F404652

General Info

Members Datasets Scaffolds Average Seq Length
318 216 305 319

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10037429|Ga0207703_100374293
Length 363
Sequence MESFGIYGSRLSLRSAGMTAVLAALGRGDSRALTRLCAPVSSTQMLDVLNLALPYFGLIFLGLLCGKLKQIPDTGLAWMNFFLIYVSLPCLFYRVLAQTPLEQLNNPRFIVATILATATMFALSFAVGWLFRRHMGEATIAGLSGAYGNIGYMGPGLALATLGPAANVPVALIFCFDTLLLFALVPFLMTLAAPRREGIAATAFEVGRRIVLHPFIIATVLGVASAAIHFEPPVALDRLMQFLQNAAAPCALFVLGVTVALRPVQKMPWEVPVTITAKLIVHPFVVLTLLSLLGPFDPTWVYTAVLMAALPPALNVFIMARQYDTWVAQASGSVLFGTFVSVVTLTATMWLVKTGALPVSLFR

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2643221736 Bosea sp. Root483D1 Isolate Unclassified
3 2773857925 Microvirga vignae BR3299 Isolate Unclassified
4 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
5 2841760612 Bosea sp. Tri-49 Isolate Nodule
6 2842694124 Methylopila sp. R-72369 Isolate Unclassified
7 2844104063 Bosea sp. Tri-39 Isolate Nodule
8 2851182111 Bosea sp. Tri-44 Isolate Nodule
9 2851246043 Bosea sp. Tri-54 Isolate Nodule
10 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
11 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
12 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.91
Metatranscriptomes 0
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 1.57
Rhizoplane 3.14
Rhizosphere 79.56
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010031 3300002987 Bacteria 2448
2 JGI25406J46586_10008160 3300003203 Bacteria 4756
3 Ga0065165_1000089 3300005262 Bacteria 150859
4 Ga0070658_10043726 3300005327 Bacteria 3619
5 Ga0070658_10059765 3300005327 Bacteria 3104
6 Ga0070658_10194323 3300005327 Bacteria 1711
7 Ga0070670_100157527 3300005331 Bacteria 1967
8 Ga0068869_100042065 3300005334 Bacteria 3274
9 Ga0070660_100072922 3300005339 Bacteria 2683
10 Ga0070661_100128530 3300005344 Bacteria 1902
11 Ga0070675_100171812 3300005354 Bacteria 1869
12 Ga0070688_100201495 3300005365 Bacteria 1393
13 Ga0070667_100102800 3300005367 Bacteria 2469
14 Ga0070714_100048797 3300005435 Bacteria 3601
15 Ga0070714_100270793 3300005435 Bacteria 1575
16 Ga0070713_100003732 3300005436 Bacteria 10083
17 Ga0070711_100082736 3300005439 Bacteria 2291
18 Ga0070711_100273806 3300005439 Bacteria 1333
19 Ga0070663_100114080 3300005455 Bacteria 2034
20 Ga0070678_100296512 3300005456 Bacteria 1372
21 Ga0070662_100335661 3300005457 Bacteria 1235
22 Ga0070681_10052609 3300005458 Bacteria 4062
23 Ga0070681_10359862 3300005458 Bacteria 1365
24 Ga0070679_100020929 3300005530 Bacteria 6382
25 Ga0070679_100055203 3300005530 Bacteria 3956
26 Ga0070679_100169261 3300005530 Bacteria 2158
27 Ga0070696_100206150 3300005546 Bacteria 1470
28 Ga0068855_100012274 3300005563 Bacteria 10352
29 Ga0068855_100062526 3300005563 Bacteria 4346
30 Ga0068855_100161591 3300005563 Bacteria 2542
31 Ga0068859_100063479 3300005617 Bacteria 3724
32 Ga0068859_100524824 3300005617 Bacteria 1279
33 Ga0068860_100108763 3300005843 Bacteria 2650
34 Ga0081540_1000257 3300005983 Bacteria 55989
35 Ga0081539_10000800 3300005985 Bacteria 61179
36 Ga0070717_10107564 3300006028 Bacteria 2375
37 Ga0075365_10010543 3300006038 Bacteria 5387
38 Ga0075368_10007349 3300006042 Bacteria 3884
39 Ga0075363_100010411 3300006048 Bacteria 4417
40 Ga0075364_10024325 3300006051 Bacteria 3844
41 Ga0075364_10076994 3300006051 Bacteria 2201
42 Ga0075362_10178810 3300006177 Bacteria 1027
43 Ga0075367_10053478 3300006178 Bacteria 2392
44 Ga0075367_10092424 3300006178 Bacteria 1842
45 Ga0075369_10020779 3300006186 Bacteria 2690
46 Ga0075366_10040756 3300006195 Bacteria 2747
47 Ga0075366_10064955 3300006195 Bacteria 2170
48 Ga0075366_10118833 3300006195 Bacteria 1592
49 Ga0097621_100188337 3300006237 Bacteria 1786
50 Ga0075370_10060254 3300006353 Bacteria 2162
51 Ga0068865_100281574 3300006881 Bacteria 1324
52 Ga0075436_100022391 3300006914 Bacteria 4340
53 Ga0097620_100063484 3300006931 Bacteria 3724
54 Ga0097620_100524720 3300006931 Bacteria 1279
55 Ga0105240_10023458 3300009093 Bacteria 8157
56 Ga0105245_10024222 3300009098 Bacteria 5329
57 Ga0105243_10066877 3300009148 Bacteria 2892
58 Ga0105241_10171352 3300009174 Bacteria 1793
59 Ga0105238_10091855 3300009551 Bacteria 3023
60 Ga0105238_10193998 3300009551 Bacteria 2007
61 Ga0163162_10336489 3300013306 Bacteria 1642
62 Ga0157380_10361652 3300014326 Bacteria 1362
63 Ga0209130_1000087 3300025284 Bacteria 155407
64 Ga0209025_1003588 3300025294 Bacteria 14488
65 Ga0209025_1080154 3300025294 Bacteria 1113
66 Ga0207426_1003682 3300025302 Bacteria 8045
67 Ga0207682_10021895 3300025893 Bacteria 2516
68 Ga0207692_10035405 3300025898 Bacteria 2425
69 Ga0207699_10064858 3300025906 Bacteria 2212
70 Ga0207645_10191058 3300025907 Bacteria 1346
71 Ga0207705_10044728 3300025909 Bacteria 3182
72 Ga0207654_10053666 3300025911 Bacteria 2328
73 Ga0207707_10013826 3300025912 Bacteria 7038
74 Ga0207663_10009641 3300025916 Bacteria 5109
75 Ga0207663_10213601 3300025916 Bacteria 1400
76 Ga0207660_10059995 3300025917 Bacteria 2733
77 Ga0207657_10067345 3300025919 Bacteria 3045
78 Ga0207652_10025311 3300025921 Bacteria 4932
79 Ga0207652_10118848 3300025921 Bacteria 2350
80 Ga0207694_10050082 3300025924 Bacteria 3233
81 Ga0207659_10077185 3300025926 Bacteria 2451
82 Ga0207687_10020034 3300025927 Bacteria 4435
83 Ga0207664_10073686 3300025929 Bacteria 2756
84 Ga0207706_10395256 3300025933 Bacteria 1199
85 Ga0207669_10141131 3300025937 Bacteria 1672
86 Ga0207691_10008505 3300025940 Bacteria 9857
87 Ga0207711_10047782 3300025941 Bacteria 3660
88 Ga0207711_10173555 3300025941 Bacteria 1957
89 Ga0207711_10197670 3300025941 Bacteria 1834
90 Ga0207667_10012374 3300025949 Bacteria 9836
91 Ga0207667_10041317 3300025949 Bacteria 4905
92 Ga0207667_10178634 3300025949 Bacteria 2180
93 Ga0207677_10328064 3300026023 Bacteria 1274
94 Ga0207703_10034453 3300026035 Bacteria 4017
95 Ga0207703_10037429 3300026035 Bacteria 3865
96 Ga0207639_10076992 3300026041 Bacteria 2628
97 Ga0207708_10197585 3300026075 Bacteria 1603
98 Ga0207702_10524352 3300026078 Bacteria 1157
99 Ga0207641_10268799 3300026088 Bacteria 1599
100 Ga0207676_10054915 3300026095 Bacteria 3123
101 Ga0207683_10012783 3300026121 Bacteria 7164
102 Ga0207683_10207941 3300026121 Bacteria 1780
103 Ga0207698_10096863 3300026142 Bacteria 2433
104 Ga0209813_10019671 3300027866 Bacteria 1879
105 Ga0268266_10466690 3300028379 Bacteria 1202
106 Ga0265338_10215590 3300028800 Bacteria 1437
107 Ga0265330_10023626 3300031235 Bacteria 2791
108 Ga0265340_10023254 3300031247 Bacteria 3161
109 Ga0265339_10063799 3300031249 Bacteria 1977
110 Ga0265331_10040607 3300031250 Bacteria 2263
111 Ga0265316_10113232 3300031344 Bacteria 2053
112 Ga0265313_10023309 3300031595 Bacteria 3336
113 Ga0316579_10011992 3300031691 Bacteria 3698
114 Ga0265314_10005122 3300031711 Bacteria 11925
115 Ga0265314_10026124 3300031711 Bacteria 4393
116 Ga0265314_10061077 3300031711 Bacteria 2569
117 Ga0265314_10142661 3300031711 Bacteria 1479
118 Ga0265342_10004840 3300031712 Bacteria 10435
119 Ga0307405_10031189 3300031731 Bacteria 3135
120 Ga0373926_0045235 3300035083 Bacteria 1578
121 Ga0373934_0082038 3300035086 Bacteria 1296
122 Ga0373923_0000216 3300035111 Bacteria 11993
123 Ga0373936_0000683 3300035113 Bacteria 11820
124 Ga0373936_0013398 3300035113 Bacteria 3130
125 Ga0373945_0001832 3300035116 Bacteria 6566
126 Ga0373945_0069210 3300035116 Bacteria 1332
127 Ga0373953_0016093 3300035117 Bacteria 2725
128 Ga0373954_0004093 3300035118 Bacteria 6250
129 Ga0373956_0004320 3300035119 Bacteria 5703
130 Ga0373957_0011195 3300035120 Bacteria 2988
131 Ga0373943_0036037 3300035170 Bacteria 2368
132 Ga0373943_0080037 3300035170 Bacteria 1673
133 Ga0373955_0000426 3300035172 Bacteria 17789
134 Ga0373955_0001523 3300035172 Bacteria 9899
135 Ga0373961_0001648 3300035241 Bacteria 6258
136 Ga0373924_0000597 3300035410 Bacteria 11136
137 Ga0373931_0070518 3300035691 Bacteria 1907
138 Ga0373935_0000088 3300035692 Bacteria 40092
139 Ga0373927_0194344 3300035695 Bacteria 1331
140 Ga0373933_0006652 3300035724 Bacteria 6296
141 Ga0373947_0002738 3300035725 Bacteria 10562
142 Ga0373937_0000124 3300036401 Bacteria 73933
143 Ga0373937_0012121 3300036401 Bacteria 7568
144 Ga0373937_0270483 3300036401 Bacteria 1604
145 Ga0373925_0000929 3300037068 Bacteria 26669
146 Ga0237819_05234 3300038705 Bacteria 2051
147 Ga0436365_0255420 3300039437 Bacteria 6473
148 Ga0436365_1126455 3300039437 Bacteria 19004
149 Ga0436365_1741712 3300039437 Bacteria 4479
150 Ga0436363_0921248 3300039450 Bacteria 1367
151 Ga0436362_0556235 3300039453 Bacteria 2188
152 Ga0495592_0000020 3300046454 Bacteria 140576
153 Ga0495592_0024541 3300046454 Bacteria 4582
154 Ga0495603_0007829 3300046455 Bacteria 6441
155 Ga0495629_0045295 3300046459 Bacteria 3086
156 Ga0495629_0133809 3300046459 Bacteria 1726
157 Ga0495651_0001798 3300046462 Bacteria 16533
158 Ga0495653_0000046 3300046463 Bacteria 113893
159 Ga0495653_0084599 3300046463 Bacteria 2336
160 Ga0495639_0119806 3300046475 Bacteria 1255
161 Ga0495662_0001688 3300046476 Bacteria 11019
162 Ga0495664_0000017 3300046477 Bacteria 172210
163 Ga0495664_0016826 3300046477 Bacteria 4174
164 Ga0495664_0135785 3300046477 Bacteria 1490
165 Ga0495608_0000560 3300046511 Bacteria 25606
166 Ga0495618_0000059 3300046514 Bacteria 79623
167 Ga0495618_0027234 3300046514 Bacteria 3558
168 Ga0495628_0000530 3300046516 Bacteria 34897
169 Ga0495628_0001927 3300046516 Bacteria 18830
170 Ga0495630_0002351 3300046517 Bacteria 13117
171 Ga0495652_0001393 3300046529 Bacteria 26853
172 Ga0495652_0015699 3300046529 Bacteria 6778
173 Ga0495652_0145379 3300046529 Bacteria 1859
174 Ga0495665_0095142 3300046531 Bacteria 1564
175 Ga0495640_0000029 3300046533 Bacteria 79567
176 Ga0495640_0020173 3300046533 Bacteria 4909
177 Ga0495586_0066283 3300046535 Bacteria 1969
178 Ga0495587_0000019 3300046536 Bacteria 161972
179 Ga0495587_0042135 3300046536 Bacteria 2723
180 Ga0495645_0000006 3300046543 Bacteria 382503
181 Ga0495645_0023203 3300046543 Bacteria 4492
182 Ga0495667_0000061 3300046559 Bacteria 94650
183 Ga0495634_0000345 3300046642 Bacteria 44890
184 Ga0495634_0163765 3300046642 Bacteria 1401
185 Ga0495635_0000023 3300046663 Bacteria 153429
186 Ga0495635_0050144 3300046663 Bacteria 2878
187 Ga0495657_0002787 3300046675 Bacteria 14535
188 Ga0495599_0000066 3300046678 Bacteria 72412
189 Ga0495599_0009859 3300046678 Bacteria 5848
190 Ga0495623_0000428 3300046679 Bacteria 27653
191 Ga0495646_0000108 3300046680 Bacteria 40754
192 Ga0495646_0128091 3300046680 Bacteria 1431
193 Ga0495647_0096480 3300046681 Bacteria 1219
194 Ga0495613_0157153 3300046689 Bacteria 1619
195 Ga0495624_0039009 3300046690 Bacteria 3047
196 Ga0495600_0000030 3300046809 Bacteria 89424
197 Ga0495600_0001326 3300046809 Bacteria 13661
198 Ga0495581_0015790 3300047315 Bacteria 4385
199 Ga0495604_0000501 3300047317 Bacteria 34507
200 Ga0495674_0001027 3300047319 Bacteria 26811
201 Ga0495674_0047567 3300047319 Bacteria 3802
202 Ga0495680_0024077 3300047322 Bacteria 5054
203 Ga0495680_0044564 3300047322 Bacteria 3507
204 Ga0495675_0000056 3300047444 Bacteria 77625
205 Ga0495675_0116447 3300047444 Unclassified 1666
206 Ga0495684_0000056 3300047471 Bacteria 79718
207 Ga0495684_0440336 3300047471 Bacteria 907
208 Ga0495593_0023880 3300047673 Bacteria 3393
209 Ga0495602_0000006 3300048088 Bacteria 322593
210 Ga0495602_0024466 3300048088 Bacteria 5858
211 Ga0496100_0367881 3300048903 Bacteria 1089
212 Ga0496102_0041646 3300048905 Bacteria 4160
213 Ga0496103_0183004 3300048906 Bacteria 1347
214 Ga0496104_0000090 3300048907 Bacteria 87877
215 Ga0496105_0069997 3300048908 Bacteria 2900
216 Ga0496106_0066563 3300048909 Bacteria 2744
217 Ga0496107_0066871 3300048910 Bacteria 2606
218 Ga0496108_0235999 3300048911 Bacteria 1591
219 Ga0496115_0010308 3300048918 Bacteria 6977
220 Ga0496115_0053290 3300048918 Bacteria 3246
221 Ga0501031_0005509 3300049568 Bacteria 8242
222 Ga0501031_0116458 3300049568 Bacteria 1746
223 Ga0501032_0032382 3300049569 Bacteria 3582
224 Ga0501032_0125815 3300049569 Bacteria 1693
225 Ga0501033_0004953 3300049570 Bacteria 10591
226 Ga0501033_0012284 3300049570 Bacteria 6536
227 Ga0501034_0000852 3300049571 Bacteria 45151
228 Ga0501034_0009488 3300049571 Bacteria 10186
229 Ga0501034_0176364 3300049571 Bacteria 2103
230 Ga0501034_0179219 3300049571 Bacteria 2084
231 Ga0501036_0006505 3300049572 Bacteria 9494
232 Ga0501037_0242311 3300049573 Bacteria 1263
233 Ga0501038_0023935 3300049574 Bacteria 5453
234 Ga0501039_0144967 3300049575 Bacteria 1866
235 Ga0501039_0180121 3300049575 Bacteria 1662
236 Ga0501046_0006709 3300049580 Bacteria 10165
237 Ga0501046_0287156 3300049580 Bacteria 1204
238 Ga0501047_0009616 3300049581 Bacteria 9142
239 Ga0501047_0014941 3300049581 Bacteria 7389
240 Ga0501047_0022597 3300049581 Bacteria 6039
241 Ga0501047_0044943 3300049581 Bacteria 4269
242 Ga0501047_0048080 3300049581 Bacteria 4120
243 Ga0501069_0012513 3300049585 Bacteria 4514
244 Ga0501069_0073102 3300049585 Bacteria 1922
245 Ga0501070_0011777 3300049586 Bacteria 7386
246 Ga0501070_0041261 3300049586 Bacteria 3845
247 Ga0501070_0069351 3300049586 Bacteria 2919
248 Ga0501070_0105845 3300049586 Bacteria 2325
249 Ga0501070_0196924 3300049586 Bacteria 1655
250 Ga0501072_0173220 3300049588 Bacteria 1722
251 Ga0501072_0205538 3300049588 Bacteria 1570
252 Ga0501073_0079293 3300049589 Bacteria 2285
253 Ga0501073_0233872 3300049589 Bacteria 1269
254 Ga0501076_0037645 3300049592 Bacteria 3795
255 Ga0501252_005242 3300049682 Bacteria 1404
256 Ga0501083_0013974 3300049744 Bacteria 5610
257 Ga0501083_0291215 3300049744 Bacteria 1062
258 Ga0501035_0001359 3300049822 Bacteria 25173
259 Ga0501035_0006609 3300049822 Bacteria 10852
260 Ga0501035_0088731 3300049822 Bacteria 2724
261 Ga0501035_0194802 3300049822 Bacteria 1741
262 Ga0501044_0045601 3300049823 Bacteria 4541
263 Ga0501044_0171698 3300049823 Bacteria 2139
264 nmdc:mga0yw44_137986_c1 3300050492 Bacteria 1583
265 nmdc:mga0k408_15093_c1 3300050493 Bacteria 4269
266 nmdc:mga06z11_22758_c1 3300050494 Bacteria 2932
267 nmdc:mga06z11_9161_c1 3300050494 Bacteria 4161
268 nmdc:mga07m45_92514_c1 3300050496 Bacteria 1733
269 nmdc:mga0qj67_45013_c1 3300050509 Bacteria 3481
270 nmdc:mga08y16_230517_c1 3300050511 Bacteria 1915
271 nmdc:mga08y16_281487_c1 3300050511 Bacteria 1715
272 nmdc:mga08x19_4942_c1 3300050514 Bacteria 7874
273 Ga0495601_0000007 3300053077 Bacteria 365972
274 Ga0495601_0000360 3300053077 Bacteria 23959
275 Ga0495601_0005300 3300053077 Bacteria 7505
276 Ga0495601_0012407 3300053077 Bacteria 5112
277 Ga0495612_0000108 3300053078 Bacteria 34924
278 Ga0495612_0001978 3300053078 Bacteria 8443
279 Ga0495612_0042581 3300053078 Bacteria 1853
280 Ga0495595_0000031 3300053084 Bacteria 89199
281 Ga0495595_0000969 3300053084 Bacteria 11036
282 Ga0495595_0013814 3300053084 Bacteria 3417
283 Ga0495619_0000023 3300053085 Bacteria 182266
284 Ga0495619_0000581 3300053085 Bacteria 24290
285 Ga0495619_0001851 3300053085 Bacteria 14080
286 Ga0495619_0002471 3300053085 Bacteria 12094
287 Ga0500643_005433 3300053087 Bacteria 5491
288 Ga0500644_0000331 3300053088 Bacteria 24183
289 Ga0500651_0134301 3300053093 Bacteria 1495
290 Ga0500641_0009223 3300053096 Bacteria 3543
291 Ga0500641_0029281 3300053096 Bacteria 2157
292 Ga0500595_000002 3300053119 Bacteria 1074388
293 Ga0500595_007827 3300053119 Bacteria 4402
294 Ga0500595_019486 3300053119 Bacteria 2460
295 Ga0500652_000002 3300053131 Bacteria 273315
296 Ga0500616_0000002 3300053153 Bacteria 1611257
297 Ga0500616_0018077 3300053153 Bacteria 3989
298 Ga0500636_0168249 3300053177 Bacteria 1188
299 Ga0500645_000471 3300053730 Bacteria 27490
300 Ga0500645_020930 3300053730 Bacteria 2022
301 Ga0501084_0163498 3300054114 Bacteria 1878
302 Ga0501084_0294928 3300054114 Bacteria 1369
303 Ga0501082_0000012 3300060353 Bacteria 119898
304 Ga0501082_0010372 3300060353 Bacteria 8024
305 Ga0530510_0234704 3300061734 Bacteria 1365

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035086 Ga0373934_0082038 Ga0373934_0082038_398_1207 265
2 3300046529 Ga0495652_0145379 Ga0495652_0145379_1010_1849 279
3 3300005331 Ga0070670_100157527 Ga0070670_1001575271 285
4 3300036401 Ga0373937_0270483 Ga0373937_0270483_731_1591 286
5 3300047444 Ga0495675_0116447 Ga0495675_0116447_796_1656 286
6 3300047471 Ga0495684_0440336 Ga0495684_0440336_21_881 286
7 3300054114 Ga0501084_0163498 Ga0501084_0163498_54_914 286
8 3300061734 Ga0530510_0234704 Ga0530510_0234704_443_1303 286
9 3300025941 Ga0207711_10047782 Ga0207711_100477823 294
10 3300053153 Ga0500616_0018077 Ga0500616_0018077_2352_3308 302
11 3300006353 Ga0075370_10060254 Ga0075370_100602542 304
12 3300050509 nmdc:mga0qj67_45013_c1 nmdc:mga0qj67_45013_c1_1818_2777 305
13 3300005530 Ga0070679_100020929 Ga0070679_1000209295 307
14 3300003203 JGI25406J46586_10008160 JGI25406J46586_100081601 309
15 3300005985 Ga0081539_10000800 Ga0081539_1000080025 309
16 3300006038 Ga0075365_10010543 Ga0075365_100105433 309
17 3300006186 Ga0075369_10020779 Ga0075369_100207792 309
18 3300027866 Ga0209813_10019671 Ga0209813_100196712 309
19 3300039450 Ga0436363_0921248 Ga0436363_0921248_314_1306 309
20 3300050494 nmdc:mga06z11_9161_c1 nmdc:mga06z11_9161_c1_1625_2587 309
21 3300005435 Ga0070714_100270793 Ga0070714_1002707932 310
22 3300006914 Ga0075436_100022391 Ga0075436_1000223912 310
23 3300031235 Ga0265330_10023626 Ga0265330_100236262 310
24 3300031250 Ga0265331_10040607 Ga0265331_100406072 310
25 3300050514 nmdc:mga08x19_4942_c1 nmdc:mga08x19_4942_c1_156_1118 310
26 iso_pu_bacteria 2842694124 2842697651 311
27 3300048906 Ga0496103_0183004 Ga0496103_0183004_171_1109 312
28 3300053730 Ga0500645_020930 Ga0500645_020930_406_1368 312
29 iso_pu_bacteria 2917554339 2917555520 312
30 3300039437 Ga0436365_1741712 Ga0436365_1741712_791_1753 314
31 3300031711 Ga0265314_10026124 Ga0265314_100261242 315
32 iso_pu_bacteria 2643221547 2643756398 316
33 3300046475 Ga0495639_0119806 Ga0495639_0119806_36_989 317
34 3300014326 Ga0157380_10361652 Ga0157380_103616522 318
35 3300026075 Ga0207708_10197585 Ga0207708_101975852 318
36 3300028379 Ga0268266_10466690 Ga0268266_104666902 318
37 3300049589 Ga0501073_0233872 Ga0501073_0233872_139_1095 318
38 3300050496 nmdc:mga07m45_92514_c1 nmdc:mga07m45_92514_c1_723_1679 318
39 3300050511 nmdc:mga08y16_230517_c1 nmdc:mga08y16_230517_c1_723_1679 318
40 iso_pu_bacteria 2773857925 2774871421 318
41 iso_pu_bacteria 2775506901 2776260630 318
42 iso_pu_bacteria 2882456835 2882460224 318
43 iso_pu_bacteria 2884298095 2884300072 318
44 3300005334 Ga0068869_100042065 Ga0068869_1000420653 319
45 3300005354 Ga0070675_100171812 Ga0070675_1001718122 319
46 3300005365 Ga0070688_100201495 Ga0070688_1002014952 319
47 3300005617 Ga0068859_100063479 Ga0068859_1000634792 319
48 3300006048 Ga0075363_100010411 Ga0075363_1000104115 319
49 3300006051 Ga0075364_10024325 Ga0075364_100243254 319
50 3300006051 Ga0075364_10076994 Ga0075364_100769942 319
51 3300006177 Ga0075362_10178810 Ga0075362_101788101 319
52 3300006178 Ga0075367_10053478 Ga0075367_100534782 319
53 3300006178 Ga0075367_10092424 Ga0075367_100924242 319
54 3300006195 Ga0075366_10040756 Ga0075366_100407563 319
55 3300006195 Ga0075366_10118833 Ga0075366_101188332 319
56 3300006931 Ga0097620_100063484 Ga0097620_1000634842 319
57 3300009148 Ga0105243_10066877 Ga0105243_100668773 319
58 3300009551 Ga0105238_10193998 Ga0105238_101939982 319
59 3300025893 Ga0207682_10021895 Ga0207682_100218952 319
60 3300025907 Ga0207645_10191058 Ga0207645_101910582 319
61 3300025926 Ga0207659_10077185 Ga0207659_100771851 319
62 3300025937 Ga0207669_10141131 Ga0207669_101411312 319
63 3300025940 Ga0207691_10008505 Ga0207691_1000850511 319
64 3300026088 Ga0207641_10268799 Ga0207641_102687992 319
65 3300026095 Ga0207676_10054915 Ga0207676_100549152 319
66 3300035241 Ga0373961_0001648 Ga0373961_0001648_2131_3090 319
67 3300039437 Ga0436365_0255420 Ga0436365_0255420_4399_5358 319
68 3300048911 Ga0496108_0235999 Ga0496108_0235999_223_1182 319
69 3300049571 Ga0501034_0176364 Ga0501034_0176364_50_1009 319
70 3300049585 Ga0501069_0073102 Ga0501069_0073102_846_1805 319
71 3300049586 Ga0501070_0105845 Ga0501070_0105845_1102_2061 319
72 3300049744 Ga0501083_0291215 Ga0501083_0291215_71_1030 319
73 3300049822 Ga0501035_0001359 Ga0501035_0001359_9212_10171 319
74 3300050492 nmdc:mga0yw44_137986_c1 nmdc:mga0yw44_137986_c1_363_1322 319
75 3300050493 nmdc:mga0k408_15093_c1 nmdc:mga0k408_15093_c1_2015_2974 319
76 3300050494 nmdc:mga06z11_22758_c1 nmdc:mga06z11_22758_c1_1225_2184 319
77 3300050511 nmdc:mga08y16_281487_c1 nmdc:mga08y16_281487_c1_573_1532 319
78 3300053119 Ga0500595_007827 Ga0500595_007827_1244_2203 319
79 3300054114 Ga0501084_0294928 Ga0501084_0294928_281_1240 319
80 3300060353 Ga0501082_0000012 Ga0501082_0000012_79399_80361 319
81 iso_pu_bacteria 2643221736 2644747359 319
82 iso_pu_bacteria 2841760612 2841761918 319
83 iso_pu_bacteria 2844104063 2844104943 319
84 iso_pu_bacteria 2851182111 2851184903 319
85 iso_pu_bacteria 2851246043 2851247931 319
86 iso_pu_bacteria 8057529695 8057529914 319
87 3300005327 Ga0070658_10043726 Ga0070658_100437264 320
88 3300005327 Ga0070658_10059765 Ga0070658_100597653 320
89 3300005327 Ga0070658_10194323 Ga0070658_101943232 320
90 3300005339 Ga0070660_100072922 Ga0070660_1000729222 320
91 3300005344 Ga0070661_100128530 Ga0070661_1001285301 320
92 3300005367 Ga0070667_100102800 Ga0070667_1001028002 320
93 3300005435 Ga0070714_100048797 Ga0070714_1000487972 320
94 3300005436 Ga0070713_100003732 Ga0070713_1000037329 320
95 3300005439 Ga0070711_100082736 Ga0070711_1000827362 320
96 3300005439 Ga0070711_100273806 Ga0070711_1002738062 320
97 3300005455 Ga0070663_100114080 Ga0070663_1001140802 320
98 3300005456 Ga0070678_100296512 Ga0070678_1002965122 320
99 3300005457 Ga0070662_100335661 Ga0070662_1003356611 320
100 3300005458 Ga0070681_10052609 Ga0070681_100526093 320
101 3300005458 Ga0070681_10359862 Ga0070681_103598621 320
102 3300005530 Ga0070679_100055203 Ga0070679_1000552034 320
103 3300005530 Ga0070679_100169261 Ga0070679_1001692612 320
104 3300005546 Ga0070696_100206150 Ga0070696_1002061502 320
105 3300005563 Ga0068855_100012274 Ga0068855_1000122745 320
106 3300005563 Ga0068855_100062526 Ga0068855_1000625265 320
107 3300005563 Ga0068855_100161591 Ga0068855_1001615912 320
108 3300005617 Ga0068859_100524824 Ga0068859_1005248242 320
109 3300005843 Ga0068860_100108763 Ga0068860_1001087632 320
110 3300005983 Ga0081540_1000257 Ga0081540_10002577 320
111 3300006028 Ga0070717_10107564 Ga0070717_101075642 320
112 3300006237 Ga0097621_100188337 Ga0097621_1001883372 320
113 3300006881 Ga0068865_100281574 Ga0068865_1002815741 320
114 3300006931 Ga0097620_100524720 Ga0097620_1005247202 320
115 3300009093 Ga0105240_10023458 Ga0105240_100234586 320
116 3300009098 Ga0105245_10024222 Ga0105245_100242222 320
117 3300009174 Ga0105241_10171352 Ga0105241_101713522 320
118 3300009551 Ga0105238_10091855 Ga0105238_100918552 320
119 3300013306 Ga0163162_10336489 Ga0163162_103364892 320
120 3300025898 Ga0207692_10035405 Ga0207692_100354052 320
121 3300025906 Ga0207699_10064858 Ga0207699_100648582 320
122 3300025909 Ga0207705_10044728 Ga0207705_100447283 320
123 3300025911 Ga0207654_10053666 Ga0207654_100536662 320
124 3300025912 Ga0207707_10013826 Ga0207707_100138265 320
125 3300025916 Ga0207663_10009641 Ga0207663_100096414 320
126 3300025916 Ga0207663_10213601 Ga0207663_102136012 320
127 3300025917 Ga0207660_10059995 Ga0207660_100599952 320
128 3300025919 Ga0207657_10067345 Ga0207657_100673452 320
129 3300025921 Ga0207652_10025311 Ga0207652_100253114 320
130 3300025921 Ga0207652_10118848 Ga0207652_101188483 320
131 3300025924 Ga0207694_10050082 Ga0207694_100500823 320
132 3300025927 Ga0207687_10020034 Ga0207687_100200342 320
133 3300025929 Ga0207664_10073686 Ga0207664_100736862 320
134 3300025933 Ga0207706_10395256 Ga0207706_103952561 320
135 3300025941 Ga0207711_10173555 Ga0207711_101735552 320
136 3300025941 Ga0207711_10197670 Ga0207711_101976702 320
137 3300025949 Ga0207667_10012374 Ga0207667_100123744 320
138 3300025949 Ga0207667_10041317 Ga0207667_100413173 320
139 3300025949 Ga0207667_10178634 Ga0207667_101786342 320
140 3300026023 Ga0207677_10328064 Ga0207677_103280641 320
141 3300026035 Ga0207703_10034453 Ga0207703_100344533 320
142 3300026041 Ga0207639_10076992 Ga0207639_100769922 320
143 3300026078 Ga0207702_10524352 Ga0207702_105243521 320
144 3300026142 Ga0207698_10096863 Ga0207698_100968632 320
145 3300028800 Ga0265338_10215590 Ga0265338_102155902 320
146 3300031247 Ga0265340_10023254 Ga0265340_100232544 320
147 3300031249 Ga0265339_10063799 Ga0265339_100637991 320
148 3300031344 Ga0265316_10113232 Ga0265316_101132321 320
149 3300031595 Ga0265313_10023309 Ga0265313_100233094 320
150 3300031691 Ga0316579_10011992 Ga0316579_100119922 320
151 3300031711 Ga0265314_10005122 Ga0265314_1000512210 320
152 3300031711 Ga0265314_10061077 Ga0265314_100610772 320
153 3300031711 Ga0265314_10142661 Ga0265314_101426611 320
154 3300031712 Ga0265342_10004840 Ga0265342_100048405 320
155 3300035083 Ga0373926_0045235 Ga0373926_0045235_139_1101 320
156 3300035111 Ga0373923_0000216 Ga0373923_0000216_5405_6367 320
157 3300035113 Ga0373936_0000683 Ga0373936_0000683_4844_5806 320
158 3300035113 Ga0373936_0013398 Ga0373936_0013398_1675_2637 320
159 3300035116 Ga0373945_0001832 Ga0373945_0001832_4798_5760 320
160 3300035117 Ga0373953_0016093 Ga0373953_0016093_1210_2172 320
161 3300035118 Ga0373954_0004093 Ga0373954_0004093_2022_2984 320
162 3300035119 Ga0373956_0004320 Ga0373956_0004320_4535_5497 320
163 3300035120 Ga0373957_0011195 Ga0373957_0011195_1069_2031 320
164 3300035170 Ga0373943_0036037 Ga0373943_0036037_778_1740 320
165 3300035170 Ga0373943_0080037 Ga0373943_0080037_84_1046 320
166 3300035172 Ga0373955_0000426 Ga0373955_0000426_14318_15280 320
167 3300035172 Ga0373955_0001523 Ga0373955_0001523_8700_9662 320
168 3300035410 Ga0373924_0000597 Ga0373924_0000597_8995_9957 320
169 3300035691 Ga0373931_0070518 Ga0373931_0070518_649_1611 320
170 3300035692 Ga0373935_0000088 Ga0373935_0000088_18759_19721 320
171 3300035695 Ga0373927_0194344 Ga0373927_0194344_30_992 320
172 3300035724 Ga0373933_0006652 Ga0373933_0006652_1054_2016 320
173 3300035725 Ga0373947_0002738 Ga0373947_0002738_8412_9374 320
174 3300036401 Ga0373937_0000124 Ga0373937_0000124_54126_55088 320
175 3300036401 Ga0373937_0012121 Ga0373937_0012121_6344_7306 320
176 3300037068 Ga0373925_0000929 Ga0373925_0000929_17685_18647 320
177 3300039437 Ga0436365_1126455 Ga0436365_1126455_1971_2933 320
178 3300039453 Ga0436362_0556235 Ga0436362_0556235_487_1449 320
179 3300046454 Ga0495592_0000020 Ga0495592_0000020_120803_121765 320
180 3300046454 Ga0495592_0024541 Ga0495592_0024541_2353_3315 320
181 3300046455 Ga0495603_0007829 Ga0495603_0007829_1893_2855 320
182 3300046459 Ga0495629_0045295 Ga0495629_0045295_861_1823 320
183 3300046459 Ga0495629_0133809 Ga0495629_0133809_271_1233 320
184 3300046462 Ga0495651_0001798 Ga0495651_0001798_829_1791 320
185 3300046463 Ga0495653_0000046 Ga0495653_0000046_19033_19995 320
186 3300046463 Ga0495653_0084599 Ga0495653_0084599_114_1076 320
187 3300046476 Ga0495662_0001688 Ga0495662_0001688_6007_6969 320
188 3300046477 Ga0495664_0000017 Ga0495664_0000017_18974_19936 320
189 3300046477 Ga0495664_0016826 Ga0495664_0016826_2958_3920 320
190 3300046477 Ga0495664_0135785 Ga0495664_0135785_108_1070 320
191 3300046511 Ga0495608_0000560 Ga0495608_0000560_18974_19936 320
192 3300046514 Ga0495618_0000059 Ga0495618_0000059_18955_19917 320
193 3300046514 Ga0495618_0027234 Ga0495618_0027234_1472_2434 320
194 3300046516 Ga0495628_0000530 Ga0495628_0000530_7046_8008 320
195 3300046516 Ga0495628_0001927 Ga0495628_0001927_13412_14374 320
196 3300046517 Ga0495630_0002351 Ga0495630_0002351_11964_12926 320
197 3300046529 Ga0495652_0001393 Ga0495652_0001393_7046_8008 320
198 3300046529 Ga0495652_0015699 Ga0495652_0015699_1705_2667 320
199 3300046531 Ga0495665_0095142 Ga0495665_0095142_520_1482 320
200 3300046533 Ga0495640_0000029 Ga0495640_0000029_59778_60740 320
201 3300046533 Ga0495640_0020173 Ga0495640_0020173_173_1135 320
202 3300046535 Ga0495586_0066283 Ga0495586_0066283_184_1146 320
203 3300046536 Ga0495587_0000019 Ga0495587_0000019_142199_143161 320
204 3300046536 Ga0495587_0042135 Ga0495587_0042135_1670_2632 320
205 3300046543 Ga0495645_0000006 Ga0495645_0000006_63862_64824 320
206 3300046543 Ga0495645_0023203 Ga0495645_0023203_1613_2575 320
207 3300046559 Ga0495667_0000061 Ga0495667_0000061_74897_75859 320
208 3300046642 Ga0495634_0000345 Ga0495634_0000345_34835_35797 320
209 3300046642 Ga0495634_0163765 Ga0495634_0163765_366_1328 320
210 3300046663 Ga0495635_0000023 Ga0495635_0000023_142431_143393 320
211 3300046663 Ga0495635_0050144 Ga0495635_0050144_159_1121 320
212 3300046675 Ga0495657_0002787 Ga0495657_0002787_6918_7880 320
213 3300046678 Ga0495599_0000066 Ga0495599_0000066_26818_27780 320
214 3300046678 Ga0495599_0009859 Ga0495599_0009859_2852_3814 320
215 3300046679 Ga0495623_0000428 Ga0495623_0000428_18704_19666 320
216 3300046680 Ga0495646_0000108 Ga0495646_0000108_18793_19755 320
217 3300046680 Ga0495646_0128091 Ga0495646_0128091_396_1358 320
218 3300046681 Ga0495647_0096480 Ga0495647_0096480_11_973 320
219 3300046689 Ga0495613_0157153 Ga0495613_0157153_135_1097 320
220 3300046690 Ga0495624_0039009 Ga0495624_0039009_821_1783 320
221 3300046809 Ga0495600_0000030 Ga0495600_0000030_69740_70702 320
222 3300046809 Ga0495600_0001326 Ga0495600_0001326_7103_8065 320
223 3300047315 Ga0495581_0015790 Ga0495581_0015790_1773_2735 320
224 3300047317 Ga0495604_0000501 Ga0495604_0000501_6918_7880 320
225 3300047319 Ga0495674_0001027 Ga0495674_0001027_18932_19894 320
226 3300047319 Ga0495674_0047567 Ga0495674_0047567_1367_2329 320
227 3300047322 Ga0495680_0024077 Ga0495680_0024077_515_1477 320
228 3300047322 Ga0495680_0044564 Ga0495680_0044564_1540_2502 320
229 3300047444 Ga0495675_0000056 Ga0495675_0000056_75908_76870 320
230 3300047471 Ga0495684_0000056 Ga0495684_0000056_59807_60769 320
231 3300047673 Ga0495593_0023880 Ga0495593_0023880_1305_2267 320
232 3300048088 Ga0495602_0000006 Ga0495602_0000006_18924_19886 320
233 3300048088 Ga0495602_0024466 Ga0495602_0024466_4663_5625 320
234 3300048903 Ga0496100_0367881 Ga0496100_0367881_101_1063 320
235 3300048907 Ga0496104_0000090 Ga0496104_0000090_69214_70176 320
236 3300048908 Ga0496105_0069997 Ga0496105_0069997_1467_2429 320
237 3300048909 Ga0496106_0066563 Ga0496106_0066563_451_1413 320
238 3300048918 Ga0496115_0010308 Ga0496115_0010308_4011_4973 320
239 3300048918 Ga0496115_0053290 Ga0496115_0053290_352_1314 320
240 3300049568 Ga0501031_0116458 Ga0501031_0116458_722_1684 320
241 3300049569 Ga0501032_0125815 Ga0501032_0125815_192_1154 320
242 3300049570 Ga0501033_0012284 Ga0501033_0012284_1649_2611 320
243 3300049571 Ga0501034_0000852 Ga0501034_0000852_10414_11376 320
244 3300049571 Ga0501034_0179219 Ga0501034_0179219_378_1340 320
245 3300049573 Ga0501037_0242311 Ga0501037_0242311_20_982 320
246 3300049575 Ga0501039_0180121 Ga0501039_0180121_450_1412 320
247 3300049580 Ga0501046_0287156 Ga0501046_0287156_74_1036 320
248 3300049581 Ga0501047_0009616 Ga0501047_0009616_1670_2632 320
249 3300049581 Ga0501047_0014941 Ga0501047_0014941_1100_2062 320
250 3300049581 Ga0501047_0022597 Ga0501047_0022597_3093_4055 320
251 3300049581 Ga0501047_0044943 Ga0501047_0044943_2986_3948 320
252 3300049586 Ga0501070_0041261 Ga0501070_0041261_2217_3179 320
253 3300049586 Ga0501070_0069351 Ga0501070_0069351_1103_2065 320
254 3300049586 Ga0501070_0196924 Ga0501070_0196924_562_1524 320
255 3300049588 Ga0501072_0205538 Ga0501072_0205538_110_1072 320
256 3300049589 Ga0501073_0079293 Ga0501073_0079293_1215_2177 320
257 3300049744 Ga0501083_0013974 Ga0501083_0013974_3407_4369 320
258 3300049822 Ga0501035_0088731 Ga0501035_0088731_140_1102 320
259 3300049822 Ga0501035_0194802 Ga0501035_0194802_330_1292 320
260 3300049823 Ga0501044_0171698 Ga0501044_0171698_1036_1998 320
261 3300053077 Ga0495601_0000007 Ga0495601_0000007_346172_347134 320
262 3300053077 Ga0495601_0000360 Ga0495601_0000360_9674_10636 320
263 3300053077 Ga0495601_0005300 Ga0495601_0005300_6371_7333 320
264 3300053077 Ga0495601_0012407 Ga0495601_0012407_3966_4928 320
265 3300053078 Ga0495612_0000108 Ga0495612_0000108_26917_27879 320
266 3300053078 Ga0495612_0001978 Ga0495612_0001978_4006_4968 320
267 3300053078 Ga0495612_0042581 Ga0495612_0042581_161_1123 320
268 3300053084 Ga0495595_0000031 Ga0495595_0000031_6605_7567 320
269 3300053084 Ga0495595_0000969 Ga0495595_0000969_4580_5542 320
270 3300053084 Ga0495595_0013814 Ga0495595_0013814_1559_2521 320
271 3300053085 Ga0495619_0000023 Ga0495619_0000023_146301_147263 320
272 3300053085 Ga0495619_0000581 Ga0495619_0000581_3826_4788 320
273 3300053085 Ga0495619_0001851 Ga0495619_0001851_5109_6071 320
274 3300053085 Ga0495619_0002471 Ga0495619_0002471_5579_6541 320
275 3300053087 Ga0500643_005433 Ga0500643_005433_2391_3353 320
276 3300053088 Ga0500644_0000331 Ga0500644_0000331_18584_19546 320
277 3300053093 Ga0500651_0134301 Ga0500651_0134301_73_1035 320
278 3300053096 Ga0500641_0009223 Ga0500641_0009223_2464_3426 320
279 3300053096 Ga0500641_0029281 Ga0500641_0029281_817_1779 320
280 3300053119 Ga0500595_000002 Ga0500595_000002_40521_41483 320
281 3300053119 Ga0500595_019486 Ga0500595_019486_733_1695 320
282 3300053131 Ga0500652_000002 Ga0500652_000002_36799_37761 320
283 3300053153 Ga0500616_0000002 Ga0500616_0000002_55345_56307 320
284 3300053177 Ga0500636_0168249 Ga0500636_0168249_116_1078 320
285 3300053730 Ga0500645_000471 Ga0500645_000471_16725_17687 320
286 3300060353 Ga0501082_0010372 Ga0501082_0010372_3816_4778 320
287 3300006042 Ga0075368_10007349 Ga0075368_100073492 321
288 3300006195 Ga0075366_10064955 Ga0075366_100649552 321
289 3300026035 Ga0207703_10037429 Ga0207703_100374293 322
290 3300026121 Ga0207683_10012783 Ga0207683_100127834 322
291 3300031731 Ga0307405_10031189 Ga0307405_100311891 322
292 3300049585 Ga0501069_0012513 Ga0501069_0012513_3069_4052 322
293 3300049682 Ga0501252_005242 Ga0501252_005242_388_1359 322
294 3300002987 JGI25159J45721_1010031 JGI25159J45721_10100312 323
295 3300005262 Ga0065165_1000089 Ga0065165_100008953 323
296 3300025284 Ga0209130_1000087 Ga0209130_100008756 323
297 3300025294 Ga0209025_1003588 Ga0209025_10035887 323
298 3300025294 Ga0209025_1080154 Ga0209025_10801541 323
299 3300025302 Ga0207426_1003682 Ga0207426_10036822 323
300 3300026121 Ga0207683_10207941 Ga0207683_102079412 323
301 3300035116 Ga0373945_0069210 Ga0373945_0069210_24_1007 323
302 3300038705 Ga0237819_05234 Ga0237819_05234_567_1538 323
303 3300048905 Ga0496102_0041646 Ga0496102_0041646_1860_2843 323
304 3300048910 Ga0496107_0066871 Ga0496107_0066871_1606_2589 323
305 3300049568 Ga0501031_0005509 Ga0501031_0005509_1363_2358 323
306 3300049569 Ga0501032_0032382 Ga0501032_0032382_1468_2463 323
307 3300049570 Ga0501033_0004953 Ga0501033_0004953_3036_4031 323
308 3300049571 Ga0501034_0009488 Ga0501034_0009488_4922_5917 323
309 3300049572 Ga0501036_0006505 Ga0501036_0006505_2399_3394 323
310 3300049574 Ga0501038_0023935 Ga0501038_0023935_1638_2633 323
311 3300049575 Ga0501039_0144967 Ga0501039_0144967_394_1365 323
312 3300049580 Ga0501046_0006709 Ga0501046_0006709_6720_7691 323
313 3300049581 Ga0501047_0048080 Ga0501047_0048080_2709_3704 323
314 3300049586 Ga0501070_0011777 Ga0501070_0011777_5903_6898 323
315 3300049588 Ga0501072_0173220 Ga0501072_0173220_596_1567 323
316 3300049592 Ga0501076_0037645 Ga0501076_0037645_211_1182 323
317 3300049822 Ga0501035_0006609 Ga0501035_0006609_4002_4997 323
318 3300049823 Ga0501044_0045601 Ga0501044_0045601_2378_3373 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03547

Mem_trans

Membrane transport protein

47

349

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.856 3 313
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.8246 3 313
7wks-assembly1.cif.gz_A apo state of atpin3 0.8235 3 313
7y9t-assembly1.cif.gz_B structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state 0.7964 3 313
7wks-assembly1.cif.gz_A apo state of atpin3 0.7943 3 313
ID Description Score Start End Superfamily
af_Q5JLM1_10_355_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8614 8 307 1.20.1530.20
af_I1MAE5_9_526_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8411 7 308 1.20.1530.20
af_K7LC37_9_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8356 7 308 1.20.1530.20
af_I1MI30_9_487_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8338 7 308 1.20.1530.20
af_Q9C9K5_10_382_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8244 7 308 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A543NYZ1-F1-model_v4 deleted 0.9911 1 323
AF-A0A1E1V946-F1-model_v4 Malonate transporter 0.9821 1 323 GO:0005886
GO:0055085
AF-A0A1E1V946-F1-model_v4 Malonate transporter 0.9791 1 323 GO:0005886
GO:0055085
AF-J6LEZ5-F1-model_v4 Malonate transporter 0.9768 4 322 GO:0016020
GO:0055085
AF-A0A2G9WSP3-F1-model_v4 Malonate transporter 0.9755 4 319 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
88.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map