 | Ga0501046_0287156 | 3300049580 | Bacteria | 1204 |
| 238 | Ga0501047_0009616 | 3300049581 | Bacteria | 9142 |
| 239 | Ga0501047_0014941 | 3300049581 | Bacteria | 7389 |
| 240 | Ga0501047_0022597 | 3300049581 | Bacteria | 6039 |
| 241 | Ga0501047_0044943 | 3300049581 | Bacteria | 4269 |
| 242 | Ga0501047_0048080 | 3300049581 | Bacteria | 4120 |
| 243 | Ga0501069_0012513 | 3300049585 | Bacteria | 4514 |
| 244 | Ga0501069_0073102 | 3300049585 | Bacteria | 1922 |
| 245 | Ga0501070_0011777 | 3300049586 | Bacteria | 7386 |
| 246 | Ga0501070_0041261 | 3300049586 | Bacteria | 3845 |
| 247 | Ga0501070_0069351 | 3300049586 | Bacteria | 2919 |
| 248 | Ga0501070_0105845 | 3300049586 | Bacteria | 2325 |
| 249 | Ga0501070_0196924 | 3300049586 | Bacteria | 1655 |
| 250 | Ga0501072_0173220 | 3300049588 | Bacteria | 1722 |
| 251 | Ga0501072_0205538 | 3300049588 | Bacteria | 1570 |
| 252 | Ga0501073_0079293 | 3300049589 | Bacteria | 2285 |
| 253 | Ga0501073_0233872 | 3300049589 | Bacteria | 1269 |
| 254 | Ga0501076_0037645 | 3300049592 | Bacteria | 3795 |
| 255 | Ga0501252_005242 | 3300049682 | Bacteria | 1404 |
| 256 | Ga0501083_0013974 | 3300049744 | Bacteria | 5610 |
| 257 | Ga0501083_0291215 | 3300049744 | Bacteria | 1062 |
| 258 | Ga0501035_0001359 | 3300049822 | Bacteria | 25173 |
| 259 | Ga0501035_0006609 | 3300049822 | Bacteria | 10852 |
| 260 | Ga0501035_0088731 | 3300049822 | Bacteria | 2724 |
| 261 | Ga0501035_0194802 | 3300049822 | Bacteria | 1741 |
| 262 | Ga0501044_0045601 | 3300049823 | Bacteria | 4541 |
| 263 | Ga0501044_0171698 | 3300049823 | Bacteria | 2139 |
| 264 | nmdc:mga0yw44_137986_c1 | 3300050492 | Bacteria | 1583 |
| 265 | nmdc:mga0k408_15093_c1 | 3300050493 | Bacteria | 4269 |
| 266 | nmdc:mga06z11_22758_c1 | 3300050494 | Bacteria | 2932 |
| 267 | nmdc:mga06z11_9161_c1 | 3300050494 | Bacteria | 4161 |
| 268 | nmdc:mga07m45_92514_c1 | 3300050496 | Bacteria | 1733 |
| 269 | nmdc:mga0qj67_45013_c1 | 3300050509 | Bacteria | 3481 |
| 270 | nmdc:mga08y16_230517_c1 | 3300050511 | Bacteria | 1915 |
| 271 | nmdc:mga08y16_281487_c1 | 3300050511 | Bacteria | 1715 |
| 272 | nmdc:mga08x19_4942_c1 | 3300050514 | Bacteria | 7874 |
| 273 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 274 | Ga0495601_0000360 | 3300053077 | Bacteria | 23959 |
| 275 | Ga0495601_0005300 | 3300053077 | Bacteria | 7505 |
| 276 | Ga0495601_0012407 | 3300053077 | Bacteria | 5112 |
| 277 | Ga0495612_0000108 | 3300053078 | Bacteria | 34924 |
| 278 | Ga0495612_0001978 | 3300053078 | Bacteria | 8443 |
| 279 | Ga0495612_0042581 | 3300053078 | Bacteria | 1853 |
| 280 | Ga0495595_0000031 | 3300053084 | Bacteria | 89199 |
| 281 | Ga0495595_0000969 | 3300053084 | Bacteria | 11036 |
| 282 | Ga0495595_0013814 | 3300053084 | Bacteria | 3417 |
| 283 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 284 | Ga0495619_0000581 | 3300053085 | Bacteria | 24290 |
| 285 | Ga0495619_0001851 | 3300053085 | Bacteria | 14080 |
| 286 | Ga0495619_0002471 | 3300053085 | Bacteria | 12094 |
| 287 | Ga0500643_005433 | 3300053087 | Bacteria | 5491 |
| 288 | Ga0500644_0000331 | 3300053088 | Bacteria | 24183 |
| 289 | Ga0500651_0134301 | 3300053093 | Bacteria | 1495 |
| 290 | Ga0500641_0009223 | 3300053096 | Bacteria | 3543 |
| 291 | Ga0500641_0029281 | 3300053096 | Bacteria | 2157 |
| 292 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 293 | Ga0500595_007827 | 3300053119 | Bacteria | 4402 |
| 294 | Ga0500595_019486 | 3300053119 | Bacteria | 2460 |
| 295 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 296 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 297 | Ga0500616_0018077 | 3300053153 | Bacteria | 3989 |
| 298 | Ga0500636_0168249 | 3300053177 | Bacteria | 1188 |
| 299 | Ga0500645_000471 | 3300053730 | Bacteria | 27490 |
| 300 | Ga0500645_020930 | 3300053730 | Bacteria | 2022 |
| 301 | Ga0501084_0163498 | 3300054114 | Bacteria | 1878 |
| 302 | Ga0501084_0294928 | 3300054114 | Bacteria | 1369 |
| 303 | Ga0501082_0000012 | 3300060353 | Bacteria | 119898 |
| 304 | Ga0501082_0010372 | 3300060353 | Bacteria | 8024 |
| 305 | Ga0530510_0234704 | 3300061734 | Bacteria | 1365 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035086 | Ga0373934_0082038 | Ga0373934_0082038_398_1207 | 265 |
| 2 | 3300046529 | Ga0495652_0145379 | Ga0495652_0145379_1010_1849 | 279 |
| 3 | 3300005331 | Ga0070670_100157527 | Ga0070670_1001575271 | 285 |
| 4 | 3300036401 | Ga0373937_0270483 | Ga0373937_0270483_731_1591 | 286 |
| 5 | 3300047444 | Ga0495675_0116447 | Ga0495675_0116447_796_1656 | 286 |
| 6 | 3300047471 | Ga0495684_0440336 | Ga0495684_0440336_21_881 | 286 |
| 7 | 3300054114 | Ga0501084_0163498 | Ga0501084_0163498_54_914 | 286 |
| 8 | 3300061734 | Ga0530510_0234704 | Ga0530510_0234704_443_1303 | 286 |
| 9 | 3300025941 | Ga0207711_10047782 | Ga0207711_100477823 | 294 |
| 10 | 3300053153 | Ga0500616_0018077 | Ga0500616_0018077_2352_3308 | 302 |
| 11 | 3300006353 | Ga0075370_10060254 | Ga0075370_100602542 | 304 |
| 12 | 3300050509 | nmdc:mga0qj67_45013_c1 | nmdc:mga0qj67_45013_c1_1818_2777 | 305 |
| 13 | 3300005530 | Ga0070679_100020929 | Ga0070679_1000209295 | 307 |
| 14 | 3300003203 | JGI25406J46586_10008160 | JGI25406J46586_100081601 | 309 |
| 15 | 3300005985 | Ga0081539_10000800 | Ga0081539_1000080025 | 309 |
| 16 | 3300006038 | Ga0075365_10010543 | Ga0075365_100105433 | 309 |
| 17 | 3300006186 | Ga0075369_10020779 | Ga0075369_100207792 | 309 |
| 18 | 3300027866 | Ga0209813_10019671 | Ga0209813_100196712 | 309 |
| 19 | 3300039450 | Ga0436363_0921248 | Ga0436363_0921248_314_1306 | 309 |
| 20 | 3300050494 | nmdc:mga06z11_9161_c1 | nmdc:mga06z11_9161_c1_1625_2587 | 309 |
| 21 | 3300005435 | Ga0070714_100270793 | Ga0070714_1002707932 | 310 |
| 22 | 3300006914 | Ga0075436_100022391 | Ga0075436_1000223912 | 310 |
| 23 | 3300031235 | Ga0265330_10023626 | Ga0265330_100236262 | 310 |
| 24 | 3300031250 | Ga0265331_10040607 | Ga0265331_100406072 | 310 |
| 25 | 3300050514 | nmdc:mga08x19_4942_c1 | nmdc:mga08x19_4942_c1_156_1118 | 310 |
| 26 | iso_pu_bacteria | 2842694124 | 2842697651 | 311 |
| 27 | 3300048906 | Ga0496103_0183004 | Ga0496103_0183004_171_1109 | 312 |
| 28 | 3300053730 | Ga0500645_020930 | Ga0500645_020930_406_1368 | 312 |
| 29 | iso_pu_bacteria | 2917554339 | 2917555520 | 312 |
| 30 | 3300039437 | Ga0436365_1741712 | Ga0436365_1741712_791_1753 | 314 |
| 31 | 3300031711 | Ga0265314_10026124 | Ga0265314_100261242 | 315 |
| 32 | iso_pu_bacteria | 2643221547 | 2643756398 | 316 |
| 33 | 3300046475 | Ga0495639_0119806 | Ga0495639_0119806_36_989 | 317 |
| 34 | 3300014326 | Ga0157380_10361652 | Ga0157380_103616522 | 318 |
| 35 | 3300026075 | Ga0207708_10197585 | Ga0207708_101975852 | 318 |
| 36 | 3300028379 | Ga0268266_10466690 | Ga0268266_104666902 | 318 |
| 37 | 3300049589 | Ga0501073_0233872 | Ga0501073_0233872_139_1095 | 318 |
| 38 | 3300050496 | nmdc:mga07m45_92514_c1 | nmdc:mga07m45_92514_c1_723_1679 | 318 |
| 39 | 3300050511 | nmdc:mga08y16_230517_c1 | nmdc:mga08y16_230517_c1_723_1679 | 318 |
| 40 | iso_pu_bacteria | 2773857925 | 2774871421 | 318 |
| 41 | iso_pu_bacteria | 2775506901 | 2776260630 | 318 |
| 42 | iso_pu_bacteria | 2882456835 | 2882460224 | 318 |
| 43 | iso_pu_bacteria | 2884298095 | 2884300072 | 318 |
| 44 | 3300005334 | Ga0068869_100042065 | Ga0068869_1000420653 | 319 |
| 45 | 3300005354 | Ga0070675_100171812 | Ga0070675_1001718122 | 319 |
| 46 | 3300005365 | Ga0070688_100201495 | Ga0070688_1002014952 | 319 |
| 47 | 3300005617 | Ga0068859_100063479 | Ga0068859_1000634792 | 319 |
| 48 | 3300006048 | Ga0075363_100010411 | Ga0075363_1000104115 | 319 |
| 49 | 3300006051 | Ga0075364_10024325 | Ga0075364_100243254 | 319 |
| 50 | 3300006051 | Ga0075364_10076994 | Ga0075364_100769942 | 319 |
| 51 | 3300006177 | Ga0075362_10178810 | Ga0075362_101788101 | 319 |
| 52 | 3300006178 | Ga0075367_10053478 | Ga0075367_100534782 | 319 |
| 53 | 3300006178 | Ga0075367_10092424 | Ga0075367_100924242 | 319 |
| 54 | 3300006195 | Ga0075366_10040756 | Ga0075366_100407563 | 319 |
| 55 | 3300006195 | Ga0075366_10118833 | Ga0075366_101188332 | 319 |
| 56 | 3300006931 | Ga0097620_100063484 | Ga0097620_1000634842 | 319 |
| 57 | 3300009148 | Ga0105243_10066877 | Ga0105243_100668773 | 319 |
| 58 | 3300009551 | Ga0105238_10193998 | Ga0105238_101939982 | 319 |
| 59 | 3300025893 | Ga0207682_10021895 | Ga0207682_100218952 | 319 |
| 60 | 3300025907 | Ga0207645_10191058 | Ga0207645_101910582 | 319 |
| 61 | 3300025926 | Ga0207659_10077185 | Ga0207659_100771851 | 319 |
| 62 | 3300025937 | Ga0207669_10141131 | Ga0207669_101411312 | 319 |
| 63 | 3300025940 | Ga0207691_10008505 | Ga0207691_1000850511 | 319 |
| 64 | 3300026088 | Ga0207641_10268799 | Ga0207641_102687992 | 319 |
| 65 | 3300026095 | Ga0207676_10054915 | Ga0207676_100549152 | 319 |
| 66 | 3300035241 | Ga0373961_0001648 | Ga0373961_0001648_2131_3090 | 319 |
| 67 | 3300039437 | Ga0436365_0255420 | Ga0436365_0255420_4399_5358 | 319 |
| 68 | 3300048911 | Ga0496108_0235999 | Ga0496108_0235999_223_1182 | 319 |
| 69 | 3300049571 | Ga0501034_0176364 | Ga0501034_0176364_50_1009 | 319 |
| 70 | 3300049585 | Ga0501069_0073102 | Ga0501069_0073102_846_1805 | 319 |
| 71 | 3300049586 | Ga0501070_0105845 | Ga0501070_0105845_1102_2061 | 319 |
| 72 | 3300049744 | Ga0501083_0291215 | Ga0501083_0291215_71_1030 | 319 |
| 73 | 3300049822 | Ga0501035_0001359 | Ga0501035_0001359_9212_10171 | 319 |
| 74 | 3300050492 | nmdc:mga0yw44_137986_c1 | nmdc:mga0yw44_137986_c1_363_1322 | 319 |
| 75 | 3300050493 | nmdc:mga0k408_15093_c1 | nmdc:mga0k408_15093_c1_2015_2974 | 319 |
| 76 | 3300050494 | nmdc:mga06z11_22758_c1 | nmdc:mga06z11_22758_c1_1225_2184 | 319 |
| 77 | 3300050511 | nmdc:mga08y16_281487_c1 | nmdc:mga08y16_281487_c1_573_1532 | 319 |
| 78 | 3300053119 | Ga0500595_007827 | Ga0500595_007827_1244_2203 | 319 |
| 79 | 3300054114 | Ga0501084_0294928 | Ga0501084_0294928_281_1240 | 319 |
| 80 | 3300060353 | Ga0501082_0000012 | Ga0501082_0000012_79399_80361 | 319 |
| 81 | iso_pu_bacteria | 2643221736 | 2644747359 | 319 |
| 82 | iso_pu_bacteria | 2841760612 | 2841761918 | 319 |
| 83 | iso_pu_bacteria | 2844104063 | 2844104943 | 319 |
| 84 | iso_pu_bacteria | 2851182111 | 2851184903 | 319 |
| 85 | iso_pu_bacteria | 2851246043 | 2851247931 | 319 |
| 86 | iso_pu_bacteria | 8057529695 | 8057529914 | 319 |
| 87 | 3300005327 | Ga0070658_10043726 | Ga0070658_100437264 | 320 |
| 88 | 3300005327 | Ga0070658_10059765 | Ga0070658_100597653 | 320 |
| 89 | 3300005327 | Ga0070658_10194323 | Ga0070658_101943232 | 320 |
| 90 | 3300005339 | Ga0070660_100072922 | Ga0070660_1000729222 | 320 |
| 91 | 3300005344 | Ga0070661_100128530 | Ga0070661_1001285301 | 320 |
| 92 | 3300005367 | Ga0070667_100102800 | Ga0070667_1001028002 | 320 |
| 93 | 3300005435 | Ga0070714_100048797 | Ga0070714_1000487972 | 320 |
| 94 | 3300005436 | Ga0070713_100003732 | Ga0070713_1000037329 | 320 |
| 95 | 3300005439 | Ga0070711_100082736 | Ga0070711_1000827362 | 320 |
| 96 | 3300005439 | Ga0070711_100273806 | Ga0070711_1002738062 | 320 |
| 97 | 3300005455 | Ga0070663_100114080 | Ga0070663_1001140802 | 320 |
| 98 | 3300005456 | Ga0070678_100296512 | Ga0070678_1002965122 | 320 |
| 99 | 3300005457 | Ga0070662_100335661 | Ga0070662_1003356611 | 320 |
| 100 | 3300005458 | Ga0070681_10052609 | Ga0070681_100526093 | 320 |
| 101 | 3300005458 | Ga0070681_10359862 | Ga0070681_103598621 | 320 |
| 102 | 3300005530 | Ga0070679_100055203 | Ga0070679_1000552034 | 320 |
| 103 | 3300005530 | Ga0070679_100169261 | Ga0070679_1001692612 | 320 |
| 104 | 3300005546 | Ga0070696_100206150 | Ga0070696_1002061502 | 320 |
| 105 | 3300005563 | Ga0068855_100012274 | Ga0068855_1000122745 | 320 |
| 106 | 3300005563 | Ga0068855_100062526 | Ga0068855_1000625265 | 320 |
| 107 | 3300005563 | Ga0068855_100161591 | Ga0068855_1001615912 | 320 |
| 108 | 3300005617 | Ga0068859_100524824 | Ga0068859_1005248242 | 320 |
| 109 | 3300005843 | Ga0068860_100108763 | Ga0068860_1001087632 | 320 |
| 110 | 3300005983 | Ga0081540_1000257 | Ga0081540_10002577 | 320 |
| 111 | 3300006028 | Ga0070717_10107564 | Ga0070717_101075642 | 320 |
| 112 | 3300006237 | Ga0097621_100188337 | Ga0097621_1001883372 | 320 |
| 113 | 3300006881 | Ga0068865_100281574 | Ga0068865_1002815741 | 320 |
| 114 | 3300006931 | Ga0097620_100524720 | Ga0097620_1005247202 | 320 |
| 115 | 3300009093 | Ga0105240_10023458 | Ga0105240_100234586 | 320 |
| 116 | 3300009098 | Ga0105245_10024222 | Ga0105245_100242222 | 320 |
| 117 | 3300009174 | Ga0105241_10171352 | Ga0105241_101713522 | 320 |
| 118 | 3300009551 | Ga0105238_10091855 | Ga0105238_100918552 | 320 |
| 119 | 3300013306 | Ga0163162_10336489 | Ga0163162_103364892 | 320 |
| 120 | 3300025898 | Ga0207692_10035405 | Ga0207692_100354052 | 320 |
| 121 | 3300025906 | Ga0207699_10064858 | Ga0207699_100648582 | 320 |
| 122 | 3300025909 | Ga0207705_10044728 | Ga0207705_100447283 | 320 |
| 123 | 3300025911 | Ga0207654_10053666 | Ga0207654_100536662 | 320 |
| 124 | 3300025912 | Ga0207707_10013826 | Ga0207707_100138265 | 320 |
| 125 | 3300025916 | Ga0207663_10009641 | Ga0207663_100096414 | 320 |
| 126 | 3300025916 | Ga0207663_10213601 | Ga0207663_102136012 | 320 |
| 127 | 3300025917 | Ga0207660_10059995 | Ga0207660_100599952 | 320 |
| 128 | 3300025919 | Ga0207657_10067345 | Ga0207657_100673452 | 320 |
| 129 | 3300025921 | Ga0207652_10025311 | Ga0207652_100253114 | 320 |
| 130 | 3300025921 | Ga0207652_10118848 | Ga0207652_101188483 | 320 |
| 131 | 3300025924 | Ga0207694_10050082 | Ga0207694_100500823 | 320 |
| 132 | 3300025927 | Ga0207687_10020034 | Ga0207687_100200342 | 320 |
| 133 | 3300025929 | Ga0207664_10073686 | Ga0207664_100736862 | 320 |
| 134 | 3300025933 | Ga0207706_10395256 | Ga0207706_103952561 | 320 |
| 135 | 3300025941 | Ga0207711_10173555 | Ga0207711_101735552 | 320 |
| 136 | 3300025941 | Ga0207711_10197670 | Ga0207711_101976702 | 320 |
| 137 | 3300025949 | Ga0207667_10012374 | Ga0207667_100123744 | 320 |
| 138 | 3300025949 | Ga0207667_10041317 | Ga0207667_100413173 | 320 |
| 139 | 3300025949 | Ga0207667_10178634 | Ga0207667_101786342 | 320 |
| 140 | 3300026023 | Ga0207677_10328064 | Ga0207677_103280641 | 320 |
| 141 | 3300026035 | Ga0207703_10034453 | Ga0207703_100344533 | 320 |
| 142 | 3300026041 | Ga0207639_10076992 | Ga0207639_100769922 | 320 |
| 143 | 3300026078 | Ga0207702_10524352 | Ga0207702_105243521 | 320 |
| 144 | 3300026142 | Ga0207698_10096863 | Ga0207698_100968632 | 320 |
| 145 | 3300028800 | Ga0265338_10215590 | Ga0265338_102155902 | 320 |
| 146 | 3300031247 | Ga0265340_10023254 | Ga0265340_100232544 | 320 |
| 147 | 3300031249 | Ga0265339_10063799 | Ga0265339_100637991 | 320 |
| 148 | 3300031344 | Ga0265316_10113232 | Ga0265316_101132321 | 320 |
| 149 | 3300031595 | Ga0265313_10023309 | Ga0265313_100233094 | 320 |
| 150 | 3300031691 | Ga0316579_10011992 | Ga0316579_100119922 | 320 |
| 151 | 3300031711 | Ga0265314_10005122 | Ga0265314_1000512210 | 320 |
| 152 | 3300031711 | Ga0265314_10061077 | Ga0265314_100610772 | 320 |
| 153 | 3300031711 | Ga0265314_10142661 | Ga0265314_101426611 | 320 |
| 154 | 3300031712 | Ga0265342_10004840 | Ga0265342_100048405 | 320 |
| 155 | 3300035083 | Ga0373926_0045235 | Ga0373926_0045235_139_1101 | 320 |
| 156 | 3300035111 | Ga0373923_0000216 | Ga0373923_0000216_5405_6367 | 320 |
| 157 | 3300035113 | Ga0373936_0000683 | Ga0373936_0000683_4844_5806 | 320 |
| 158 | 3300035113 | Ga0373936_0013398 | Ga0373936_0013398_1675_2637 | 320 |
| 159 | 3300035116 | Ga0373945_0001832 | Ga0373945_0001832_4798_5760 | 320 |
| 160 | 3300035117 | Ga0373953_0016093 | Ga0373953_0016093_1210_2172 | 320 |
| 161 | 3300035118 | Ga0373954_0004093 | Ga0373954_0004093_2022_2984 | 320 |
| 162 | 3300035119 | Ga0373956_0004320 | Ga0373956_0004320_4535_5497 | 320 |
| 163 | 3300035120 | Ga0373957_0011195 | Ga0373957_0011195_1069_2031 | 320 |
| 164 | 3300035170 | Ga0373943_0036037 | Ga0373943_0036037_778_1740 | 320 |
| 165 | 3300035170 | Ga0373943_0080037 | Ga0373943_0080037_84_1046 | 320 |
| 166 | 3300035172 | Ga0373955_0000426 | Ga0373955_0000426_14318_15280 | 320 |
| 167 | 3300035172 | Ga0373955_0001523 | Ga0373955_0001523_8700_9662 | 320 |
| 168 | 3300035410 | Ga0373924_0000597 | Ga0373924_0000597_8995_9957 | 320 |
| 169 | 3300035691 | Ga0373931_0070518 | Ga0373931_0070518_649_1611 | 320 |
| 170 | 3300035692 | Ga0373935_0000088 | Ga0373935_0000088_18759_19721 | 320 |
| 171 | 3300035695 | Ga0373927_0194344 | Ga0373927_0194344_30_992 | 320 |
| 172 | 3300035724 | Ga0373933_0006652 | Ga0373933_0006652_1054_2016 | 320 |
| 173 | 3300035725 | Ga0373947_0002738 | Ga0373947_0002738_8412_9374 | 320 |
| 174 | 3300036401 | Ga0373937_0000124 | Ga0373937_0000124_54126_55088 | 320 |
| 175 | 3300036401 | Ga0373937_0012121 | Ga0373937_0012121_6344_7306 | 320 |
| 176 | 3300037068 | Ga0373925_0000929 | Ga0373925_0000929_17685_18647 | 320 |
| 177 | 3300039437 | Ga0436365_1126455 | Ga0436365_1126455_1971_2933 | 320 |
| 178 | 3300039453 | Ga0436362_0556235 | Ga0436362_0556235_487_1449 | 320 |
| 179 | 3300046454 | Ga0495592_0000020 | Ga0495592_0000020_120803_121765 | 320 |
| 180 | 3300046454 | Ga0495592_0024541 | Ga0495592_0024541_2353_3315 | 320 |
| 181 | 3300046455 | Ga0495603_0007829 | Ga0495603_0007829_1893_2855 | 320 |
| 182 | 3300046459 | Ga0495629_0045295 | Ga0495629_0045295_861_1823 | 320 |
| 183 | 3300046459 | Ga0495629_0133809 | Ga0495629_0133809_271_1233 | 320 |
| 184 | 3300046462 | Ga0495651_0001798 | Ga0495651_0001798_829_1791 | 320 |
| 185 | 3300046463 | Ga0495653_0000046 | Ga0495653_0000046_19033_19995 | 320 |
| 186 | 3300046463 | Ga0495653_0084599 | Ga0495653_0084599_114_1076 | 320 |
| 187 | 3300046476 | Ga0495662_0001688 | Ga0495662_0001688_6007_6969 | 320 |
| 188 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_18974_19936 | 320 |
| 189 | 3300046477 | Ga0495664_0016826 | Ga0495664_0016826_2958_3920 | 320 |
| 190 | 3300046477 | Ga0495664_0135785 | Ga0495664_0135785_108_1070 | 320 |
| 191 | 3300046511 | Ga0495608_0000560 | Ga0495608_0000560_18974_19936 | 320 |
| 192 | 3300046514 | Ga0495618_0000059 | Ga0495618_0000059_18955_19917 | 320 |
| 193 | 3300046514 | Ga0495618_0027234 | Ga0495618_0027234_1472_2434 | 320 |
| 194 | 3300046516 | Ga0495628_0000530 | Ga0495628_0000530_7046_8008 | 320 |
| 195 | 3300046516 | Ga0495628_0001927 | Ga0495628_0001927_13412_14374 | 320 |
| 196 | 3300046517 | Ga0495630_0002351 | Ga0495630_0002351_11964_12926 | 320 |
| 197 | 3300046529 | Ga0495652_0001393 | Ga0495652_0001393_7046_8008 | 320 |
| 198 | 3300046529 | Ga0495652_0015699 | Ga0495652_0015699_1705_2667 | 320 |
| 199 | 3300046531 | Ga0495665_0095142 | Ga0495665_0095142_520_1482 | 320 |
| 200 | 3300046533 | Ga0495640_0000029 | Ga0495640_0000029_59778_60740 | 320 |
| 201 | 3300046533 | Ga0495640_0020173 | Ga0495640_0020173_173_1135 | 320 |
| 202 | 3300046535 | Ga0495586_0066283 | Ga0495586_0066283_184_1146 | 320 |
| 203 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_142199_143161 | 320 |
| 204 | 3300046536 | Ga0495587_0042135 | Ga0495587_0042135_1670_2632 | 320 |
| 205 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_63862_64824 | 320 |
| 206 | 3300046543 | Ga0495645_0023203 | Ga0495645_0023203_1613_2575 | 320 |
| 207 | 3300046559 | Ga0495667_0000061 | Ga0495667_0000061_74897_75859 | 320 |
| 208 | 3300046642 | Ga0495634_0000345 | Ga0495634_0000345_34835_35797 | 320 |
| 209 | 3300046642 | Ga0495634_0163765 | Ga0495634_0163765_366_1328 | 320 |
| 210 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_142431_143393 | 320 |
| 211 | 3300046663 | Ga0495635_0050144 | Ga0495635_0050144_159_1121 | 320 |
| 212 | 3300046675 | Ga0495657_0002787 | Ga0495657_0002787_6918_7880 | 320 |
| 213 | 3300046678 | Ga0495599_0000066 | Ga0495599_0000066_26818_27780 | 320 |
| 214 | 3300046678 | Ga0495599_0009859 | Ga0495599_0009859_2852_3814 | 320 |
| 215 | 3300046679 | Ga0495623_0000428 | Ga0495623_0000428_18704_19666 | 320 |
| 216 | 3300046680 | Ga0495646_0000108 | Ga0495646_0000108_18793_19755 | 320 |
| 217 | 3300046680 | Ga0495646_0128091 | Ga0495646_0128091_396_1358 | 320 |
| 218 | 3300046681 | Ga0495647_0096480 | Ga0495647_0096480_11_973 | 320 |
| 219 | 3300046689 | Ga0495613_0157153 | Ga0495613_0157153_135_1097 | 320 |
| 220 | 3300046690 | Ga0495624_0039009 | Ga0495624_0039009_821_1783 | 320 |
| 221 | 3300046809 | Ga0495600_0000030 | Ga0495600_0000030_69740_70702 | 320 |
| 222 | 3300046809 | Ga0495600_0001326 | Ga0495600_0001326_7103_8065 | 320 |
| 223 | 3300047315 | Ga0495581_0015790 | Ga0495581_0015790_1773_2735 | 320 |
| 224 | 3300047317 | Ga0495604_0000501 | Ga0495604_0000501_6918_7880 | 320 |
| 225 | 3300047319 | Ga0495674_0001027 | Ga0495674_0001027_18932_19894 | 320 |
| 226 | 3300047319 | Ga0495674_0047567 | Ga0495674_0047567_1367_2329 | 320 |
| 227 | 3300047322 | Ga0495680_0024077 | Ga0495680_0024077_515_1477 | 320 |
| 228 | 3300047322 | Ga0495680_0044564 | Ga0495680_0044564_1540_2502 | 320 |
| 229 | 3300047444 | Ga0495675_0000056 | Ga0495675_0000056_75908_76870 | 320 |
| 230 | 3300047471 | Ga0495684_0000056 | Ga0495684_0000056_59807_60769 | 320 |
| 231 | 3300047673 | Ga0495593_0023880 | Ga0495593_0023880_1305_2267 | 320 |
| 232 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_18924_19886 | 320 |
| 233 | 3300048088 | Ga0495602_0024466 | Ga0495602_0024466_4663_5625 | 320 |
| 234 | 3300048903 | Ga0496100_0367881 | Ga0496100_0367881_101_1063 | 320 |
| 235 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_69214_70176 | 320 |
| 236 | 3300048908 | Ga0496105_0069997 | Ga0496105_0069997_1467_2429 | 320 |
| 237 | 3300048909 | Ga0496106_0066563 | Ga0496106_0066563_451_1413 | 320 |
| 238 | 3300048918 | Ga0496115_0010308 | Ga0496115_0010308_4011_4973 | 320 |
| 239 | 3300048918 | Ga0496115_0053290 | Ga0496115_0053290_352_1314 | 320 |
| 240 | 3300049568 | Ga0501031_0116458 | Ga0501031_0116458_722_1684 | 320 |
| 241 | 3300049569 | Ga0501032_0125815 | Ga0501032_0125815_192_1154 | 320 |
| 242 | 3300049570 | Ga0501033_0012284 | Ga0501033_0012284_1649_2611 | 320 |
| 243 | 3300049571 | Ga0501034_0000852 | Ga0501034_0000852_10414_11376 | 320 |
| 244 | 3300049571 | Ga0501034_0179219 | Ga0501034_0179219_378_1340 | 320 |
| 245 | 3300049573 | Ga0501037_0242311 | Ga0501037_0242311_20_982 | 320 |
| 246 | 3300049575 | Ga0501039_0180121 | Ga0501039_0180121_450_1412 | 320 |
| 247 | 3300049580 | Ga0501046_0287156 | Ga0501046_0287156_74_1036 | 320 |
| 248 | 3300049581 | Ga0501047_0009616 | Ga0501047_0009616_1670_2632 | 320 |
| 249 | 3300049581 | Ga0501047_0014941 | Ga0501047_0014941_1100_2062 | 320 |
| 250 | 3300049581 | Ga0501047_0022597 | Ga0501047_0022597_3093_4055 | 320 |
| 251 | 3300049581 | Ga0501047_0044943 | Ga0501047_0044943_2986_3948 | 320 |
| 252 | 3300049586 | Ga0501070_0041261 | Ga0501070_0041261_2217_3179 | 320 |
| 253 | 3300049586 | Ga0501070_0069351 | Ga0501070_0069351_1103_2065 | 320 |
| 254 | 3300049586 | Ga0501070_0196924 | Ga0501070_0196924_562_1524 | 320 |
| 255 | 3300049588 | Ga0501072_0205538 | Ga0501072_0205538_110_1072 | 320 |
| 256 | 3300049589 | Ga0501073_0079293 | Ga0501073_0079293_1215_2177 | 320 |
| 257 | 3300049744 | Ga0501083_0013974 | Ga0501083_0013974_3407_4369 | 320 |
| 258 | 3300049822 | Ga0501035_0088731 | Ga0501035_0088731_140_1102 | 320 |
| 259 | 3300049822 | Ga0501035_0194802 | Ga0501035_0194802_330_1292 | 320 |
| 260 | 3300049823 | Ga0501044_0171698 | Ga0501044_0171698_1036_1998 | 320 |
| 261 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_346172_347134 | 320 |
| 262 | 3300053077 | Ga0495601_0000360 | Ga0495601_0000360_9674_10636 | 320 |
| 263 | 3300053077 | Ga0495601_0005300 | Ga0495601_0005300_6371_7333 | 320 |
| 264 | 3300053077 | Ga0495601_0012407 | Ga0495601_0012407_3966_4928 | 320 |
| 265 | 3300053078 | Ga0495612_0000108 | Ga0495612_0000108_26917_27879 | 320 |
| 266 | 3300053078 | Ga0495612_0001978 | Ga0495612_0001978_4006_4968 | 320 |
| 267 | 3300053078 | Ga0495612_0042581 | Ga0495612_0042581_161_1123 | 320 |
| 268 | 3300053084 | Ga0495595_0000031 | Ga0495595_0000031_6605_7567 | 320 |
| 269 | 3300053084 | Ga0495595_0000969 | Ga0495595_0000969_4580_5542 | 320 |
| 270 | 3300053084 | Ga0495595_0013814 | Ga0495595_0013814_1559_2521 | 320 |
| 271 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_146301_147263 | 320 |
| 272 | 3300053085 | Ga0495619_0000581 | Ga0495619_0000581_3826_4788 | 320 |
| 273 | 3300053085 | Ga0495619_0001851 | Ga0495619_0001851_5109_6071 | 320 |
| 274 | 3300053085 | Ga0495619_0002471 | Ga0495619_0002471_5579_6541 | 320 |
| 275 | 3300053087 | Ga0500643_005433 | Ga0500643_005433_2391_3353 | 320 |
| 276 | 3300053088 | Ga0500644_0000331 | Ga0500644_0000331_18584_19546 | 320 |
| 277 | 3300053093 | Ga0500651_0134301 | Ga0500651_0134301_73_1035 | 320 |
| 278 | 3300053096 | Ga0500641_0009223 | Ga0500641_0009223_2464_3426 | 320 |
| 279 | 3300053096 | Ga0500641_0029281 | Ga0500641_0029281_817_1779 | 320 |
| 280 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_40521_41483 | 320 |
| 281 | 3300053119 | Ga0500595_019486 | Ga0500595_019486_733_1695 | 320 |
| 282 | 3300053131 | Ga0500652_000002 | Ga0500652_000002_36799_37761 | 320 |
| 283 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_55345_56307 | 320 |
| 284 | 3300053177 | Ga0500636_0168249 | Ga0500636_0168249_116_1078 | 320 |
| 285 | 3300053730 | Ga0500645_000471 | Ga0500645_000471_16725_17687 | 320 |
| 286 | 3300060353 | Ga0501082_0010372 | Ga0501082_0010372_3816_4778 | 320 |
| 287 | 3300006042 | Ga0075368_10007349 | Ga0075368_100073492 | 321 |
| 288 | 3300006195 | Ga0075366_10064955 | Ga0075366_100649552 | 321 |
| 289 | 3300026035 | Ga0207703_10037429 | Ga0207703_100374293 | 322 |
| 290 | 3300026121 | Ga0207683_10012783 | Ga0207683_100127834 | 322 |
| 291 | 3300031731 | Ga0307405_10031189 | Ga0307405_100311891 | 322 |
| 292 | 3300049585 | Ga0501069_0012513 | Ga0501069_0012513_3069_4052 | 322 |
| 293 | 3300049682 | Ga0501252_005242 | Ga0501252_005242_388_1359 | 322 |
| 294 | 3300002987 | JGI25159J45721_1010031 | JGI25159J45721_10100312 | 323 |
| 295 | 3300005262 | Ga0065165_1000089 | Ga0065165_100008953 | 323 |
| 296 | 3300025284 | Ga0209130_1000087 | Ga0209130_100008756 | 323 |
| 297 | 3300025294 | Ga0209025_1003588 | Ga0209025_10035887 | 323 |
| 298 | 3300025294 | Ga0209025_1080154 | Ga0209025_10801541 | 323 |
| 299 | 3300025302 | Ga0207426_1003682 | Ga0207426_10036822 | 323 |
| 300 | 3300026121 | Ga0207683_10207941 | Ga0207683_102079412 | 323 |
| 301 | 3300035116 | Ga0373945_0069210 | Ga0373945_0069210_24_1007 | 323 |
| 302 | 3300038705 | Ga0237819_05234 | Ga0237819_05234_567_1538 | 323 |
| 303 | 3300048905 | Ga0496102_0041646 | Ga0496102_0041646_1860_2843 | 323 |
| 304 | 3300048910 | Ga0496107_0066871 | Ga0496107_0066871_1606_2589 | 323 |
| 305 | 3300049568 | Ga0501031_0005509 | Ga0501031_0005509_1363_2358 | 323 |
| 306 | 3300049569 | Ga0501032_0032382 | Ga0501032_0032382_1468_2463 | 323 |
| 307 | 3300049570 | Ga0501033_0004953 | Ga0501033_0004953_3036_4031 | 323 |
| 308 | 3300049571 | Ga0501034_0009488 | Ga0501034_0009488_4922_5917 | 323 |
| 309 | 3300049572 | Ga0501036_0006505 | Ga0501036_0006505_2399_3394 | 323 |
| 310 | 3300049574 | Ga0501038_0023935 | Ga0501038_0023935_1638_2633 | 323 |
| 311 | 3300049575 | Ga0501039_0144967 | Ga0501039_0144967_394_1365 | 323 |
| 312 | 3300049580 | Ga0501046_0006709 | Ga0501046_0006709_6720_7691 | 323 |
| 313 | 3300049581 | Ga0501047_0048080 | Ga0501047_0048080_2709_3704 | 323 |
| 314 | 3300049586 | Ga0501070_0011777 | Ga0501070_0011777_5903_6898 | 323 |
| 315 | 3300049588 | Ga0501072_0173220 | Ga0501072_0173220_596_1567 | 323 |
| 316 | 3300049592 | Ga0501076_0037645 | Ga0501076_0037645_211_1182 | 323 |
| 317 | 3300049822 | Ga0501035_0006609 | Ga0501035_0006609_4002_4997 | 323 |
| 318 | 3300049823 | Ga0501044_0045601 | Ga0501044_0045601_2378_3373 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qpc-assembly1.cif.gz_A | inward-facing npa bound form of auxin transporter pin8 | 0.856 | 3 | 313 |
| 7qpc-assembly1.cif.gz_A | inward-facing npa bound form of auxin transporter pin8 | 0.8246 | 3 | 313 |
| 7wks-assembly1.cif.gz_A | apo state of atpin3 | 0.8235 | 3 | 313 |
| 7y9t-assembly1.cif.gz_B | structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state | 0.7964 | 3 | 313 |
| 7wks-assembly1.cif.gz_A | apo state of atpin3 | 0.7943 | 3 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5JLM1_10_355_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8614 | 8 | 307 | 1.20.1530.20 |
| af_I1MAE5_9_526_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8411 | 7 | 308 | 1.20.1530.20 |
| af_K7LC37_9_437_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8356 | 7 | 308 | 1.20.1530.20 |
| af_I1MI30_9_487_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8338 | 7 | 308 | 1.20.1530.20 |
| af_Q9C9K5_10_382_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8244 | 7 | 308 | 1.20.1530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A543NYZ1-F1-model_v4 | deleted | 0.9911 | 1 | 323 |
|
| AF-A0A1E1V946-F1-model_v4 | Malonate transporter | 0.9821 | 1 | 323 |
GO:0005886
GO:0055085 |
| AF-A0A1E1V946-F1-model_v4 | Malonate transporter | 0.9791 | 1 | 323 |
GO:0005886
GO:0055085 |
| AF-J6LEZ5-F1-model_v4 | Malonate transporter | 0.9768 | 4 | 322 |
GO:0016020
GO:0055085 |
| AF-A0A2G9WSP3-F1-model_v4 | Malonate transporter | 0.9755 | 4 | 319 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar