F404593

General Info

Members Datasets Scaffolds Average Seq Length
318 208 636 353

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10172425|Ga0105239_101724253
Length 384
Sequence MTGAPAPEELPAAPGSFDDLPAALRTPLTELTGVRYPIVQTGMGWVSGARLTAATAKAGGLGIIASSTMSIAELRQAIHEVKERTDAPFGVNIRSDAADAGERVDLMIAEGVKVASFALAPKKELIAKLKDAGIVCMPSVGAKRHAEKVASWGADLVMVQGGEGGGHTGAVPTSLLVPQVVDAVDIPVVAAGGFFDGRGLIAALAYGAVGIGMGTRFLLTSDSTVAVQVKQRYLDADVNGTVVTTRVDGMPHRVLRTELVDHLEKATPLTRLPRSLRNAAAFKKESGASWAGLLRDGRSMKHASDLDWSQVLMAANTPMLLKASMVDGRPDLGLMTSGQVAGLIDDLPSADELITRIINDAVAVLSRLGVPSGATQLTGASSPA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
171 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
172 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
179 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
180 2547132424 Nocardia nova SH22a Isolate Unclassified
181 2558860280 Kutzneria sp. 744 Isolate Unclassified
182 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
183 2643221576 Nocardioides sp. Root614 Isolate Unclassified
184 2643221590 Nocardioides sp. Root682 Isolate Unclassified
185 2643221604 Nocardioides sp. Root190 Isolate Unclassified
186 2643221615 Nocardioides sp. Root224 Isolate Unclassified
187 2643221617 Nocardioides sp. Root79 Isolate Unclassified
188 2643221620 Nocardioides sp. Root240 Isolate Unclassified
189 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
190 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
191 2738541305 Nocardioides sp. CF167 Isolate Unclassified
192 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
193 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
194 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
195 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
196 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
197 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
198 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
199 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
200 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
201 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
202 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
203 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
204 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
205 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
206 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
207 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
208 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.25
Metatranscriptomes 0
Isolates 9.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.84
Nodule 0
Rhizoplane 5.66
Rhizosphere 58.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10172425 3300010375 Bacteria 2419
2 JGI25406J46586_10001476 3300003203 Bacteria 11075
3 Ga0070682_100154832 3300005337 Bacteria 1577
4 Ga0070660_100280770 3300005339 Bacteria 1363
5 Ga0070671_100004655 3300005355 Bacteria 10880
6 Ga0070659_100159296 3300005366 Bacteria 1845
7 Ga0070667_100006659 3300005367 Bacteria 9603
8 Ga0070667_100056339 3300005367 Bacteria 3321
9 Ga0070667_100059642 3300005367 Bacteria 3228
10 Ga0070709_10049566 3300005434 Bacteria 2627
11 Ga0070711_100025940 3300005439 Bacteria 3837
12 Ga0070705_100216874 3300005440 Bacteria 1322
13 Ga0070662_100064923 3300005457 Bacteria 2674
14 Ga0070672_100022897 3300005543 Bacteria 4597
15 Ga0070696_100007868 3300005546 Bacteria 7117
16 Ga0070665_100003208 3300005548 Bacteria 17593
17 Ga0070664_100027714 3300005564 Bacteria 4709
18 Ga0068859_100007729 3300005617 Bacteria 10916
19 Ga0068866_10075620 3300005718 Bacteria 1793
20 Ga0068863_100001890 3300005841 Bacteria 20785
21 Ga0068863_100002843 3300005841 Bacteria 17141
22 Ga0068858_100189061 3300005842 Bacteria 1946
23 Ga0068860_100000410 3300005843 Bacteria 55852
24 Ga0068862_100000217 3300005844 Bacteria 64007
25 Ga0081539_10000086 3300005985 Bacteria 217801
26 Ga0081539_10067495 3300005985 Bacteria 1934
27 Ga0075365_10003105 3300006038 Bacteria 8448
28 Ga0075365_10009748 3300006038 Bacteria 5547
29 Ga0075365_10025033 3300006038 Bacteria 3774
30 Ga0075365_10041825 3300006038 Bacteria 2995
31 Ga0075365_10071091 3300006038 Bacteria 2342
32 Ga0075365_10072093 3300006038 Bacteria 2326
33 Ga0075365_10095537 3300006038 Bacteria 2030
34 Ga0075365_10119055 3300006038 Bacteria 1820
35 Ga0075365_10205666 3300006038 Bacteria 1380
36 Ga0075365_10211013 3300006038 Bacteria 1361
37 Ga0075368_10022048 3300006042 Bacteria 2422
38 Ga0075368_10096629 3300006042 Bacteria 1211
39 Ga0075363_100001198 3300006048 Bacteria 9567
40 Ga0075363_100003670 3300006048 Bacteria 6592
41 Ga0075363_100005657 3300006048 Bacteria 5593
42 Ga0075363_100012578 3300006048 Bacteria 4084
43 Ga0075363_100031795 3300006048 Bacteria 2738
44 Ga0075363_100042800 3300006048 Bacteria 2393
45 Ga0075363_100051952 3300006048 Bacteria 2187
46 Ga0075363_100056107 3300006048 Bacteria 2111
47 Ga0075364_10018908 3300006051 Bacteria 4320
48 Ga0075364_10025147 3300006051 Bacteria 3788
49 Ga0075364_10046169 3300006051 Bacteria 2836
50 Ga0075364_10052386 3300006051 Bacteria 2666
51 Ga0075364_10084235 3300006051 Bacteria 2105
52 Ga0070716_100072033 3300006173 Bacteria 2034
53 Ga0070712_100010840 3300006175 Bacteria 5764
54 Ga0075367_10003906 3300006178 Bacteria 7188
55 Ga0075367_10033010 3300006178 Bacteria 2981
56 Ga0075369_10000696 3300006186 Bacteria 10788
57 Ga0075369_10024282 3300006186 Bacteria 2511
58 Ga0075366_10091804 3300006195 Bacteria 1819
59 Ga0097621_100091130 3300006237 Bacteria 2552
60 Ga0075370_10007144 3300006353 Bacteria 5670
61 Ga0075370_10010289 3300006353 Bacteria 4887
62 Ga0075370_10034639 3300006353 Bacteria 2830
63 Ga0075370_10069160 3300006353 Bacteria 2017
64 Ga0075428_100001799 3300006844 Bacteria 22941
65 Ga0075428_100006534 3300006844 Bacteria 12964
66 Ga0075430_100031746 3300006846 Bacteria 4483
67 Ga0075431_100010524 3300006847 Bacteria 9300
68 Ga0097620_100007729 3300006931 Bacteria 10916
69 Ga0105250_10022979 3300009092 Bacteria 2512
70 Ga0111539_10318795 3300009094 Bacteria 1809
71 Ga0105245_10079493 3300009098 Bacteria 2994
72 Ga0114129_10037177 3300009147 Bacteria 6874
73 Ga0105248_10034338 3300009177 Bacteria 5670
74 Ga0105248_10042285 3300009177 Bacteria 5110
75 Ga0105248_10185721 3300009177 Bacteria 2343
76 Ga0105238_10265837 3300009551 Bacteria 1695
77 Ga0105249_10000881 3300009553 Bacteria 26692
78 Ga0105249_10194398 3300009553 Bacteria 1982
79 Ga0099796_10018824 3300010159 Bacteria 2082
80 Ga0157369_10332964 3300013105 Bacteria 1577
81 Ga0163163_10040274 3300014325 Bacteria 4563
82 Ga0209051_1026635 3300025303 Bacteria 2325
83 Ga0207696_1016632 3300025711 Bacteria 2455
84 Ga0207710_10000210 3300025900 Bacteria 53899
85 Ga0207688_10001417 3300025901 Bacteria 12499
86 Ga0207647_10006673 3300025904 Bacteria 8387
87 Ga0207699_10105224 3300025906 Bacteria 1799
88 Ga0207693_10031416 3300025915 Bacteria 4195
89 Ga0207663_10023285 3300025916 Bacteria 3551
90 Ga0207657_10240722 3300025919 Bacteria 1445
91 Ga0207694_10141908 3300025924 Bacteria 1932
92 Ga0207690_10203608 3300025932 Bacteria 1505
93 Ga0207709_10071381 3300025935 Bacteria 2205
94 Ga0207665_10007190 3300025939 Bacteria 7366
95 Ga0207665_10215137 3300025939 Bacteria 1406
96 Ga0207691_10108887 3300025940 Bacteria 2465
97 Ga0207711_10005185 3300025941 Bacteria 11037
98 Ga0207679_10018854 3300025945 Bacteria 4629
99 Ga0207679_10128101 3300025945 Bacteria 2032
100 Ga0207712_10000595 3300025961 Bacteria 28916
101 Ga0207658_10030634 3300025986 Bacteria 3811
102 Ga0207658_10107643 3300025986 Bacteria 2197
103 Ga0207658_10251052 3300025986 Bacteria 1503
104 Ga0207703_10191558 3300026035 Bacteria 1811
105 Ga0207678_10192736 3300026067 Bacteria 1742
106 Ga0207708_10143240 3300026075 Bacteria 1876
107 Ga0207641_10002580 3300026088 Bacteria 16645
108 Ga0207641_10006922 3300026088 Bacteria 9489
109 Ga0207683_10005999 3300026121 Bacteria 10407
110 Ga0209813_10001283 3300027866 Bacteria 5609
111 Ga0268266_10002931 3300028379 Bacteria 17640
112 Ga0268265_10000202 3300028380 Bacteria 69213
113 Ga0268265_10132828 3300028380 Bacteria 2072
114 Ga0268264_10000155 3300028381 Bacteria 156029
115 Ga0268264_10205077 3300028381 Bacteria 1806
116 Ga0316578_10064495 3300031728 Bacteria 2162
117 Ga0316577_10091917 3300031733 Bacteria 1699
118 Ga0307407_10145971 3300031903 Bacteria 1532
119 Ga0307409_100027058 3300031995 Bacteria 4058
120 Ga0307409_100050488 3300031995 Bacteria 3177
121 Ga0307409_100052417 3300031995 Bacteria 3128
122 Ga0307507_10200150 3300033179 Bacteria 1383
123 Ga0373931_0046898 3300035691 Bacteria 2286
124 Ga0316584_0062514 3300036712 Bacteria 2788
125 Ga0395899_0128533 3300037312 Bacteria 1811
126 Ga0395900_0029203 3300037418 Bacteria 5656
127 Ga0395898_0047254 3300037466 Bacteria 4225
128 Ga0436364_0506337 3300037853 Bacteria 16554
129 Ga0436364_0657103 3300037853 Bacteria 3192
130 Ga0395901_0150672 3300038443 Bacteria 2444
131 Ga0436365_0553974 3300039437 Bacteria 1928
132 Ga0439436_0032243 3300041404 Bacteria 1520
133 Ga0439466_0007625 3300041411 Bacteria 4088
134 Ga0439466_0036541 3300041411 Bacteria 1658
135 Ga0439465_0000608 3300041413 Bacteria 10852
136 Ga0439465_0019957 3300041413 Bacteria 2096
137 Ga0439445_0006483 3300042004 Bacteria 2691
138 Ga0439445_0021724 3300042004 Bacteria 1614
139 Ga0466969_0008936 3300044656 Bacteria 5314
140 Ga0466969_0031285 3300044656 Bacteria 2710
141 Ga0466972_0003969 3300044658 Bacteria 7373
142 Ga0466965_0004861 3300044683 Bacteria 5999
143 Ga0466965_0005657 3300044683 Bacteria 5639
144 Ga0466966_0001808 3300044684 Bacteria 13869
145 Ga0466966_0008398 3300044684 Bacteria 6836
146 Ga0466966_0009094 3300044684 Bacteria 6580
147 Ga0466961_0011031 3300044693 Bacteria 5775
148 Ga0466961_0059689 3300044693 Bacteria 2425
149 Ga0466961_0097714 3300044693 Bacteria 1851
150 Ga0466961_0102112 3300044693 Bacteria 1806
151 Ga0466961_0130063 3300044693 Bacteria 1578
152 Ga0466963_0008756 3300044694 Bacteria 6077
153 Ga0466963_0271579 3300044694 Bacteria 1191
154 Ga0466964_0032530 3300044706 Bacteria 2073
155 Ga0466971_0022453 3300044719 Bacteria 2812
156 Ga0466971_0052436 3300044719 Bacteria 1837
157 Ga0466968_0032546 3300044735 Bacteria 2170
158 Ga0466968_0041822 3300044735 Bacteria 1936
159 Ga0466970_0009702 3300044765 Bacteria 4870
160 Ga0466970_0029588 3300044765 Bacteria 2885
161 Ga0466970_0064858 3300044765 Bacteria 1959
162 Ga0466957_0007998 3300044842 Bacteria 5999
163 Ga0466957_0133119 3300044842 Bacteria 1595
164 Ga0466960_0146367 3300044901 Bacteria 1259
165 Ga0466959_0018434 3300045049 Bacteria 5123
166 Ga0466959_0047392 3300045049 Bacteria 3161
167 Ga0466958_0000256 3300045836 Bacteria 20577
168 Ga0466958_0000490 3300045836 Bacteria 16540
169 Ga0466958_0001134 3300045836 Bacteria 12323
170 Ga0466958_0109472 3300045836 Bacteria 1724
171 Ga0466967_0035050 3300045976 Bacteria 4267
172 Ga0466967_0053173 3300045976 Bacteria 3558
173 Ga0466967_0084918 3300045976 Bacteria 2865
174 Ga0495603_0068100 3300046455 Bacteria 2094
175 Ga0495629_0017526 3300046459 Bacteria 5133
176 Ga0495638_0012399 3300046460 Bacteria 5844
177 Ga0495608_0104850 3300046511 Bacteria 1821
178 Ga0495640_0125594 3300046533 Bacteria 1664
179 Ga0495634_0164107 3300046642 Bacteria 1399
180 Ga0495657_0194933 3300046675 Bacteria 1237
181 Ga0495613_0179257 3300046689 Bacteria 1501
182 Ga0495624_0013550 3300046690 Bacteria 5558
183 Ga0495672_0032622 3300047320 Bacteria 3237
184 Ga0495683_0001552 3300047323 Bacteria 14875
185 Ga0495686_0128431 3300047472 Bacteria 1505
186 Ga0495593_0007678 3300047673 Bacteria 6294
187 Ga0496102_0008140 3300048905 Bacteria 8971
188 Ga0496102_0069426 3300048905 Bacteria 3234
189 Ga0496103_0024568 3300048906 Bacteria 3638
190 Ga0496104_0020837 3300048907 Bacteria 6012
191 Ga0496105_0019003 3300048908 Bacteria 5537
192 Ga0496107_0187967 3300048910 Bacteria 1534
193 Ga0496108_0041445 3300048911 Bacteria 3844
194 Ga0496109_0143740 3300048912 Bacteria 2231
195 Ga0496109_0522651 3300048912 Bacteria 1120
196 Ga0496109_0581427 3300048912 Bacteria 1056
197 Ga0496110_0054944 3300048913 Bacteria 3503
198 Ga0496110_0307721 3300048913 Bacteria 1443
199 Ga0496112_0211682 3300048915 Bacteria 1896
200 Ga0496113_0238819 3300048916 Bacteria 1450
201 Ga0496114_0018844 3300048917 Bacteria 5588
202 Ga0496114_0048522 3300048917 Bacteria 3532
203 Ga0496114_0060893 3300048917 Bacteria 3156
204 Ga0496114_0138964 3300048917 Bacteria 2102
205 Ga0496116_0000265 3300048919 Bacteria 91618
206 Ga0496118_0075164 3300048921 Bacteria 2411
207 Ga0496119_0003589 3300048922 Bacteria 15995
208 Ga0496119_0008009 3300048922 Bacteria 9389
209 Ga0496120_0007325 3300048923 Bacteria 8230
210 Ga0496121_0007983 3300048924 Bacteria 12638
211 Ga0496125_0014340 3300048928 Bacteria 7721
212 Ga0496126_0159214 3300048929 Bacteria 1930
213 Ga0501031_0018340 3300049568 Bacteria 4555
214 Ga0501032_0049351 3300049569 Bacteria 2839
215 Ga0501033_0000335 3300049570 Bacteria 44924
216 Ga0501033_0052412 3300049570 Bacteria 3024
217 Ga0501034_0024183 3300049571 Bacteria 6179
218 Ga0501036_0051203 3300049572 Bacteria 3496
219 Ga0501036_0272470 3300049572 Bacteria 1417
220 Ga0501037_0002718 3300049573 Bacteria 12787
221 Ga0501038_0052468 3300049574 Bacteria 3516
222 Ga0501042_0039778 3300049578 Bacteria 3343
223 Ga0501046_0010203 3300049580 Bacteria 8083
224 Ga0501047_0261325 3300049581 Bacteria 1579
225 Ga0501048_0011622 3300049582 Bacteria 6566
226 Ga0501070_0100976 3300049586 Bacteria 2386
227 Ga0501070_0312291 3300049586 Bacteria 1279
228 Ga0501075_0232173 3300049591 Bacteria 1407
229 Ga0501076_0041540 3300049592 Bacteria 3619
230 Ga0501080_0041693 3300049742 Bacteria 4276
231 Ga0501035_0000218 3300049822 Bacteria 68475
232 Ga0501035_0034118 3300049822 Bacteria 4625
233 Ga0501044_0000639 3300049823 Bacteria 42286
234 Ga0501044_0009825 3300049823 Bacteria 10404
235 Ga0501044_0158791 3300049823 Bacteria 2239
236 nmdc:mga03n38_1869_c1 3300050490 Bacteria 6296
237 nmdc:mga03n38_24457_c1 3300050490 Bacteria 2470
238 nmdc:mga03n38_2817_c1 3300050490 Bacteria 5467
239 nmdc:mga03n38_7755_c1 3300050490 Bacteria 3809
240 nmdc:mga00v17_11541_c1 3300050491 Bacteria 4858
241 nmdc:mga00v17_23461_c1 3300050491 Bacteria 3568
242 nmdc:mga00v17_31823_c1 3300050491 Bacteria 3113
243 nmdc:mga00v17_32942_c1 3300050491 Bacteria 3066
244 nmdc:mga00v17_45871_c1 3300050491 Bacteria 2642
245 nmdc:mga00v17_6799_c1 3300050491 Bacteria 6078
246 nmdc:mga00v17_7266_c1 3300050491 Bacteria 5902
247 nmdc:mga0yw44_110747_c1 3300050492 Bacteria 1759
248 nmdc:mga0yw44_127136_c1 3300050492 Bacteria 1647
249 nmdc:mga0yw44_13821_c1 3300050492 Bacteria 4265
250 nmdc:mga0yw44_16332_c1 3300050492 Bacteria 4007
251 nmdc:mga0yw44_16923_c1 3300050492 Bacteria 3952
252 nmdc:mga0yw44_23061_c1 3300050492 Bacteria 3502
253 nmdc:mga0yw44_27137_c1 3300050492 Bacteria 3277
254 nmdc:mga0yw44_306572_c1 3300050492 Bacteria 1065
255 nmdc:mga0yw44_42714_c1 3300050492 Bacteria 2704
256 nmdc:mga0yw44_47426_c1 3300050492 Bacteria 2586
257 nmdc:mga0yw44_52079_c1 3300050492 Bacteria 2481
258 nmdc:mga0k408_66151_c1 3300050493 Bacteria 2105
259 nmdc:mga06z11_146513_c1 3300050494 Bacteria 1339
260 nmdc:mga06z11_17862_c1 3300050494 Bacteria 3229
261 nmdc:mga06z11_22855_c1 3300050494 Bacteria 2928
262 nmdc:mga04h51_428_c1 3300050495 Bacteria 10124
263 nmdc:mga07m45_150041_c1 3300050496 Bacteria 1352
264 nmdc:mga07m45_17884_c1 3300050496 Bacteria 3814
265 nmdc:mga07m45_24970_c2 3300050496 Bacteria 2783
266 nmdc:mga07m45_4884_c1 3300050496 Bacteria 6604
267 nmdc:mga07m45_949_c1 3300050496 Bacteria 12713
268 nmdc:mga05p37_218858_c1 3300050507 Bacteria 2299
269 nmdc:mga06r32_73608_c1 3300050510 Bacteria 3310
270 nmdc:mga0sz30_3579_c1 3300050516 Bacteria 5601
271 Ga0495612_0004424 3300053078 Bacteria 5827
272 Ga0495619_0050733 3300053085 Bacteria 2740
273 Ga0500644_0000067 3300053088 Bacteria 61703
274 Ga0500566_0000284 3300053094 Bacteria 27344
275 Ga0500556_0001941 3300053104 Bacteria 7316
276 Ga0500560_000456 3300053107 Bacteria 5662
277 Ga0500593_000238 3300053117 Bacteria 22609
278 Ga0500573_0006388 3300053140 Bacteria 6375
279 Ga0500573_0040031 3300053140 Bacteria 2707
280 Ga0500573_0040051 3300053140 Bacteria 2706
281 Ga0500616_0005062 3300053153 Bacteria 9107
282 Ga0500645_000020 3300053730 Bacteria 134162
283 Ga0501082_0044586 3300060353 Bacteria 3825
284 Ga0466962_0005822 3300061719 Bacteria 5923
285 Ga0466962_0019949 3300061719 Bacteria 3222
286 Ga0466962_0109345 3300061719 Bacteria 1330
287 Ga0530510_0087207 3300061734 Bacteria 2274
288 2515719627 2515154129 Bacteria 5584369
289 2516083964 2515154202 Bacteria 5471270
290 2548692785 2547132424 Bacteria 8348532
291 2559423996 2558860280 Bacteria 11429938
292 2566995471 2565956761 Bacteria 6601618
293 2643891732 2643221576 Bacteria 5214352
294 2643960780 2643221590 Bacteria 5214697
295 2644035711 2643221604 Bacteria 5014917
296 2644089241 2643221615 Bacteria 5487866
297 2644101576 2643221617 Bacteria 5139111
298 2644115639 2643221620 Bacteria 5134593
299 2644319086 2643221657 Bacteria 5490246
300 2738703552 2738541274 Bacteria 6909446
301 2738868191 2738541305 Bacteria 4910150
302 2739328987 2738543028 Bacteria 6917070
303 2739362934 2738543034 Bacteria 6084756
304 2774395638 2773857762 Bacteria 5971770
305 2809198966 2808606439 Bacteria 5952208
306 2812333080 2811994874 Bacteria 5367947
307 2812348274 2811994878 Bacteria 5992952
308 2855387042 2855386786 Bacteria 4752232
309 2866557234 2866552031 Bacteria 5824618
310 2891974035 2891968417 Bacteria 5821697
311 2902800898 2902799365 Bacteria 5419524
312 2904539730 2904535858 Bacteria 6308016
313 2904770335 2904765812 Bacteria 5369154
314 2919422346 2919420072 Bacteria 5390363
315 2919435401 2919432681 Bacteria 5390474
316 2929218056 2929212328 Bacteria 7708288
317 8047715965 8047710418 Bacteria 11023148
318 8056210779 8056207758 Bacteria 8639239
319 Ga0105239_10172425
320 JGI25406J46586_10001476
321 Ga0070682_100154832
322 Ga0070660_100280770
323 Ga0070671_100004655
324 Ga0070659_100159296
325 Ga0070667_100006659
326 Ga0070667_100056339
327 Ga0070667_100059642
328 Ga0070709_10049566
329 Ga0070711_100025940
330 Ga0070705_100216874
331 Ga0070662_100064923
332 Ga0070672_100022897
333 Ga0070696_100007868
334 Ga0070665_100003208
335 Ga0070664_100027714
336 Ga0068859_100007729
337 Ga0068866_10075620
338 Ga0068863_100001890
339 Ga0068863_100002843
340 Ga0068858_100189061
341 Ga0068860_100000410
342 Ga0068862_100000217
343 Ga0081539_10000086
344 Ga0081539_10067495
345 Ga0075365_10003105
346 Ga0075365_10009748
347 Ga0075365_10025033
348 Ga0075365_10041825
349 Ga0075365_10071091
350 Ga0075365_10072093
351 Ga0075365_10095537
352 Ga0075365_10119055
353 Ga0075365_10205666
354 Ga0075365_10211013
355 Ga0075368_10022048
356 Ga0075368_10096629
357 Ga0075363_100001198
358 Ga0075363_100003670
359 Ga0075363_100005657
360 Ga0075363_100012578
361 Ga0075363_100031795
362 Ga0075363_100042800
363 Ga0075363_100051952
364 Ga0075363_100056107
365 Ga0075364_10018908
366 Ga0075364_10025147
367 Ga0075364_10046169
368 Ga0075364_10052386
369 Ga0075364_10084235
370 Ga0070716_100072033
371 Ga0070712_100010840
372 Ga0075367_10003906
373 Ga0075367_10033010
374 Ga0075369_10000696
375 Ga0075369_10024282
376 Ga0075366_10091804
377 Ga0097621_100091130
378 Ga0075370_10007144
379 Ga0075370_10010289
380 Ga0075370_10034639
381 Ga0075370_10069160
382 Ga0075428_100001799
383 Ga0075428_100006534
384 Ga0075430_100031746
385 Ga0075431_100010524
386 Ga0097620_100007729
387 Ga0105250_10022979
388 Ga0111539_10318795
389 Ga0105245_10079493
390 Ga0114129_10037177
391 Ga0105248_10034338
392 Ga0105248_10042285
393 Ga0105248_10185721
394 Ga0105238_10265837
395 Ga0105249_10000881
396 Ga0105249_10194398
397 Ga0099796_10018824
398 Ga0157369_10332964
399 Ga0163163_10040274
400 Ga0209051_1026635
401 Ga0207696_1016632
402 Ga0207710_10000210
403 Ga0207688_10001417
404 Ga0207647_10006673
405 Ga0207699_10105224
406 Ga0207693_10031416
407 Ga0207663_10023285
408 Ga0207657_10240722
409 Ga0207694_10141908
410 Ga0207690_10203608
411 Ga0207709_10071381
412 Ga0207665_10007190
413 Ga0207665_10215137
414 Ga0207691_10108887
415 Ga0207711_10005185
416 Ga0207679_10018854
417 Ga0207679_10128101
418 Ga0207712_10000595
419 Ga0207658_10030634
420 Ga0207658_10107643
421 Ga0207658_10251052
422 Ga0207703_10191558
423 Ga0207678_10192736
424 Ga0207708_10143240
425 Ga0207641_10002580
426 Ga0207641_10006922
427 Ga0207683_10005999
428 Ga0209813_10001283
429 Ga0268266_10002931
430 Ga0268265_10000202
431 Ga0268265_10132828
432 Ga0268264_10000155
433 Ga0268264_10205077
434 Ga0316578_10064495
435 Ga0316577_10091917
436 Ga0307407_10145971
437 Ga0307409_100027058
438 Ga0307409_100050488
439 Ga0307409_100052417
440 Ga0307507_10200150
441 Ga0373931_0046898
442 Ga0316584_0062514
443 Ga0395899_0128533
444 Ga0395900_0029203
445 Ga0395898_0047254
446 Ga0436364_0506337
447 Ga0436364_0657103
448 Ga0395901_0150672
449 Ga0436365_0553974
450 Ga0439436_0032243
451 Ga0439466_0007625
452 Ga0439466_0036541
453 Ga0439465_0000608
454 Ga0439465_0019957
455 Ga0439445_0006483
456 Ga0439445_0021724
457 Ga0466969_0008936
458 Ga0466969_0031285
459 Ga0466972_0003969
460 Ga0466965_0004861
461 Ga0466965_0005657
462 Ga0466966_0001808
463 Ga0466966_0008398
464 Ga0466966_0009094
465 Ga0466961_0011031
466 Ga0466961_0059689
467 Ga0466961_0097714
468 Ga0466961_0102112
469 Ga0466961_0130063
470 Ga0466963_0008756
471 Ga0466963_0271579
472 Ga0466964_0032530
473 Ga0466971_0022453
474 Ga0466971_0052436
475 Ga0466968_0032546
476 Ga0466968_0041822
477 Ga0466970_0009702
478 Ga0466970_0029588
479 Ga0466970_0064858
480 Ga0466957_0007998
481 Ga0466957_0133119
482 Ga0466960_0146367
483 Ga0466959_0018434
484 Ga0466959_0047392
485 Ga0466958_0000256
486 Ga0466958_0000490
487 Ga0466958_0001134
488 Ga0466958_0109472
489 Ga0466967_0035050
490 Ga0466967_0053173
491 Ga0466967_0084918
492 Ga0495603_0068100
493 Ga0495629_0017526
494 Ga0495638_0012399
495 Ga0495608_0104850
496 Ga0495640_0125594
497 Ga0495634_0164107
498 Ga0495657_0194933
499 Ga0495613_0179257
500 Ga0495624_0013550
501 Ga0495672_0032622
502 Ga0495683_0001552
503 Ga0495686_0128431
504 Ga0495593_0007678
505 Ga0496102_0008140
506 Ga0496102_0069426
507 Ga0496103_0024568
508 Ga0496104_0020837
509 Ga0496105_0019003
510 Ga0496107_0187967
511 Ga0496108_0041445
512 Ga0496109_0143740
513 Ga0496109_0522651
514 Ga0496109_0581427
515 Ga0496110_0054944
516 Ga0496110_0307721
517 Ga0496112_0211682
518 Ga0496113_0238819
519 Ga0496114_0018844
520 Ga0496114_0048522
521 Ga0496114_0060893
522 Ga0496114_0138964
523 Ga0496116_0000265
524 Ga0496118_0075164
525 Ga0496119_0003589
526 Ga0496119_0008009
527 Ga0496120_0007325
528 Ga0496121_0007983
529 Ga0496125_0014340
530 Ga0496126_0159214
531 Ga0501031_0018340
532 Ga0501032_0049351
533 Ga0501033_0000335
534 Ga0501033_0052412
535 Ga0501034_0024183
536 Ga0501036_0051203
537 Ga0501036_0272470
538 Ga0501037_0002718
539 Ga0501038_0052468
540 Ga0501042_0039778
541 Ga0501046_0010203
542 Ga0501047_0261325
543 Ga0501048_0011622
544 Ga0501070_0100976
545 Ga0501070_0312291
546 Ga0501075_0232173
547 Ga0501076_0041540
548 Ga0501080_0041693
549 Ga0501035_0000218
550 Ga0501035_0034118
551 Ga0501044_0000639
552 Ga0501044_0009825
553 Ga0501044_0158791
554 nmdc:mga03n38_1869_c1
555 nmdc:mga03n38_24457_c1
556 nmdc:mga03n38_2817_c1
557 nmdc:mga03n38_7755_c1
558 nmdc:mga00v17_11541_c1
559 nmdc:mga00v17_23461_c1
560 nmdc:mga00v17_31823_c1
561 nmdc:mga00v17_32942_c1
562 nmdc:mga00v17_45871_c1
563 nmdc:mga00v17_6799_c1
564 nmdc:mga00v17_7266_c1
565 nmdc:mga0yw44_110747_c1
566 nmdc:mga0yw44_127136_c1
567 nmdc:mga0yw44_13821_c1
568 nmdc:mga0yw44_16332_c1
569 nmdc:mga0yw44_16923_c1
570 nmdc:mga0yw44_23061_c1
571 nmdc:mga0yw44_27137_c1
572 nmdc:mga0yw44_306572_c1
573 nmdc:mga0yw44_42714_c1
574 nmdc:mga0yw44_47426_c1
575 nmdc:mga0yw44_52079_c1
576 nmdc:mga0k408_66151_c1
577 nmdc:mga06z11_146513_c1
578 nmdc:mga06z11_17862_c1
579 nmdc:mga06z11_22855_c1
580 nmdc:mga04h51_428_c1
581 nmdc:mga07m45_150041_c1
582 nmdc:mga07m45_17884_c1
583 nmdc:mga07m45_24970_c2
584 nmdc:mga07m45_4884_c1
585 nmdc:mga07m45_949_c1
586 nmdc:mga05p37_218858_c1
587 nmdc:mga06r32_73608_c1
588 nmdc:mga0sz30_3579_c1
589 Ga0495612_0004424
590 Ga0495619_0050733
591 Ga0500644_0000067
592 Ga0500566_0000284
593 Ga0500556_0001941
594 Ga0500560_000456
595 Ga0500593_000238
596 Ga0500573_0006388
597 Ga0500573_0040031
598 Ga0500573_0040051
599 Ga0500616_0005062
600 Ga0500645_000020
601 Ga0501082_0044586
602 Ga0466962_0005822
603 Ga0466962_0019949
604 Ga0466962_0109345
605 Ga0530510_0087207
606 2515719627
607 2516083964
608 2548692785
609 2559423996
610 2566995471
611 2643891732
612 2643960780
613 2644035711
614 2644089241
615 2644101576
616 2644115639
617 2644319086
618 2738703552
619 2738868191
620 2739328987
621 2739362934
622 2774395638
623 2809198966
624 2812333080
625 2812348274
626 2855387042
627 2866557234
628 2891974035
629 2902800898
630 2904539730
631 2904770335
632 2919422346
633 2919435401
634 2929218056
635 8047715965
636 8056210779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

25

105

0.96

PF03060

NMO

Nitronate monooxygenase

97

360

0.92

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

12

241

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.9351 1 344
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.9323 1 344
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.9142 1 344
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.9137 1 344
2z6j-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.9127 1 343
ID Description Score Start End Superfamily
af_F1QCQ8_214_377_3.50.7.10 Alpha Beta;3-Layer(bba) Sandwich;GroEL;GroEL 0.9492 81 113 3.50.7.10
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9355 6 343 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9351 1 344 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9137 1 344 3.20.20.70
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9124 6 343 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A5N8VRF9-F1-model_v4 Nitronate monooxygenase 0.9935 1 165 GO:0018580
AF-A0A499VNE2-F1-model_v4 Nitronate monooxygenase domain-containing protein 0.9898 1 99 GO:0018580
AF-A0A7K0VH58-F1-model_v4 Nitronate monooxygenase 0.9855 1 155 GO:0018580
AF-R2RCH9-F1-model_v4 Nitronate monooxygenase domain-containing protein 0.9774 5 195 GO:0018580
AF-A0A1V4R7H3-F1-model_v4 2-nitropropane dioxygenase 0.9774 1 89 GO:0018580
GO:0051213

Map