F404602

General Info

Members Datasets Scaffolds Average Seq Length
318 174 636 150

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_11460560|Ga0157374_114605601
Length 157
Sequence LGRVGGAYMIIDTLQNAPKYFSAHPLFAKAFEYISQTDLANAADGKSDISDGLKAIFSNAPGKTIELSCAKFECHNKNIDIQLCISGFETIGWKPREKCETPNGDYNAEKDVQFFNDTPDTFFQLRDGQFAIFFPEDVHAPMIGEGTIKKLVIKVKI

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 0.94
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 11.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_11460560 3300013296 Bacteria 707
2 ARcpr5oldR_c005089 3300000041 Bacteria 1132
3 ARcpr5yngRDRAFT_c009056 3300000043 Bacteria 855
4 rootH1_10308434 3300003323 Bacteria 1448
5 Ga0065704_10096647 3300005289 Bacteria 2430
6 Ga0065712_10036148 3300005290 Bacteria 716
7 Ga0065712_10070940 3300005290 Bacteria 5573
8 Ga0065712_10226741 3300005290 Bacteria 1003
9 Ga0065715_10603043 3300005293 Bacteria 673
10 Ga0070658_10547098 3300005327 Bacteria 1002
11 Ga0070658_10757824 3300005327 Unclassified 843
12 Ga0070690_100646899 3300005330 Unclassified 807
13 Ga0070670_100032693 3300005331 Bacteria 4481
14 Ga0070670_100037556 3300005331 Bacteria 4167
15 Ga0070670_100110098 3300005331 Bacteria 2373
16 Ga0070670_100197950 3300005331 Unclassified 1745
17 Ga0070670_100226356 3300005331 Bacteria 1627
18 Ga0068869_100709816 3300005334 Bacteria 858
19 Ga0068869_101001070 3300005334 Bacteria 728
20 Ga0068869_101682245 3300005334 Unclassified 566
21 Ga0070682_100000109 3300005337 Bacteria 73659
22 Ga0070682_100676136 3300005337 Unclassified 825
23 Ga0068868_100046440 3300005338 Bacteria 3399
24 Ga0070660_101293348 3300005339 Bacteria 619
25 Ga0070689_100094600 3300005340 Bacteria 2359
26 Ga0070689_100463950 3300005340 Bacteria 1079
27 Ga0070668_100617512 3300005347 Bacteria 950
28 Ga0070669_100506984 3300005353 Bacteria 1001
29 Ga0070669_101394584 3300005353 Bacteria 608
30 Ga0070675_101627150 3300005354 Bacteria 596
31 Ga0070671_101807783 3300005355 Bacteria 543
32 Ga0070674_100100396 3300005356 Bacteria 2107
33 Ga0070673_100117688 3300005364 Bacteria 2212
34 Ga0070673_100123001 3300005364 Bacteria 2168
35 Ga0070673_100604523 3300005364 Bacteria 1000
36 Ga0070673_100638481 3300005364 Unclassified 974
37 Ga0070688_100350455 3300005365 Bacteria 1081
38 Ga0070700_100459936 3300005441 Bacteria 970
39 Ga0070678_100118078 3300005456 Bacteria 2087
40 Ga0070681_10753160 3300005458 Bacteria 891
41 Ga0068867_100068819 3300005459 Bacteria 2642
42 Ga0068867_100092344 3300005459 Bacteria 2299
43 Ga0068867_100647834 3300005459 Unclassified 926
44 Ga0070685_10051290 3300005466 Bacteria 2385
45 Ga0070685_10277049 3300005466 Bacteria 1121
46 Ga0070698_100038167 3300005471 Bacteria 4949
47 Ga0070698_100105919 3300005471 Unclassified 2781
48 Ga0070698_100112057 3300005471 Bacteria 2693
49 Ga0070679_100000473 3300005530 Bacteria 34337
50 Ga0070679_100006332 3300005530 Bacteria 11019
51 Ga0070679_100363837 3300005530 Bacteria 1394
52 Ga0070684_101047593 3300005535 Bacteria 766
53 Ga0068853_100548139 3300005539 Bacteria 1095
54 Ga0068853_101875342 3300005539 Unclassified 581
55 Ga0070672_100279256 3300005543 Bacteria 1412
56 Ga0070686_100556786 3300005544 Bacteria 898
57 Ga0068855_100369736 3300005563 Bacteria 1576
58 Ga0068855_100792090 3300005563 Bacteria 1008
59 Ga0070664_100670656 3300005564 Bacteria 964
60 Ga0068857_100070058 3300005577 Bacteria 3123
61 Ga0068857_100146165 3300005577 Bacteria 2139
62 Ga0068857_100460352 3300005577 Bacteria 1190
63 Ga0068854_100178151 3300005578 Bacteria 1659
64 Ga0068856_100013103 3300005614 Bacteria 8030
65 Ga0068852_100001611 3300005616 Bacteria 15376
66 Ga0068852_100065215 3300005616 Bacteria 3176
67 Ga0068852_100427661 3300005616 Bacteria 1307
68 Ga0068859_100188590 3300005617 Bacteria 2146
69 Ga0068859_100445938 3300005617 Bacteria 1390
70 Ga0068859_101889926 3300005617 Bacteria 659
71 Ga0068859_102624113 3300005617 Unclassified 554
72 Ga0068864_100025865 3300005618 Bacteria 4946
73 Ga0068864_100127891 3300005618 Bacteria 2279
74 Ga0068864_100167464 3300005618 Bacteria 2001
75 Ga0068866_10184388 3300005718 Bacteria 1235
76 Ga0068866_10217389 3300005718 Bacteria 1151
77 Ga0068861_100111745 3300005719 Bacteria 2190
78 Ga0068861_101078019 3300005719 Bacteria 771
79 Ga0068851_10040883 3300005834 Unclassified 2331
80 Ga0068851_10078437 3300005834 Bacteria 1721
81 Ga0068870_10025567 3300005840 Bacteria 2932
82 Ga0068863_100002022 3300005841 Bacteria 20097
83 Ga0068863_100023020 3300005841 Bacteria 5954
84 Ga0068863_100028129 3300005841 Bacteria 5367
85 Ga0068863_100112791 3300005841 Bacteria 2589
86 Ga0068858_100688200 3300005842 Bacteria 995
87 Ga0068862_100435431 3300005844 Bacteria 1233
88 Ga0068862_101424981 3300005844 Bacteria 697
89 Ga0081539_10326303 3300005985 Bacteria 651
90 Ga0075366_10043025 3300006195 Bacteria 2675
91 Ga0075366_10081492 3300006195 Bacteria 1933
92 Ga0097621_101431978 3300006237 Bacteria 655
93 Ga0068871_100792710 3300006358 Bacteria 873
94 Ga0075428_100023631 3300006844 Bacteria 6804
95 Ga0075428_100035764 3300006844 Bacteria 5474
96 Ga0075428_100080181 3300006844 Bacteria 3562
97 Ga0075428_100466618 3300006844 Unclassified 1352
98 Ga0075430_100908067 3300006846 Bacteria 725
99 Ga0075431_100055364 3300006847 Bacteria 4091
100 Ga0075434_100098808 3300006871 Bacteria 2924
101 Ga0075434_101371461 3300006871 Bacteria 717
102 Ga0075429_100019691 3300006880 Bacteria 5850
103 Ga0075429_100381756 3300006880 Bacteria 1234
104 Ga0075429_100866380 3300006880 Bacteria 791
105 Ga0068865_100070037 3300006881 Bacteria 2484
106 Ga0068865_100316820 3300006881 Unclassified 1253
107 Ga0068865_100721386 3300006881 Unclassified 854
108 Ga0097620_100188601 3300006931 Bacteria 2146
109 Ga0097620_100445944 3300006931 Bacteria 1390
110 Ga0097620_101890972 3300006931 Bacteria 659
111 Ga0097620_102624424 3300006931 Unclassified 554
112 Ga0111539_10039542 3300009094 Bacteria 5684
113 Ga0111539_10431096 3300009094 Bacteria 1535
114 Ga0111539_11682304 3300009094 Bacteria 736
115 Ga0105245_10393707 3300009098 Bacteria 1383
116 Ga0114129_10072374 3300009147 Bacteria 4805
117 Ga0114129_10601382 3300009147 Bacteria 1425
118 Ga0114129_12574019 3300009147 Bacteria 607
119 Ga0105241_12522156 3300009174 Unclassified 515
120 Ga0105242_10016279 3300009176 Bacteria 5781
121 Ga0105242_10228471 3300009176 Bacteria 1666
122 Ga0105242_10291440 3300009176 Bacteria 1486
123 Ga0105248_11363260 3300009177 Bacteria 802
124 Ga0105237_10233730 3300009545 Bacteria 1839
125 Ga0105249_10001277 3300009553 Bacteria 22079
126 Ga0105249_10002441 3300009553 Bacteria 16139
127 Ga0105249_10034136 3300009553 Bacteria 4608
128 Ga0105249_10052870 3300009553 Bacteria 3712
129 Ga0105249_10185058 3300009553 Unclassified 2029
130 Ga0105249_10473053 3300009553 Bacteria 1295
131 Ga0105249_11872186 3300009553 Bacteria 673
132 Ga0105246_11698559 3300011119 Bacteria 600
133 Ga0105246_12087396 3300011119 Unclassified 549
134 Ga0157373_10139263 3300013100 Bacteria 1706
135 Ga0157373_10213947 3300013100 Unclassified 1359
136 Ga0157371_10311263 3300013102 Bacteria 1141
137 Ga0157371_10501448 3300013102 Bacteria 896
138 Ga0157370_10006533 3300013104 Bacteria 12836
139 Ga0157370_10119855 3300013104 Bacteria 2456
140 Ga0157370_10664042 3300013104 Bacteria 952
141 Ga0157370_10888521 3300013104 Bacteria 809
142 Ga0157369_10437376 3300013105 Bacteria 1355
143 Ga0157378_10044235 3300013297 Bacteria 3954
144 Ga0157378_11014836 3300013297 Bacteria 864
145 Ga0163162_10002052 3300013306 Bacteria 18913
146 Ga0163162_10868668 3300013306 Bacteria 1016
147 Ga0157372_10046235 3300013307 Bacteria 4832
148 Ga0157372_10340104 3300013307 Bacteria 1748
149 Ga0157375_10384533 3300013308 Bacteria 1570
150 Ga0157375_10423339 3300013308 Bacteria 1498
151 Ga0157375_11008592 3300013308 Bacteria 972
152 Ga0163163_10348378 3300014325 Bacteria 1537
153 Ga0163163_10423532 3300014325 Bacteria 1390
154 Ga0163163_11331489 3300014325 Bacteria 780
155 Ga0163163_11677056 3300014325 Bacteria 696
156 Ga0157380_10333590 3300014326 Bacteria 1411
157 Ga0157380_10345091 3300014326 Bacteria 1391
158 Ga0157380_10861663 3300014326 Bacteria 929
159 Ga0157380_11822196 3300014326 Bacteria 668
160 Ga0157377_10105453 3300014745 Bacteria 1687
161 Ga0157377_10373848 3300014745 Bacteria 963
162 Ga0157379_10631266 3300014968 Bacteria 1002
163 Ga0157376_10177713 3300014969 Bacteria 1943
164 Ga0157376_10427297 3300014969 Bacteria 1287
165 Ga0157376_12470102 3300014969 Bacteria 559
166 Ga0163161_10292889 3300017792 Bacteria 1280
167 Ga0213876_10005187 3300021384 Bacteria 7187
168 Ga0207697_10030284 3300025315 Bacteria 2214
169 Ga0207656_10373662 3300025321 Bacteria 714
170 Ga0207682_10025039 3300025893 Bacteria 2365
171 Ga0207642_10072528 3300025899 Unclassified 1643
172 Ga0207710_10003594 3300025900 Bacteria 6874
173 Ga0207645_10022378 3300025907 Bacteria 4113
174 Ga0207643_10004790 3300025908 Bacteria 7250
175 Ga0207705_10159829 3300025909 Bacteria 1692
176 Ga0207705_10320064 3300025909 Bacteria 1192
177 Ga0207695_10174926 3300025913 Bacteria 2070
178 Ga0207662_10208245 3300025918 Bacteria 1269
179 Ga0207652_10003880 3300025921 Bacteria 12232
180 Ga0207652_10282089 3300025921 Bacteria 1499
181 Ga0207681_10154888 3300025923 Unclassified 1721
182 Ga0207681_10650440 3300025923 Bacteria 874
183 Ga0207650_10026305 3300025925 Bacteria 4149
184 Ga0207650_10056783 3300025925 Bacteria 2910
185 Ga0207650_10080051 3300025925 Bacteria 2476
186 Ga0207650_10132905 3300025925 Bacteria 1949
187 Ga0207659_10057397 3300025926 Bacteria 2791
188 Ga0207659_10544771 3300025926 Unclassified 986
189 Ga0207686_10000405 3300025934 Bacteria 29880
190 Ga0207686_10259705 3300025934 Bacteria 1273
191 Ga0207670_10027670 3300025936 Bacteria 3588
192 Ga0207669_10572227 3300025937 Bacteria 915
193 Ga0207704_10279143 3300025938 Unclassified 1269
194 Ga0207704_10395212 3300025938 Bacteria 1089
195 Ga0207704_11315771 3300025938 Bacteria 618
196 Ga0207665_10589225 3300025939 Bacteria 867
197 Ga0207691_10007641 3300025940 Bacteria 10404
198 Ga0207691_10351391 3300025940 Unclassified 1261
199 Ga0207711_10257678 3300025941 Bacteria 1603
200 Ga0207689_10117237 3300025942 Bacteria 2189
201 Ga0207689_10675645 3300025942 Bacteria 870
202 Ga0207689_11239259 3300025942 Bacteria 627
203 Ga0207667_10424105 3300025949 Bacteria 1353
204 Ga0207667_10736698 3300025949 Bacteria 986
205 Ga0207667_10808448 3300025949 Bacteria 934
206 Ga0207651_10389129 3300025960 Bacteria 1183
207 Ga0207651_10698125 3300025960 Unclassified 894
208 Ga0207651_11744583 3300025960 Bacteria 560
209 Ga0207712_10004491 3300025961 Bacteria 8811
210 Ga0207712_10069126 3300025961 Bacteria 2533
211 Ga0207712_10175173 3300025961 Bacteria 1680
212 Ga0207712_10678263 3300025961 Bacteria 898
213 Ga0207668_10155149 3300025972 Bacteria 1778
214 Ga0207640_10175697 3300025981 Bacteria 1600
215 Ga0207658_11396544 3300025986 Bacteria 641
216 Ga0207677_10105990 3300026023 Bacteria 2081
217 Ga0207703_11516378 3300026035 Bacteria 645
218 Ga0207639_10027874 3300026041 Bacteria 4119
219 Ga0207639_10408581 3300026041 Bacteria 1225
220 Ga0207639_10676874 3300026041 Bacteria 956
221 Ga0207639_11748443 3300026041 Unclassified 582
222 Ga0207708_10157849 3300026075 Bacteria 1790
223 Ga0207708_10649235 3300026075 Bacteria 898
224 Ga0207702_10529318 3300026078 Bacteria 1151
225 Ga0207641_10001054 3300026088 Bacteria 27824
226 Ga0207641_10006686 3300026088 Bacteria 9667
227 Ga0207641_10032412 3300026088 Bacteria 4338
228 Ga0207641_10477861 3300026088 Bacteria 1207
229 Ga0207641_10541424 3300026088 Bacteria 1134
230 Ga0207648_10001073 3300026089 Bacteria 30612
231 Ga0207648_10050442 3300026089 Bacteria 3639
232 Ga0207648_10471388 3300026089 Unclassified 1146
233 Ga0207648_11513786 3300026089 Bacteria 631
234 Ga0207676_10010773 3300026095 Bacteria 6521
235 Ga0207676_10109181 3300026095 Bacteria 2311
236 Ga0207676_10156954 3300026095 Bacteria 1967
237 Ga0207676_10212953 3300026095 Bacteria 1716
238 Ga0207674_10061308 3300026116 Bacteria 3801
239 Ga0207674_10173156 3300026116 Bacteria 2111
240 Ga0207675_100067819 3300026118 Bacteria 3335
241 Ga0207675_100709542 3300026118 Bacteria 1015
242 Ga0207683_11258000 3300026121 Bacteria 685
243 Ga0207698_10046611 3300026142 Bacteria 3275
244 Ga0207698_10122674 3300026142 Bacteria 2202
245 Ga0207698_10155142 3300026142 Bacteria 1993
246 Ga0207698_12026339 3300026142 Bacteria 590
247 Ga0207428_10438877 3300027907 Unclassified 953
248 Ga0268265_10334211 3300028380 Bacteria 1377
249 Ga0268265_10408082 3300028380 Bacteria 1258
250 Ga0268265_11992098 3300028380 Bacteria 588
251 Ga0268264_11896732 3300028381 Bacteria 605
252 Ga0265338_10110483 3300028800 Bacteria 2216
253 Ga0265327_10016774 3300031251 Bacteria 4629
254 Ga0265327_10160711 3300031251 Unclassified 1038
255 Ga0373955_0556203 3300035172 Bacteria 702
256 Ga0373937_0262121 3300036401 Bacteria 1630
257 Ga0395900_0023731 3300037418 Bacteria 6275
258 Ga0436365_1251897 3300039437 Bacteria 24739
259 Ga0451793_0745794 3300041452 Bacteria 836
260 Ga0451793_1721755 3300041452 Bacteria 945
261 Ga0451804_0683920 3300041463 Unclassified 856
262 Ga0451853_2175051 3300041512 Bacteria 1186
263 Ga0439431_0161041 3300041997 Bacteria 641
264 Ga0439434_0063074 3300042435 Bacteria 1161
265 Ga0451577_0017381 3300042876 Bacteria 6645
266 Ga0453683_0280001 3300044673 Bacteria 1065
267 Ga0453684_0005326 3300044712 Bacteria 25632
268 Ga0453684_0462115 3300044712 Bacteria 1411
269 Ga0453684_0577246 3300044712 Bacteria 1235
270 Ga0451576_0016546 3300045051 Bacteria 8134
271 Ga0495638_0232428 3300046460 Bacteria 1025
272 Ga0495638_0405416 3300046460 Bacteria 706
273 Ga0495641_0320228 3300046461 Bacteria 700
274 Ga0495594_0152436 3300046499 Bacteria 1313
275 Ga0495642_0282218 3300046528 Bacteria 727
276 Ga0495670_0147507 3300046691 Unclassified 1233
277 Ga0495672_0004980 3300047320 Bacteria 10658
278 Ga0495672_0024633 3300047320 Bacteria 3872
279 Ga0495672_0258639 3300047320 Bacteria 841
280 Ga0495686_0028043 3300047472 Bacteria 3670
281 Ga0501032_0011617 3300049569 Bacteria 6316
282 Ga0501034_0015187 3300049571 Bacteria 7915
283 Ga0501034_0016302 3300049571 Bacteria 7628
284 Ga0501034_0037172 3300049571 Bacteria 4930
285 Ga0501036_1099679 3300049572 Bacteria 649
286 Ga0501038_0055888 3300049574 Bacteria 3390
287 Ga0501039_0032992 3300049575 Bacteria 3994
288 Ga0501043_0010615 3300049579 Bacteria 7212
289 Ga0501043_0358971 3300049579 Bacteria 1106
290 Ga0501046_0006720 3300049580 Bacteria 10156
291 Ga0501047_0010701 3300049581 Bacteria 8669
292 Ga0501047_1278287 3300049581 Bacteria 548
293 Ga0501070_0041260 3300049586 Bacteria 3845
294 Ga0501073_0002013 3300049589 Bacteria 15173
295 Ga0501074_0002600 3300049590 Bacteria 12616
296 Ga0501080_0018745 3300049742 Bacteria 6404
297 Ga0501080_1391107 3300049742 Unclassified 599
298 Ga0501083_0012750 3300049744 Bacteria 5878
299 Ga0501035_0049062 3300049822 Bacteria 3784
300 Ga0501044_0045316 3300049823 Bacteria 4557
301 Ga0501044_1075641 3300049823 Bacteria 674
302 Ga0501045_1278061 3300049824 Bacteria 534
303 nmdc:mga0k408_160797_c1 3300050493 Bacteria 1338
304 nmdc:mga0k408_209441_c1 3300050493 Bacteria 1164
305 nmdc:mga0k408_2100_c1 3300050493 Bacteria 10668
306 nmdc:mga05p37_1142514_c1 3300050507 Unclassified 811
307 nmdc:mga05p37_1884143_c1 3300050507 Bacteria 572
308 nmdc:mga09592_73266_c1 3300050508 Bacteria 2910
309 nmdc:mga09592_785727_c1 3300050508 Unclassified 806
310 nmdc:mga0qj67_146587_c1 3300050509 Bacteria 1914
311 nmdc:mga06r32_1158209_c1 3300050510 Bacteria 721
312 nmdc:mga08y16_22391_c1 3300050511 Bacteria 6669
313 nmdc:mga08y16_90980_c1 3300050511 Bacteria 3180
314 nmdc:mga0n895_1391550_c1 3300050512 Bacteria 670
315 nmdc:mga0n895_318923_c1 3300050512 Bacteria 1575
316 Ga0500562_049217 3300053108 Unclassified 1126
317 Ga0500616_0009931 3300053153 Bacteria 5729
318 Ga0500611_000008 3300053727 Bacteria 198346
319 Ga0157374_11460560
320 ARcpr5oldR_c005089
321 ARcpr5yngRDRAFT_c009056
322 rootH1_10308434
323 Ga0065704_10096647
324 Ga0065712_10036148
325 Ga0065712_10070940
326 Ga0065712_10226741
327 Ga0065715_10603043
328 Ga0070658_10547098
329 Ga0070658_10757824
330 Ga0070690_100646899
331 Ga0070670_100032693
332 Ga0070670_100037556
333 Ga0070670_100110098
334 Ga0070670_100197950
335 Ga0070670_100226356
336 Ga0068869_100709816
337 Ga0068869_101001070
338 Ga0068869_101682245
339 Ga0070682_100000109
340 Ga0070682_100676136
341 Ga0068868_100046440
342 Ga0070660_101293348
343 Ga0070689_100094600
344 Ga0070689_100463950
345 Ga0070668_100617512
346 Ga0070669_100506984
347 Ga0070669_101394584
348 Ga0070675_101627150
349 Ga0070671_101807783
350 Ga0070674_100100396
351 Ga0070673_100117688
352 Ga0070673_100123001
353 Ga0070673_100604523
354 Ga0070673_100638481
355 Ga0070688_100350455
356 Ga0070700_100459936
357 Ga0070678_100118078
358 Ga0070681_10753160
359 Ga0068867_100068819
360 Ga0068867_100092344
361 Ga0068867_100647834
362 Ga0070685_10051290
363 Ga0070685_10277049
364 Ga0070698_100038167
365 Ga0070698_100105919
366 Ga0070698_100112057
367 Ga0070679_100000473
368 Ga0070679_100006332
369 Ga0070679_100363837
370 Ga0070684_101047593
371 Ga0068853_100548139
372 Ga0068853_101875342
373 Ga0070672_100279256
374 Ga0070686_100556786
375 Ga0068855_100369736
376 Ga0068855_100792090
377 Ga0070664_100670656
378 Ga0068857_100070058
379 Ga0068857_100146165
380 Ga0068857_100460352
381 Ga0068854_100178151
382 Ga0068856_100013103
383 Ga0068852_100001611
384 Ga0068852_100065215
385 Ga0068852_100427661
386 Ga0068859_100188590
387 Ga0068859_100445938
388 Ga0068859_101889926
389 Ga0068859_102624113
390 Ga0068864_100025865
391 Ga0068864_100127891
392 Ga0068864_100167464
393 Ga0068866_10184388
394 Ga0068866_10217389
395 Ga0068861_100111745
396 Ga0068861_101078019
397 Ga0068851_10040883
398 Ga0068851_10078437
399 Ga0068870_10025567
400 Ga0068863_100002022
401 Ga0068863_100023020
402 Ga0068863_100028129
403 Ga0068863_100112791
404 Ga0068858_100688200
405 Ga0068862_100435431
406 Ga0068862_101424981
407 Ga0081539_10326303
408 Ga0075366_10043025
409 Ga0075366_10081492
410 Ga0097621_101431978
411 Ga0068871_100792710
412 Ga0075428_100023631
413 Ga0075428_100035764
414 Ga0075428_100080181
415 Ga0075428_100466618
416 Ga0075430_100908067
417 Ga0075431_100055364
418 Ga0075434_100098808
419 Ga0075434_101371461
420 Ga0075429_100019691
421 Ga0075429_100381756
422 Ga0075429_100866380
423 Ga0068865_100070037
424 Ga0068865_100316820
425 Ga0068865_100721386
426 Ga0097620_100188601
427 Ga0097620_100445944
428 Ga0097620_101890972
429 Ga0097620_102624424
430 Ga0111539_10039542
431 Ga0111539_10431096
432 Ga0111539_11682304
433 Ga0105245_10393707
434 Ga0114129_10072374
435 Ga0114129_10601382
436 Ga0114129_12574019
437 Ga0105241_12522156
438 Ga0105242_10016279
439 Ga0105242_10228471
440 Ga0105242_10291440
441 Ga0105248_11363260
442 Ga0105237_10233730
443 Ga0105249_10001277
444 Ga0105249_10002441
445 Ga0105249_10034136
446 Ga0105249_10052870
447 Ga0105249_10185058
448 Ga0105249_10473053
449 Ga0105249_11872186
450 Ga0105246_11698559
451 Ga0105246_12087396
452 Ga0157373_10139263
453 Ga0157373_10213947
454 Ga0157371_10311263
455 Ga0157371_10501448
456 Ga0157370_10006533
457 Ga0157370_10119855
458 Ga0157370_10664042
459 Ga0157370_10888521
460 Ga0157369_10437376
461 Ga0157378_10044235
462 Ga0157378_11014836
463 Ga0163162_10002052
464 Ga0163162_10868668
465 Ga0157372_10046235
466 Ga0157372_10340104
467 Ga0157375_10384533
468 Ga0157375_10423339
469 Ga0157375_11008592
470 Ga0163163_10348378
471 Ga0163163_10423532
472 Ga0163163_11331489
473 Ga0163163_11677056
474 Ga0157380_10333590
475 Ga0157380_10345091
476 Ga0157380_10861663
477 Ga0157380_11822196
478 Ga0157377_10105453
479 Ga0157377_10373848
480 Ga0157379_10631266
481 Ga0157376_10177713
482 Ga0157376_10427297
483 Ga0157376_12470102
484 Ga0163161_10292889
485 Ga0213876_10005187
486 Ga0207697_10030284
487 Ga0207656_10373662
488 Ga0207682_10025039
489 Ga0207642_10072528
490 Ga0207710_10003594
491 Ga0207645_10022378
492 Ga0207643_10004790
493 Ga0207705_10159829
494 Ga0207705_10320064
495 Ga0207695_10174926
496 Ga0207662_10208245
497 Ga0207652_10003880
498 Ga0207652_10282089
499 Ga0207681_10154888
500 Ga0207681_10650440
501 Ga0207650_10026305
502 Ga0207650_10056783
503 Ga0207650_10080051
504 Ga0207650_10132905
505 Ga0207659_10057397
506 Ga0207659_10544771
507 Ga0207686_10000405
508 Ga0207686_10259705
509 Ga0207670_10027670
510 Ga0207669_10572227
511 Ga0207704_10279143
512 Ga0207704_10395212
513 Ga0207704_11315771
514 Ga0207665_10589225
515 Ga0207691_10007641
516 Ga0207691_10351391
517 Ga0207711_10257678
518 Ga0207689_10117237
519 Ga0207689_10675645
520 Ga0207689_11239259
521 Ga0207667_10424105
522 Ga0207667_10736698
523 Ga0207667_10808448
524 Ga0207651_10389129
525 Ga0207651_10698125
526 Ga0207651_11744583
527 Ga0207712_10004491
528 Ga0207712_10069126
529 Ga0207712_10175173
530 Ga0207712_10678263
531 Ga0207668_10155149
532 Ga0207640_10175697
533 Ga0207658_11396544
534 Ga0207677_10105990
535 Ga0207703_11516378
536 Ga0207639_10027874
537 Ga0207639_10408581
538 Ga0207639_10676874
539 Ga0207639_11748443
540 Ga0207708_10157849
541 Ga0207708_10649235
542 Ga0207702_10529318
543 Ga0207641_10001054
544 Ga0207641_10006686
545 Ga0207641_10032412
546 Ga0207641_10477861
547 Ga0207641_10541424
548 Ga0207648_10001073
549 Ga0207648_10050442
550 Ga0207648_10471388
551 Ga0207648_11513786
552 Ga0207676_10010773
553 Ga0207676_10109181
554 Ga0207676_10156954
555 Ga0207676_10212953
556 Ga0207674_10061308
557 Ga0207674_10173156
558 Ga0207675_100067819
559 Ga0207675_100709542
560 Ga0207683_11258000
561 Ga0207698_10046611
562 Ga0207698_10122674
563 Ga0207698_10155142
564 Ga0207698_12026339
565 Ga0207428_10438877
566 Ga0268265_10334211
567 Ga0268265_10408082
568 Ga0268265_11992098
569 Ga0268264_11896732
570 Ga0265338_10110483
571 Ga0265327_10016774
572 Ga0265327_10160711
573 Ga0373955_0556203
574 Ga0373937_0262121
575 Ga0395900_0023731
576 Ga0436365_1251897
577 Ga0451793_0745794
578 Ga0451793_1721755
579 Ga0451804_0683920
580 Ga0451853_2175051
581 Ga0439431_0161041
582 Ga0439434_0063074
583 Ga0451577_0017381
584 Ga0453683_0280001
585 Ga0453684_0005326
586 Ga0453684_0462115
587 Ga0453684_0577246
588 Ga0451576_0016546
589 Ga0495638_0232428
590 Ga0495638_0405416
591 Ga0495641_0320228
592 Ga0495594_0152436
593 Ga0495642_0282218
594 Ga0495670_0147507
595 Ga0495672_0004980
596 Ga0495672_0024633
597 Ga0495672_0258639
598 Ga0495686_0028043
599 Ga0501032_0011617
600 Ga0501034_0015187
601 Ga0501034_0016302
602 Ga0501034_0037172
603 Ga0501036_1099679
604 Ga0501038_0055888
605 Ga0501039_0032992
606 Ga0501043_0010615
607 Ga0501043_0358971
608 Ga0501046_0006720
609 Ga0501047_0010701
610 Ga0501047_1278287
611 Ga0501070_0041260
612 Ga0501073_0002013
613 Ga0501074_0002600
614 Ga0501080_0018745
615 Ga0501080_1391107
616 Ga0501083_0012750
617 Ga0501035_0049062
618 Ga0501044_0045316
619 Ga0501044_1075641
620 Ga0501045_1278061
621 nmdc:mga0k408_160797_c1
622 nmdc:mga0k408_209441_c1
623 nmdc:mga0k408_2100_c1
624 nmdc:mga05p37_1142514_c1
625 nmdc:mga05p37_1884143_c1
626 nmdc:mga09592_73266_c1
627 nmdc:mga09592_785727_c1
628 nmdc:mga0qj67_146587_c1
629 nmdc:mga06r32_1158209_c1
630 nmdc:mga08y16_22391_c1
631 nmdc:mga08y16_90980_c1
632 nmdc:mga0n895_1391550_c1
633 nmdc:mga0n895_318923_c1
634 Ga0500562_049217
635 Ga0500616_0009931
636 Ga0500611_000008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04074

DUF386

YhcH/YjgK/YiaL

9

156

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9044 45 149
1s4c-assembly1.cif.gz_A yhch protein (hi0227) copper complex 0.8746 1 149
1s4c-assembly2.cif.gz_B yhch protein (hi0227) copper complex 0.8675 1 149
2h0v-assembly1.cif.gz_B crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution 0.8615 45 149
1s4c-assembly2.cif.gz_B yhch protein (hi0227) copper complex 0.857 1 149
ID Description Score Start End Superfamily
af_P45424_1_153_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.8906 1 149 2.60.120.370
af_P37673_1_152_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.889 1 150 2.60.120.370
af_P0AC73_2_142_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.8843 2 150 2.60.120.370
af_P37673_1_152_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.8834 1 150 2.60.120.370
af_P45424_1_153_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.8794 1 149 2.60.120.370
ID Description Score Start End GO Terms
AF-A0A085EMC2-F1-model_v4 deleted 0.9892 1 150
AF-A0A7J5WPL3-F1-model_v4 YhcH/YjgK/YiaL family protein 0.9888 1 150 GO:0005829
AF-A0A4Q5YK08-F1-model_v4 DUF386 domain-containing protein 0.9864 1 116 GO:0005829
AF-A0A419EZD4-F1-model_v4 DUF386 domain-containing protein 0.9838 1 150 GO:0005829
AF-A0A085EMC2-F1-model_v4 deleted 0.9827 1 150

Map