F404614

General Info

Members Datasets Scaffolds Average Seq Length
318 189 285 255

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1000057|Ga0182006_1000057136
Length 270
Sequence LDDGEDRRMSATHTVLVIWLAAAWVMTAGWAWQRRKENAGIVDVLWSAGVGGAAVLAGLIGSGAPATRLVMALLGGLWGLRLAWHLWRRVGGEAEDGRYRALREHWHGSQLKFFGFFQFQAFLVGVFAVPFVAVATNPAASFSGIAVAIVIWLVSVGGESVADRQLSAFRANPANRGKTCRKGLWRYSRHPNYFFEWLHWFAYVVLAIGSPLWWLAWSGPVVMFVFLRFVSGVPYTEAQALRSRGEAYRRYQRDTPMFFPWFPKRESDNP

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221593 Lysobacter sp. Root690 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
12 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
13 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
14 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
15 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
16 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
17 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
18 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
19 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
20 2919404418 Luteibacter sp. 3190 Isolate Unclassified
21 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
22 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
23 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
24 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
25 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
26 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
27 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
28 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
29 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
30 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
31 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
32 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
33 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
123 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.31
Metatranscriptomes 0.31
Isolates 10.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 17.3
Nodule 0.31
Rhizoplane 3.46
Rhizosphere 49.37
Stem 0
Stem Tuber 0
Unclassified 29.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009949 3300001904 Bacteria 1560
2 JGI25151J46595_10003942 3300003187 Bacteria 8004
3 rootH2_10048725 3300003320 Bacteria 13226
4 rootH1_10092037 3300003323 Bacteria 2015
5 Ga0006562J51391_1147163 3300003578 Bacteria 2940
6 Ga0055526_1002239 3300003771 Bacteria 13243
7 Ga0055537_1000725 3300003773 Bacteria 16991
8 Ga0055524_1015947 3300003775 Bacteria 2718
9 Ga0055536_1001146 3300003781 Bacteria 16580
10 Ga0055536_1004096 3300003781 Bacteria 7575
11 Ga0055536_1004097 3300003781 Bacteria 7574
12 Ga0055536_1004138 3300003781 Bacteria 7520
13 Ga0055536_1008902 3300003781 Bacteria 4238
14 Ga0055536_1031776 3300003781 Bacteria 1377
15 Ga0055534_1000140 3300003784 Bacteria 54706
16 Ga0055528_1001350 3300003790 Bacteria 15167
17 Ga0055530_10000406 3300003791 Bacteria 38596
18 Ga0055530_10002169 3300003791 Bacteria 13002
19 Ga0055531_10000934 3300003794 Bacteria 23634
20 Ga0055531_10001845 3300003794 Bacteria 14941
21 Ga0055531_10005286 3300003794 Bacteria 7575
22 Ga0055531_10005288 3300003794 Bacteria 7574
23 Ga0065704_10071092 3300005289 Bacteria 13225
24 Ga0070670_100027120 3300005331 Bacteria 4926
25 Ga0070666_10000066 3300005335 Bacteria 77241
26 Ga0070660_100161490 3300005339 Bacteria 1806
27 Ga0070661_100025377 3300005344 Bacteria 4259
28 Ga0070668_100052187 3300005347 Bacteria 3152
29 Ga0070669_100082741 3300005353 Bacteria 2393
30 Ga0070669_100150071 3300005353 Bacteria 1804
31 Ga0070675_100572859 3300005354 Bacteria 1022
32 Ga0070673_100331284 3300005364 Bacteria 1347
33 Ga0070678_100020130 3300005456 Bacteria 4372
34 Ga0068853_100000269 3300005539 Bacteria 36675
35 Ga0068853_100028897 3300005539 Bacteria 4667
36 Ga0068853_100160752 3300005539 Bacteria 2027
37 Ga0070665_100015037 3300005548 Bacteria 7767
38 Ga0070665_100474568 3300005548 Bacteria 1261
39 Ga0070664_100493574 3300005564 Bacteria 1128
40 Ga0068857_100113560 3300005577 Bacteria 2435
41 Ga0081539_10144007 3300005985 Bacteria 1154
42 Ga0075365_10032882 3300006038 Bacteria 3338
43 Ga0075365_10341627 3300006038 Bacteria 1055
44 Ga0075364_10118904 3300006051 Bacteria 1768
45 Ga0075367_10054557 3300006178 Bacteria 2370
46 Ga0105251_10004131 3300009011 Bacteria 10127
47 Ga0105240_10503290 3300009093 Bacteria 1347
48 Ga0105243_10014989 3300009148 Bacteria 5868
49 Ga0105239_10077405 3300010375 Bacteria 3660
50 Ga0157373_10027621 3300013100 Bacteria 4094
51 Ga0157371_10000112 3300013102 Bacteria 122773
52 Ga0157371_10008887 3300013102 Bacteria 7956
53 Ga0157371_10010516 3300013102 Bacteria 7195
54 Ga0157370_10019389 3300013104 Bacteria 6824
55 Ga0157370_10260161 3300013104 Bacteria 1604
56 Ga0157369_10097904 3300013105 Bacteria 3129
57 Ga0163162_10000278 3300013306 Bacteria 46877
58 Ga0163162_10186745 3300013306 Bacteria 2200
59 Ga0182008_10000031 3300014497 Bacteria 166109
60 Ga0182006_1000057 3300015261 Bacteria 168707
61 Ga0182006_1009950 3300015261 Bacteria 4249
62 Ga0182006_1013551 3300015261 Bacteria 3535
63 Ga0182006_1013730 3300015261 Bacteria 3505
64 Ga0182006_1013819 3300015261 Bacteria 3492
65 Ga0182007_10000172 3300015262 Bacteria 44155
66 Ga0182005_1000462 3300015265 Bacteria 21236
67 Ga0183360_10001 3300015689 Bacteria 3943671
68 Ga0163161_10009552 3300017792 Bacteria 6706
69 Ga0163161_10011846 3300017792 Bacteria 6049
70 Ga0163161_10012403 3300017792 Bacteria 5917
71 Ga0209258_102200 3300025242 Bacteria 5310
72 Ga0207425_1003623 3300025245 Bacteria 4877
73 Ga0209646_1005642 3300025246 Bacteria 2163
74 Ga0209565_1000071 3300025263 Bacteria 166213
75 Ga0209673_1000205 3300025273 Bacteria 118408
76 Ga0209675_1000018 3300025291 Bacteria 377481
77 Ga0209676_1000075 3300025292 Bacteria 303609
78 Ga0209676_1000156 3300025292 Bacteria 163255
79 Ga0209676_1000185 3300025292 Bacteria 142505
80 Ga0209676_1001051 3300025292 Bacteria 31728
81 Ga0209676_1001787 3300025292 Bacteria 18055
82 Ga0209676_1003477 3300025292 Bacteria 9661
83 Ga0209025_1000023 3300025294 Bacteria 541307
84 Ga0209025_1000401 3300025294 Bacteria 88709
85 Ga0209025_1003199 3300025294 Bacteria 15886
86 Ga0209564_1000148 3300025295 Bacteria 172177
87 Ga0209758_1024967 3300025297 Bacteria 2641
88 Ga0209050_1000182 3300025298 Bacteria 142435
89 Ga0209050_1000390 3300025298 Bacteria 82442
90 Ga0209256_1025923 3300025299 Bacteria 1700
91 Ga0209051_1003580 3300025303 Bacteria 10103
92 Ga0209257_1000400 3300025304 Bacteria 84778
93 Ga0209257_1000503 3300025304 Bacteria 69015
94 Ga0209257_1003393 3300025304 Bacteria 13745
95 Ga0209257_1003468 3300025304 Bacteria 13472
96 Ga0209257_1003820 3300025304 Bacteria 12356
97 Ga0209257_1012329 3300025304 Bacteria 3971
98 Ga0207680_10000006 3300025903 Bacteria 635950
99 Ga0207647_10023959 3300025904 Bacteria 4031
100 Ga0207705_10003895 3300025909 Bacteria 11355
101 Ga0207657_10033180 3300025919 Bacteria 4656
102 Ga0207657_10211398 3300025919 Bacteria 1557
103 Ga0207649_10049282 3300025920 Bacteria 2600
104 Ga0207681_10117139 3300025923 Bacteria 1948
105 Ga0207681_10210914 3300025923 Bacteria 1497
106 Ga0207650_10017451 3300025925 Bacteria 5027
107 Ga0207690_10001760 3300025932 Bacteria 13300
108 Ga0207690_10057032 3300025932 Bacteria 2637
109 Ga0207651_10294099 3300025960 Bacteria 1348
110 Ga0207668_10210932 3300025972 Bacteria 1553
111 Ga0207639_10001797 3300026041 Bacteria 14437
112 Ga0207639_10036612 3300026041 Bacteria 3638
113 Ga0207674_10017422 3300026116 Bacteria 7839
114 Ga0207683_10110717 3300026121 Bacteria 2458
115 Ga0268266_10000844 3300028379 Bacteria 39924
116 Ga0265334_10051656 3300028573 Bacteria 1575
117 Ga0307517_10162276 3300028786 Bacteria 1496
118 Ga0316183_1186173 3300030742 Bacteria 6552
119 Ga0265340_10029897 3300031247 Bacteria 2734
120 Ga0316576_10003914 3300031727 Bacteria 8830
121 Ga0316576_10013516 3300031727 Bacteria 5430
122 Ga0307412_10000124 3300031911 Bacteria 57526
123 Ga0307414_10003819 3300032004 Bacteria 8097
124 Ga0307510_10000038 3300033180 Bacteria 106256
125 Ga0237819_00001 3300038705 Bacteria 103317
126 Ga0436365_1316095 3300039437 Bacteria 4561
127 Ga0439465_0029400 3300041413 Bacteria 1745
128 Ga0451853_0218152 3300041512 Bacteria 3017
129 Ga0439432_004467 3300042006 Bacteria 5109
130 Ga0439432_005539 3300042006 Bacteria 4541
131 Ga0439449_0026838 3300042007 Bacteria 2149
132 Ga0450911_000070 3300042115 Bacteria 42451
133 Ga0450901_001238 3300042533 Bacteria 2949
134 Ga0451577_0001741 3300042876 Bacteria 28063
135 Ga0451577_0332428 3300042876 Bacteria 1378
136 Ga0466963_0300005 3300044694 Bacteria 1130
137 Ga0466968_0000746 3300044735 Bacteria 11288
138 Ga0495617_000089 3300046452 Bacteria 65101
139 Ga0495627_002146 3300046453 Bacteria 9915
140 Ga0495591_024958 3300046458 Bacteria 1883
141 Ga0495638_0002782 3300046460 Bacteria 14049
142 Ga0495638_0063067 3300046460 Bacteria 2286
143 Ga0495650_0000720 3300046471 Bacteria 41984
144 Ga0495605_0139570 3300046474 Bacteria 1088
145 Ga0495584_0002045 3300046491 Bacteria 11599
146 Ga0495585_0000168 3300046492 Bacteria 70692
147 Ga0495585_0043586 3300046492 Bacteria 2508
148 Ga0495607_0074603 3300046501 Bacteria 1882
149 Ga0495606_0000275 3300046507 Bacteria 90456
150 Ga0495606_0000356 3300046507 Bacteria 78185
151 Ga0495606_0005137 3300046507 Bacteria 12696
152 Ga0495606_0006531 3300046507 Bacteria 10727
153 Ga0495606_0069922 3300046507 Bacteria 2216
154 Ga0495610_0028871 3300046512 Bacteria 2928
155 Ga0495610_0063920 3300046512 Bacteria 1741
156 Ga0495610_0150481 3300046512 Bacteria 993
157 Ga0495616_0000062 3300046513 Bacteria 91197
158 Ga0495620_0000969 3300046515 Bacteria 17678
159 Ga0495620_0006574 3300046515 Bacteria 6377
160 Ga0495631_0000192 3300046518 Bacteria 41824
161 Ga0495631_0000288 3300046518 Bacteria 35151
162 Ga0495631_0000420 3300046518 Bacteria 29217
163 Ga0495631_0026862 3300046518 Bacteria 2639
164 Ga0495632_0010629 3300046519 Bacteria 5431
165 Ga0495632_0010722 3300046519 Bacteria 5402
166 Ga0495643_0002289 3300046522 Bacteria 15479
167 Ga0495648_0000685 3300046524 Bacteria 36230
168 Ga0495648_0006710 3300046524 Bacteria 9314
169 Ga0495648_0064527 3300046524 Bacteria 2157
170 Ga0495663_0000191 3300046525 Bacteria 24465
171 Ga0495663_0000526 3300046525 Bacteria 13804
172 Ga0495663_0002410 3300046525 Bacteria 5623
173 Ga0495609_0022092 3300046538 Bacteria 2932
174 Ga0495633_0000714 3300046558 Bacteria 30168
175 Ga0495633_0000885 3300046558 Bacteria 25748
176 Ga0495633_0016661 3300046558 Bacteria 3781
177 Ga0495633_0081734 3300046558 Bacteria 1503
178 Ga0495668_0003888 3300046616 Bacteria 10904
179 Ga0495611_0000201 3300046648 Bacteria 41950
180 Ga0495625_0015197 3300046660 Bacteria 6108
181 Ga0495625_0036911 3300046660 Bacteria 3587
182 Ga0495625_0145287 3300046660 Bacteria 1597
183 Ga0495661_0002522 3300046665 Bacteria 14059
184 Ga0495670_0022688 3300046691 Bacteria 3100
185 Ga0495660_0000182 3300046810 Bacteria 67980
186 Ga0495660_0137512 3300046810 Bacteria 1219
187 Ga0495672_0000092 3300047320 Bacteria 146431
188 Ga0495672_0003737 3300047320 Bacteria 12845
189 Ga0495673_0000001 3300047469 Bacteria 1630730
190 Ga0495673_0000030 3300047469 Bacteria 468915
191 Ga0495681_0069074 3300047470 Bacteria 1606
192 Ga0495686_0000175 3300047472 Bacteria 122163
193 Ga0495686_0003708 3300047472 Bacteria 13044
194 Ga0495686_0003760 3300047472 Bacteria 12908
195 Ga0495686_0023071 3300047472 Bacteria 4111
196 Ga0495686_0034460 3300047472 Bacteria 3260
197 Ga0495686_0146461 3300047472 Bacteria 1389
198 Ga0496100_0001951 3300048903 Bacteria 10327
199 Ga0496101_0000410 3300048904 Bacteria 27774
200 Ga0496102_0003634 3300048905 Bacteria 13041
201 Ga0496103_0078714 3300048906 Bacteria 2071
202 Ga0496104_0081000 3300048907 Bacteria 3095
203 Ga0496105_0004115 3300048908 Bacteria 10905
204 Ga0496105_0069350 3300048908 Bacteria 2913
205 Ga0496106_0010593 3300048909 Bacteria 6810
206 Ga0496110_0389526 3300048913 Bacteria 1270
207 Ga0496111_0071827 3300048914 Bacteria 2519
208 Ga0496115_0004590 3300048918 Bacteria 10006
209 Ga0496116_0000081 3300048919 Bacteria 224170
210 Ga0496116_0003928 3300048919 Bacteria 14477
211 Ga0496116_0041133 3300048919 Bacteria 3174
212 Ga0496116_0074539 3300048919 Bacteria 2134
213 Ga0496116_0083739 3300048919 Bacteria 1967
214 Ga0496117_0000840 3300048920 Bacteria 47449
215 Ga0496117_0003908 3300048920 Bacteria 16880
216 Ga0496117_0004248 3300048920 Bacteria 15989
217 Ga0496117_0031698 3300048920 Bacteria 4031
218 Ga0496117_0137343 3300048920 Bacteria 1470
219 Ga0496118_0000356 3300048921 Bacteria 77474
220 Ga0496118_0002348 3300048921 Bacteria 25661
221 Ga0496118_0003563 3300048921 Bacteria 19427
222 Ga0496118_0021050 3300048921 Bacteria 5758
223 Ga0496118_0054752 3300048921 Bacteria 3018
224 Ga0496118_0074781 3300048921 Bacteria 2419
225 Ga0496119_0000813 3300048922 Bacteria 41688
226 Ga0496119_0013638 3300048922 Bacteria 6449
227 Ga0496119_0021073 3300048922 Bacteria 4724
228 Ga0496119_0189746 3300048922 Bacteria 1072
229 Ga0496120_0001576 3300048923 Bacteria 26656
230 Ga0496120_0031309 3300048923 Bacteria 3222
231 Ga0496120_0093670 3300048923 Bacteria 1600
232 Ga0496121_0000521 3300048924 Bacteria 73374
233 Ga0496121_0001833 3300048924 Bacteria 34277
234 Ga0496121_0012450 3300048924 Bacteria 9272
235 Ga0496121_0014092 3300048924 Bacteria 8523
236 Ga0496121_0039320 3300048924 Bacteria 4171
237 Ga0496121_0047367 3300048924 Bacteria 3668
238 Ga0496121_0238106 3300048924 Bacteria 1270
239 Ga0496122_0008155 3300048925 Bacteria 11402
240 Ga0496122_0019322 3300048925 Bacteria 6229
241 Ga0496122_0019459 3300048925 Bacteria 6199
242 Ga0496122_0027543 3300048925 Bacteria 4855
243 Ga0496122_0104461 3300048925 Bacteria 1882
244 Ga0496123_0003289 3300048926 Bacteria 18308
245 Ga0496123_0003813 3300048926 Bacteria 16462
246 Ga0496123_0005994 3300048926 Bacteria 11953
247 Ga0496123_0011270 3300048926 Bacteria 7771
248 Ga0496123_0037610 3300048926 Bacteria 3415
249 Ga0496123_0049428 3300048926 Bacteria 2820
250 Ga0496123_0099095 3300048926 Bacteria 1702
251 Ga0496123_0150707 3300048926 Bacteria 1255
252 Ga0496124_0002988 3300048927 Bacteria 21163
253 Ga0496124_0003626 3300048927 Bacteria 18740
254 Ga0496124_0010690 3300048927 Bacteria 9259
255 Ga0496124_0011825 3300048927 Bacteria 8693
256 Ga0496124_0042022 3300048927 Bacteria 3938
257 Ga0496124_0077829 3300048927 Bacteria 2734
258 Ga0496124_0186393 3300048927 Bacteria 1592
259 Ga0496124_0190015 3300048927 Bacteria 1572
260 Ga0496125_0002091 3300048928 Bacteria 26857
261 Ga0496125_0002404 3300048928 Bacteria 24362
262 Ga0496125_0018160 3300048928 Bacteria 6683
263 Ga0496125_0025900 3300048928 Bacteria 5359
264 Ga0496125_0041640 3300048928 Bacteria 3924
265 Ga0496125_0078700 3300048928 Bacteria 2532
266 Ga0496125_0113958 3300048928 Bacteria 1949
267 Ga0496126_0002248 3300048929 Bacteria 26659
268 Ga0496126_0003751 3300048929 Bacteria 18892
269 Ga0496126_0007935 3300048929 Bacteria 11539
270 Ga0496126_0017413 3300048929 Bacteria 7159
271 Ga0496126_0054868 3300048929 Bacteria 3607
272 Ga0496126_0123759 3300048929 Bacteria 2240
273 Ga0495682_0000350 3300049460 Bacteria 33753
274 Ga0501034_0000147 3300049571 Bacteria 132629
275 Ga0501034_0114082 3300049571 Bacteria 2691
276 Ga0501077_0035645 3300049593 Bacteria 3168
277 Ga0501045_0100344 3300049824 Bacteria 2143
278 nmdc:mga00v17_335903_c1 3300050491 Bacteria 982
279 nmdc:mga0yw44_86397_c1 3300050492 Bacteria 1975
280 nmdc:mga06z11_40532_c1 3300050494 Bacteria 2324
281 Ga0495619_0128407 3300053085 Bacteria 1741
282 Ga0500568_0027418 3300053139 Bacteria 2382
283 Ga0500633_0160459 3300053160 Bacteria 843
284 Ga0500645_000476 3300053730 Bacteria 27430
285 Ga0500565_000044 3300053734 Bacteria 5628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_335903_c1 nmdc:mga00v17_335903_c1_304_966 213
2 3300015689 Ga0183360_10001 Ga0183360_100011566 215
3 3300015261 Ga0182006_1013819 Ga0182006_10138193 220
4 3300048928 Ga0496125_0002091 Ga0496125_0002091_9905_10702 220
5 3300003578 Ga0006562J51391_1147163 Ga0006562J51391_11471632 222
6 3300005335 Ga0070666_10000066 Ga0070666_1000006629 222
7 3300025903 Ga0207680_10000006 Ga0207680_1000000638 222
8 3300048928 Ga0496125_0041640 Ga0496125_0041640_1812_2660 222
9 3300048929 Ga0496126_0007935 Ga0496126_0007935_5824_6672 222
10 3300005539 Ga0068853_100160752 Ga0068853_1001607523 223
11 3300005548 Ga0070665_100015037 Ga0070665_1000150372 223
12 3300025294 Ga0209025_1003199 Ga0209025_10031996 223
13 3300025909 Ga0207705_10003895 Ga0207705_1000389510 223
14 3300028379 Ga0268266_10000844 Ga0268266_100008448 223
15 3300006038 Ga0075365_10341627 Ga0075365_103416272 228
16 3300046507 Ga0495606_0000356 Ga0495606_0000356_66884_67696 228
17 3300046518 Ga0495631_0026862 Ga0495631_0026862_1092_1904 228
18 3300046660 Ga0495625_0145287 Ga0495625_0145287_245_1057 228
19 3300047472 Ga0495686_0146461 Ga0495686_0146461_243_1055 228
20 3300048924 Ga0496121_0047367 Ga0496121_0047367_518_1330 228
21 3300013306 Ga0163162_10000278 Ga0163162_1000027814 229
22 3300025920 Ga0207649_10049282 Ga0207649_100492822 229
23 3300044735 Ga0466968_0000746 Ga0466968_0000746_8319_9113 229
24 3300046452 Ga0495617_000089 Ga0495617_000089_53122_53934 229
25 3300046515 Ga0495620_0000969 Ga0495620_0000969_11339_12151 229
26 3300048926 Ga0496123_0099095 Ga0496123_0099095_684_1481 229
27 3300048919 Ga0496116_0003928 Ga0496116_0003928_1584_2381 230
28 3300049571 Ga0501034_0114082 Ga0501034_0114082_361_1134 231
29 3300003781 Ga0055536_1031776 Ga0055536_10317762 232
30 3300009011 Ga0105251_10004131 Ga0105251_100041315 232
31 3300025292 Ga0209676_1003477 Ga0209676_10034774 232
32 3300048907 Ga0496104_0081000 Ga0496104_0081000_1442_2296 232
33 3300048908 Ga0496105_0004115 Ga0496105_0004115_7508_8362 232
34 3300053085 Ga0495619_0128407 Ga0495619_0128407_186_1040 232
35 3300006038 Ga0075365_10032882 Ga0075365_100328823 233
36 3300013104 Ga0157370_10019389 Ga0157370_100193896 233
37 3300013306 Ga0163162_10186745 Ga0163162_101867451 233
38 3300014497 Ga0182008_10000031 Ga0182008_10000031116 233
39 3300017792 Ga0163161_10012403 Ga0163161_100124033 233
40 3300046460 Ga0495638_0002782 Ga0495638_0002782_8023_8820 233
41 3300047470 Ga0495681_0069074 Ga0495681_0069074_414_1211 233
42 3300048913 Ga0496110_0389526 Ga0496110_0389526_249_1046 233
43 3300048918 Ga0496115_0004590 Ga0496115_0004590_4122_4919 233
44 3300048920 Ga0496117_0000840 Ga0496117_0000840_18193_18990 233
45 3300048924 Ga0496121_0012450 Ga0496121_0012450_5261_6058 233
46 3300048925 Ga0496122_0019459 Ga0496122_0019459_2650_3447 233
47 3300048926 Ga0496123_0011270 Ga0496123_0011270_1712_2509 233
48 3300048927 Ga0496124_0042022 Ga0496124_0042022_357_1154 233
49 3300048928 Ga0496125_0078700 Ga0496125_0078700_1606_2403 233
50 3300048929 Ga0496126_0123759 Ga0496126_0123759_993_1790 233
51 3300050492 nmdc:mga0yw44_86397_c1 nmdc:mga0yw44_86397_c1_840_1637 233
52 3300053734 Ga0500565_000044 Ga0500565_000044_2327_3124 233
53 3300042533 Ga0450901_001238 Ga0450901_001238_1754_2548 235
54 3300048927 Ga0496124_0186393 Ga0496124_0186393_641_1435 235
55 3300046512 Ga0495610_0150481 Ga0495610_0150481_53_850 236
56 3300046524 Ga0495648_0064527 Ga0495648_0064527_903_1700 236
57 3300046538 Ga0495609_0022092 Ga0495609_0022092_980_1777 236
58 3300003781 Ga0055536_1004138 Ga0055536_10041384 237
59 3300025292 Ga0209676_1000156 Ga0209676_1000156100 237
60 3300013102 Ga0157371_10008887 Ga0157371_100088875 238
61 3300039437 Ga0436365_1316095 Ga0436365_1316095_1888_2691 238
62 3300048919 Ga0496116_0041133 Ga0496116_0041133_377_1162 238
63 3300048922 Ga0496119_0021073 Ga0496119_0021073_692_1477 238
64 3300048922 Ga0496119_0189746 Ga0496119_0189746_239_1015 238
65 3300048923 Ga0496120_0031309 Ga0496120_0031309_2081_2866 238
66 3300048928 Ga0496125_0113958 Ga0496125_0113958_800_1585 238
67 3300046525 Ga0495663_0000526 Ga0495663_0000526_9982_10776 239
68 3300046558 Ga0495633_0000885 Ga0495633_0000885_4011_4805 239
69 3300048927 Ga0496124_0190015 Ga0496124_0190015_10_762 239
70 3300015262 Ga0182007_10000172 Ga0182007_100001727 240
71 3300015265 Ga0182005_1000462 Ga0182005_100046214 240
72 3300017792 Ga0163161_10009552 Ga0163161_100095525 240
73 3300046453 Ga0495627_002146 Ga0495627_002146_4968_5765 240
74 3300046458 Ga0495591_024958 Ga0495591_024958_146_943 240
75 3300046810 Ga0495660_0137512 Ga0495660_0137512_387_1181 240
76 3300047472 Ga0495686_0034460 Ga0495686_0034460_2124_2918 240
77 3300048914 Ga0496111_0071827 Ga0496111_0071827_100_897 240
78 3300048920 Ga0496117_0003908 Ga0496117_0003908_4186_4983 240
79 3300048921 Ga0496118_0003563 Ga0496118_0003563_3902_4699 240
80 3300048927 Ga0496124_0002988 Ga0496124_0002988_1855_2652 240
81 3300048927 Ga0496124_0010690 Ga0496124_0010690_946_1743 240
82 3300048927 Ga0496124_0011825 Ga0496124_0011825_7522_8319 240
83 3300048928 Ga0496125_0025900 Ga0496125_0025900_3667_4464 240
84 3300048929 Ga0496126_0003751 Ga0496126_0003751_12958_13719 240
85 3300048929 Ga0496126_0054868 Ga0496126_0054868_1899_2696 240
86 3300005347 Ga0070668_100052187 Ga0070668_1000521874 241
87 3300013100 Ga0157373_10027621 Ga0157373_100276212 241
88 3300013102 Ga0157371_10010516 Ga0157371_100105164 241
89 3300013105 Ga0157369_10097904 Ga0157369_100979041 241
90 3300015261 Ga0182006_1013730 Ga0182006_10137302 241
91 3300017792 Ga0163161_10011846 Ga0163161_100118462 241
92 3300025972 Ga0207668_10210932 Ga0207668_102109322 241
93 3300031911 Ga0307412_10000124 Ga0307412_100001245 241
94 3300032004 Ga0307414_10003819 Ga0307414_100038194 241
95 3300042115 Ga0450911_000070 Ga0450911_000070_36745_37521 241
96 3300047472 Ga0495686_0003708 Ga0495686_0003708_4957_5751 241
97 3300048919 Ga0496116_0000081 Ga0496116_0000081_147052_147828 241
98 3300048920 Ga0496117_0004248 Ga0496117_0004248_1862_2659 241
99 3300048920 Ga0496117_0137343 Ga0496117_0137343_677_1453 241
100 3300048921 Ga0496118_0074781 Ga0496118_0074781_548_1324 241
101 3300048924 Ga0496121_0039320 Ga0496121_0039320_365_1141 241
102 3300048926 Ga0496123_0150707 Ga0496123_0150707_170_946 241
103 3300048927 Ga0496124_0003626 Ga0496124_0003626_6712_7509 241
104 3300048928 Ga0496125_0018160 Ga0496125_0018160_4914_5690 241
105 3300013102 Ga0157371_10000112 Ga0157371_1000011238 242
106 3300030742 Ga0316183_1186173 Ga0316183_11861734 242
107 3300042006 Ga0439432_004467 Ga0439432_004467_1130_1924 242
108 3300046525 Ga0495663_0002410 Ga0495663_0002410_3363_4160 242
109 3300046558 Ga0495633_0081734 Ga0495633_0081734_636_1433 242
110 3300048908 Ga0496105_0069350 Ga0496105_0069350_312_1109 242
111 3300048919 Ga0496116_0074539 Ga0496116_0074539_260_1057 242
112 3300048921 Ga0496118_0054752 Ga0496118_0054752_629_1426 242
113 3300048922 Ga0496119_0000813 Ga0496119_0000813_7661_8458 242
114 3300048923 Ga0496120_0001576 Ga0496120_0001576_14511_15308 242
115 3300048924 Ga0496121_0014092 Ga0496121_0014092_4846_5643 242
116 3300048928 Ga0496125_0002404 Ga0496125_0002404_5964_6761 242
117 3300048929 Ga0496126_0002248 Ga0496126_0002248_18205_19002 242
118 3300005456 Ga0070678_100020130 Ga0070678_1000201303 243
119 3300005985 Ga0081539_10144007 Ga0081539_101440072 243
120 3300026121 Ga0207683_10110717 Ga0207683_101107172 243
121 3300046507 Ga0495606_0005137 Ga0495606_0005137_6176_6964 243
122 3300047320 Ga0495672_0003737 Ga0495672_0003737_8770_9567 243
123 3300026041 Ga0207639_10036612 Ga0207639_100366124 244
124 3300048925 Ga0496122_0019322 Ga0496122_0019322_2651_3448 244
125 3300048926 Ga0496123_0003289 Ga0496123_0003289_9658_10455 244
126 3300003781 Ga0055536_1001146 Ga0055536_10011467 245
127 3300003791 Ga0055530_10000406 Ga0055530_100004067 245
128 3300025292 Ga0209676_1000075 Ga0209676_100007584 245
129 3300025298 Ga0209050_1000390 Ga0209050_100039050 245
130 3300042876 Ga0451577_0001741 Ga0451577_0001741_8186_8959 245
131 3300003320 rootH2_10048725 rootH2_100487256 246
132 3300003323 rootH1_10092037 rootH1_100920372 246
133 3300003771 Ga0055526_1002239 Ga0055526_10022398 246
134 3300003773 Ga0055537_1000725 Ga0055537_100072516 246
135 3300003775 Ga0055524_1015947 Ga0055524_10159472 246
136 3300003781 Ga0055536_1004096 Ga0055536_10040968 246
137 3300003781 Ga0055536_1004097 Ga0055536_10040978 246
138 3300003784 Ga0055534_1000140 Ga0055534_100014020 246
139 3300003790 Ga0055528_1001350 Ga0055528_10013507 246
140 3300003791 Ga0055530_10002169 Ga0055530_1000216911 246
141 3300003794 Ga0055531_10005286 Ga0055531_100052862 246
142 3300003794 Ga0055531_10005288 Ga0055531_100052888 246
143 3300005353 Ga0070669_100150071 Ga0070669_1001500712 246
144 3300006051 Ga0075364_10118904 Ga0075364_101189043 246
145 3300015261 Ga0182006_1009950 Ga0182006_10099505 246
146 3300015261 Ga0182006_1013551 Ga0182006_10135512 246
147 3300025292 Ga0209676_1000185 Ga0209676_100018554 246
148 3300025292 Ga0209676_1001787 Ga0209676_10017872 246
149 3300025298 Ga0209050_1000182 Ga0209050_100018293 246
150 3300025299 Ga0209256_1025923 Ga0209256_10259232 246
151 3300025303 Ga0209051_1003580 Ga0209051_10035807 246
152 3300025304 Ga0209257_1000503 Ga0209257_100050354 246
153 3300025304 Ga0209257_1003393 Ga0209257_10033932 246
154 3300046660 Ga0495625_0036911 Ga0495625_0036911_1994_2788 246
155 3300048922 Ga0496119_0013638 Ga0496119_0013638_3096_3887 246
156 3300048923 Ga0496120_0093670 Ga0496120_0093670_316_1107 246
157 3300003794 Ga0055531_10001845 Ga0055531_100018457 247
158 3300005548 Ga0070665_100474568 Ga0070665_1004745682 247
159 3300006178 Ga0075367_10054557 Ga0075367_100545571 247
160 3300025263 Ga0209565_1000071 Ga0209565_1000071105 247
161 3300025273 Ga0209673_1000205 Ga0209673_1000205106 247
162 3300025291 Ga0209675_1000018 Ga0209675_1000018237 247
163 3300025295 Ga0209564_1000148 Ga0209564_1000148105 247
164 3300025304 Ga0209257_1003820 Ga0209257_10038208 247
165 3300025923 Ga0207681_10210914 Ga0207681_102109142 247
166 3300042006 Ga0439432_005539 Ga0439432_005539_2130_2924 247
167 3300046522 Ga0495643_0002289 Ga0495643_0002289_7805_8599 247
168 3300046558 Ga0495633_0016661 Ga0495633_0016661_1454_2251 247
169 3300047320 Ga0495672_0000092 Ga0495672_0000092_38977_39771 247
170 3300048919 Ga0496116_0083739 Ga0496116_0083739_1073_1867 247
171 3300048921 Ga0496118_0002348 Ga0496118_0002348_21165_21959 247
172 3300048925 Ga0496122_0027543 Ga0496122_0027543_2918_3712 247
173 3300048926 Ga0496123_0037610 Ga0496123_0037610_1522_2316 247
174 3300048927 Ga0496124_0077829 Ga0496124_0077829_1461_2255 247
175 3300050494 nmdc:mga06z11_40532_c1 nmdc:mga06z11_40532_c1_33_827 247
176 iso_pu_bacteria 2547132130 2547501309 247
177 iso_pu_bacteria 2816332141 2816517107 247
178 iso_pu_bacteria 2842391507 2842392295 247
179 iso_pu_bacteria 2874220319 2874221855 247
180 iso_pu_bacteria 2919089067 2919089514 247
181 iso_pu_bacteria 2919134579 2919136019 247
182 iso_pu_bacteria 2928496128 2928497321 247
183 iso_pu_bacteria 2931380184 2931380548 247
184 iso_pu_bacteria 2937610967 2937612702 247
185 iso_pu_bacteria 2939626828 2939627132 247
186 iso_pu_bacteria 2961047084 2961048622 247
187 iso_pu_bacteria 2961064222 2961067244 247
188 3300044694 Ga0466963_0300005 Ga0466963_0300005_123_926 248
189 3300046518 Ga0495631_0000192 Ga0495631_0000192_3878_4687 248
190 3300005331 Ga0070670_100027120 Ga0070670_1000271203 249
191 3300005353 Ga0070669_100082741 Ga0070669_1000827412 249
192 3300005354 Ga0070675_100572859 Ga0070675_1005728592 249
193 3300005364 Ga0070673_100331284 Ga0070673_1003312842 249
194 3300005564 Ga0070664_100493574 Ga0070664_1004935742 249
195 3300025923 Ga0207681_10117139 Ga0207681_101171392 249
196 3300025925 Ga0207650_10017451 Ga0207650_100174515 249
197 3300025960 Ga0207651_10294099 Ga0207651_102940992 249
198 3300038705 Ga0237819_00001 Ga0237819_00001_37447_38229 249
199 iso_pu_bacteria 2747842428 2747949796 249
200 iso_pu_bacteria 2765235840 2765579184 249
201 iso_pu_bacteria 2974307012 2974310507 249
202 iso_pu_bacteria 2977247770 2977251240 249
203 iso_pu_bacteria 2984514374 2984518119 249
204 3300031727 Ga0316576_10013516 Ga0316576_100135162 250
205 iso_pu_bacteria 2576861471 2578460087 250
206 iso_pu_bacteria 2842757796 2842760886 250
207 iso_pu_bacteria 2852649853 2852652639 250
208 iso_pu_bacteria 2939622612 2939623461 250
209 iso_pu_bacteria 2941475908 2941479365 250
210 3300009148 Ga0105243_10014989 Ga0105243_100149897 251
211 3300025304 Ga0209257_1003468 Ga0209257_10034685 251
212 3300046460 Ga0495638_0063067 Ga0495638_0063067_1261_2046 251
213 3300046525 Ga0495663_0000191 Ga0495663_0000191_1990_2766 251
214 3300046558 Ga0495633_0000714 Ga0495633_0000714_1596_2372 251
215 iso_pu_bacteria 2537561836 2538834350 251
216 iso_pu_bacteria 2643221593 2643977931 251
217 iso_pu_bacteria 2718218334 2721027755 251
218 iso_pu_bacteria 2734482264 2735836688 251
219 iso_pu_bacteria 2738543009 2739228604 251
220 iso_pu_bacteria 2919404418 2919405676 251
221 3300003187 JGI25151J46595_10003942 JGI25151J46595_100039422 252
222 3300003781 Ga0055536_1008902 Ga0055536_10089023 252
223 3300003794 Ga0055531_10000934 Ga0055531_1000093415 252
224 3300025292 Ga0209676_1001051 Ga0209676_10010519 252
225 3300025294 Ga0209025_1000401 Ga0209025_100040153 252
226 3300025304 Ga0209257_1000400 Ga0209257_100040050 252
227 3300042876 Ga0451577_0332428 Ga0451577_0332428_360_1157 252
228 iso_pu_bacteria 2643221573 2643881631 252
229 iso_pu_bacteria 2643221579 2643906302 252
230 iso_pu_bacteria 2643221581 2643915324 252
231 iso_pu_bacteria 2923516293 2923519129 252
232 iso_pu_bacteria 2941489479 2941490389 252
233 3300025304 Ga0209257_1012329 Ga0209257_10123294 253
234 3300031247 Ga0265340_10029897 Ga0265340_100298973 253
235 3300049824 Ga0501045_0100344 Ga0501045_0100344_1094_1876 253
236 3300005339 Ga0070660_100161490 Ga0070660_1001614902 254
237 3300005344 Ga0070661_100025377 Ga0070661_1000253775 254
238 3300005539 Ga0068853_100000269 Ga0068853_10000026920 254
239 3300005577 Ga0068857_100113560 Ga0068857_1001135603 254
240 3300010375 Ga0105239_10077405 Ga0105239_100774053 254
241 3300015261 Ga0182006_1000057 Ga0182006_1000057136 254
242 3300025245 Ga0207425_1003623 Ga0207425_10036235 254
243 3300025294 Ga0209025_1000023 Ga0209025_100002363 254
244 3300025297 Ga0209758_1024967 Ga0209758_10249671 254
245 3300025919 Ga0207657_10033180 Ga0207657_100331804 254
246 3300025919 Ga0207657_10211398 Ga0207657_102113982 254
247 3300025932 Ga0207690_10001760 Ga0207690_1000176012 254
248 3300025932 Ga0207690_10057032 Ga0207690_100570322 254
249 3300026041 Ga0207639_10001797 Ga0207639_100017977 254
250 3300026116 Ga0207674_10017422 Ga0207674_100174223 254
251 3300028786 Ga0307517_10162276 Ga0307517_101622762 254
252 3300031727 Ga0316576_10003914 Ga0316576_100039143 254
253 3300033180 Ga0307510_10000038 Ga0307510_1000003823 254
254 3300046471 Ga0495650_0000720 Ga0495650_0000720_27390_28178 254
255 3300046474 Ga0495605_0139570 Ga0495605_0139570_209_997 254
256 3300046491 Ga0495584_0002045 Ga0495584_0002045_859_1647 254
257 3300046492 Ga0495585_0000168 Ga0495585_0000168_43950_44738 254
258 3300046492 Ga0495585_0043586 Ga0495585_0043586_563_1351 254
259 3300046501 Ga0495607_0074603 Ga0495607_0074603_503_1291 254
260 3300046507 Ga0495606_0000275 Ga0495606_0000275_34953_35741 254
261 3300046507 Ga0495606_0006531 Ga0495606_0006531_5630_6418 254
262 3300046507 Ga0495606_0069922 Ga0495606_0069922_616_1428 254
263 3300046512 Ga0495610_0028871 Ga0495610_0028871_1378_2166 254
264 3300046512 Ga0495610_0063920 Ga0495610_0063920_763_1551 254
265 3300046513 Ga0495616_0000062 Ga0495616_0000062_62847_63635 254
266 3300046515 Ga0495620_0006574 Ga0495620_0006574_3387_4175 254
267 3300046518 Ga0495631_0000288 Ga0495631_0000288_27373_28161 254
268 3300046518 Ga0495631_0000420 Ga0495631_0000420_2502_3290 254
269 3300046519 Ga0495632_0010629 Ga0495632_0010629_2133_2921 254
270 3300046519 Ga0495632_0010722 Ga0495632_0010722_1329_2117 254
271 3300046524 Ga0495648_0000685 Ga0495648_0000685_33757_34545 254
272 3300046524 Ga0495648_0006710 Ga0495648_0006710_4164_4952 254
273 3300046616 Ga0495668_0003888 Ga0495668_0003888_8492_9304 254
274 3300046648 Ga0495611_0000201 Ga0495611_0000201_27355_28143 254
275 3300046660 Ga0495625_0015197 Ga0495625_0015197_484_1272 254
276 3300046665 Ga0495661_0002522 Ga0495661_0002522_12975_13763 254
277 3300046691 Ga0495670_0022688 Ga0495670_0022688_765_1553 254
278 3300046810 Ga0495660_0000182 Ga0495660_0000182_15705_16517 254
279 3300047469 Ga0495673_0000001 Ga0495673_0000001_1157945_1158757 254
280 3300047469 Ga0495673_0000030 Ga0495673_0000030_28461_29249 254
281 3300047472 Ga0495686_0000175 Ga0495686_0000175_39586_40374 254
282 3300047472 Ga0495686_0003760 Ga0495686_0003760_10137_10925 254
283 3300047472 Ga0495686_0023071 Ga0495686_0023071_263_1051 254
284 3300048903 Ga0496100_0001951 Ga0496100_0001951_2537_3325 254
285 3300048904 Ga0496101_0000410 Ga0496101_0000410_3857_4645 254
286 3300048905 Ga0496102_0003634 Ga0496102_0003634_10579_11358 254
287 3300048909 Ga0496106_0010593 Ga0496106_0010593_2734_3522 254
288 3300048920 Ga0496117_0031698 Ga0496117_0031698_826_1605 254
289 3300048921 Ga0496118_0000356 Ga0496118_0000356_74640_75452 254
290 3300048921 Ga0496118_0021050 Ga0496118_0021050_3753_4532 254
291 3300048924 Ga0496121_0000521 Ga0496121_0000521_43163_43951 254
292 3300048924 Ga0496121_0001833 Ga0496121_0001833_19409_20221 254
293 3300048924 Ga0496121_0238106 Ga0496121_0238106_119_907 254
294 3300048925 Ga0496122_0104461 Ga0496122_0104461_650_1438 254
295 3300048926 Ga0496123_0005994 Ga0496123_0005994_7162_7950 254
296 3300048926 Ga0496123_0049428 Ga0496123_0049428_818_1606 254
297 3300049460 Ga0495682_0000350 Ga0495682_0000350_11434_12222 254
298 3300049593 Ga0501077_0035645 Ga0501077_0035645_1092_1874 254
299 3300053160 Ga0500633_0160459 Ga0500633_0160459_20_808 254
300 3300053730 Ga0500645_000476 Ga0500645_000476_20684_21472 254
301 3300001904 JGI24736J21556_1009949 JGI24736J21556_10099492 255
302 3300005289 Ga0065704_10071092 Ga0065704_1007109212 255
303 3300005539 Ga0068853_100028897 Ga0068853_1000288973 255
304 3300009093 Ga0105240_10503290 Ga0105240_105032902 255
305 3300013104 Ga0157370_10260161 Ga0157370_102601612 255
306 3300025242 Ga0209258_102200 Ga0209258_1022006 255
307 3300025246 Ga0209646_1005642 Ga0209646_10056422 255
308 3300025904 Ga0207647_10023959 Ga0207647_100239595 255
309 3300028573 Ga0265334_10051656 Ga0265334_100516562 255
310 3300041413 Ga0439465_0029400 Ga0439465_0029400_723_1508 255
311 3300041512 Ga0451853_0218152 Ga0451853_0218152_1184_1981 255
312 3300042007 Ga0439449_0026838 Ga0439449_0026838_60_845 255
313 3300048906 Ga0496103_0078714 Ga0496103_0078714_210_1037 255
314 3300048925 Ga0496122_0008155 Ga0496122_0008155_7146_7934 255
315 3300048926 Ga0496123_0003813 Ga0496123_0003813_12234_13022 255
316 3300048929 Ga0496126_0017413 Ga0496126_0017413_5306_6094 255
317 3300049571 Ga0501034_0000147 Ga0501034_0000147_101982_102779 255
318 3300053139 Ga0500568_0027418 Ga0500568_0027418_1390_2202 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

29

255

0.96

PF02544

Steroid_dh

3-oxo-5-alpha-steroid 4-dehydrogenase

109

262

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.6658 30 248
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.6533 30 243
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.6328 112 248
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.5777 30 248
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.5543 30 243
ID Description Score Start End Superfamily
af_A0A1D8PPI7_47_265_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8655 169 245 1.20.120.1630
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8616 53 248 1.20.120.1630
af_O60725_93_277_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8597 170 248 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.857 54 249 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8513 57 248 1.20.120.1630
ID Description Score Start End GO Terms
AF-F0BF25-F1-model_v4 Putative membrane protein 0.9859 1 112 GO:0016020
AF-A0A2W6I6W3-F1-model_v4 Uncharacterized protein 0.9813 4 255 GO:0016020
AF-A0A2P1PS68-F1-model_v4 Uncharacterized protein 0.9813 2 255 GO:0016020
AF-A0A4Q6FHJ7-F1-model_v4 deleted 0.9769 4 210
AF-A0A2P1PS68-F1-model_v4 Uncharacterized protein 0.9737 2 255 GO:0016020

Feature Viewer

pLDDT pTM Quality
93.43 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map