F404576

General Info

Members Datasets Scaffolds Average Seq Length
318 181 636 121

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_12532799|Ga0111539_125327991
Length 135
Sequence MPYQASHRFARIAPRKARLIMDLIRGRDVDDAIAMLKFSKQRASGMIEKVIRSAVANANEQDTAGGPRNTLFVAKAWVDPGPVIKRFQPKDRGKAYPINKRTSHLVVTVDEREEGETAPISLKKAVGARPGKARK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 2.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.63
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_12532799 3300009094 Bacteria 595
2 Ga0070658_11180342 3300005327 Bacteria 665
3 Ga0070658_11489749 3300005327 Bacteria 587
4 Ga0070676_10025168 3300005328 Bacteria 3362
5 Ga0070676_11048592 3300005328 Unclassified 614
6 Ga0070683_101118667 3300005329 Bacteria 757
7 Ga0070683_102114023 3300005329 Unclassified 541
8 Ga0070690_101119727 3300005330 Bacteria 625
9 Ga0070670_100143674 3300005331 Bacteria 2064
10 Ga0070670_100509316 3300005331 Bacteria 1071
11 Ga0070677_10014617 3300005333 Bacteria 2766
12 Ga0070666_10304803 3300005335 Bacteria 1135
13 Ga0070666_10416032 3300005335 Bacteria 968
14 Ga0068868_100163673 3300005338 Bacteria 1839
15 Ga0068868_100954243 3300005338 Bacteria 782
16 Ga0068868_101277500 3300005338 Bacteria 681
17 Ga0070661_100410017 3300005344 Bacteria 1073
18 Ga0070692_10357743 3300005345 Bacteria 909
19 Ga0070692_11070082 3300005345 Bacteria 568
20 Ga0070668_100919200 3300005347 Bacteria 783
21 Ga0070675_100010673 3300005354 Bacteria 7182
22 Ga0070675_100157529 3300005354 Bacteria 1950
23 Ga0070675_100347673 3300005354 Bacteria 1314
24 Ga0070671_100077947 3300005355 Bacteria 2769
25 Ga0070671_100215287 3300005355 Bacteria 1630
26 Ga0070671_100621995 3300005355 Bacteria 934
27 Ga0070671_100968515 3300005355 Bacteria 745
28 Ga0070671_101878258 3300005355 Bacteria 533
29 Ga0070674_100286053 3300005356 Bacteria 1309
30 Ga0070674_100530460 3300005356 Bacteria 985
31 Ga0070674_100647773 3300005356 Bacteria 898
32 Ga0070674_101186507 3300005356 Bacteria 677
33 Ga0070673_100066769 3300005364 Bacteria 2874
34 Ga0070673_100511617 3300005364 Bacteria 1087
35 Ga0070673_101702008 3300005364 Bacteria 597
36 Ga0070667_100432521 3300005367 Bacteria 1201
37 Ga0070667_100731079 3300005367 Bacteria 917
38 Ga0070714_100023283 3300005435 Bacteria 5086
39 Ga0070714_100028337 3300005435 Bacteria 4646
40 Ga0070714_100331616 3300005435 Unclassified 1425
41 Ga0070713_100239770 3300005436 Bacteria 1651
42 Ga0070713_100848798 3300005436 Unclassified 877
43 Ga0070710_10289802 3300005437 Bacteria 1065
44 Ga0070663_100503842 3300005455 Bacteria 1006
45 Ga0070681_11664966 3300005458 Unclassified 564
46 Ga0068867_100591304 3300005459 Bacteria 967
47 Ga0070706_102027299 3300005467 Bacteria 521
48 Ga0070679_100578392 3300005530 Bacteria 1067
49 Ga0070679_101329274 3300005530 Bacteria 665
50 Ga0070684_100541529 3300005535 Bacteria 1080
51 Ga0070672_100003420 3300005543 Bacteria 10294
52 Ga0070672_101033899 3300005543 Bacteria 729
53 Ga0070686_101262349 3300005544 Bacteria 616
54 Ga0070665_100459684 3300005548 Bacteria 1283
55 Ga0070665_100737963 3300005548 Bacteria 998
56 Ga0070665_100868927 3300005548 Bacteria 915
57 Ga0070665_101391939 3300005548 Bacteria 711
58 Ga0070665_101455010 3300005548 Bacteria 694
59 Ga0070665_101907431 3300005548 Bacteria 600
60 Ga0068855_100253048 3300005563 Bacteria 1964
61 Ga0068855_100710753 3300005563 Bacteria 1075
62 Ga0070664_100332434 3300005564 Bacteria 1379
63 Ga0070664_100386888 3300005564 Bacteria 1277
64 Ga0068857_100509945 3300005577 Bacteria 1130
65 Ga0068854_101347640 3300005578 Bacteria 644
66 Ga0068854_101416582 3300005578 Bacteria 629
67 Ga0068856_100248382 3300005614 Bacteria 1794
68 Ga0068856_100710107 3300005614 Bacteria 1026
69 Ga0068852_100510655 3300005616 Bacteria 1198
70 Ga0068852_101130992 3300005616 Bacteria 804
71 Ga0068852_102248794 3300005616 Bacteria 567
72 Ga0068852_102331539 3300005616 Unclassified 556
73 Ga0068859_100840143 3300005617 Bacteria 1005
74 Ga0068864_100181108 3300005618 Bacteria 1927
75 Ga0068861_100466350 3300005719 Bacteria 1135
76 Ga0068863_100508636 3300005841 Bacteria 1187
77 Ga0068863_101502987 3300005841 Bacteria 682
78 Ga0068858_101835934 3300005842 Unclassified 599
79 Ga0068858_101917141 3300005842 Bacteria 586
80 Ga0068860_100384585 3300005843 Bacteria 1386
81 Ga0068860_101534710 3300005843 Bacteria 688
82 Ga0068860_102337695 3300005843 Bacteria 555
83 Ga0068862_101560264 3300005844 Bacteria 667
84 Ga0070717_10097732 3300006028 Bacteria 2488
85 Ga0070717_11909997 3300006028 Unclassified 536
86 Ga0097621_100677765 3300006237 Bacteria 948
87 Ga0097621_100767436 3300006237 Bacteria 891
88 Ga0068871_101114354 3300006358 Bacteria 738
89 Ga0068871_101953580 3300006358 Bacteria 558
90 Ga0075428_101262180 3300006844 Bacteria 778
91 Ga0075428_102321107 3300006844 Bacteria 552
92 Ga0075430_100021518 3300006846 Bacteria 5481
93 Ga0075431_100196759 3300006847 Bacteria 2063
94 Ga0075431_100473577 3300006847 Bacteria 1246
95 Ga0075429_100288634 3300006880 Bacteria 1436
96 Ga0075429_100825225 3300006880 Bacteria 812
97 Ga0097620_100840153 3300006931 Bacteria 1005
98 Ga0075435_100380769 3300007076 Bacteria 1212
99 Ga0105240_10010542 3300009093 Bacteria 12980
100 Ga0105240_10715151 3300009093 Bacteria 1092
101 Ga0105245_10133636 3300009098 Bacteria 2329
102 Ga0105245_11466524 3300009098 Bacteria 733
103 Ga0105247_11246059 3300009101 Unclassified 594
104 Ga0114129_11642775 3300009147 Bacteria 785
105 Ga0105243_10558877 3300009148 Bacteria 1095
106 Ga0105243_10648237 3300009148 Bacteria 1023
107 Ga0105241_10109507 3300009174 Bacteria 2209
108 Ga0105248_10361287 3300009177 Bacteria 1635
109 Ga0105248_10660523 3300009177 Bacteria 1179
110 Ga0105248_10876677 3300009177 Bacteria 1013
111 Ga0105248_11193581 3300009177 Bacteria 860
112 Ga0105237_11348027 3300009545 Bacteria 720
113 Ga0105238_10067706 3300009551 Bacteria 3571
114 Ga0105238_11729974 3300009551 Bacteria 657
115 Ga0105239_10679276 3300010375 Bacteria 1177
116 Ga0105239_11936396 3300010375 Bacteria 684
117 Ga0105246_11679935 3300011119 Bacteria 603
118 Ga0157371_10349237 3300013102 Bacteria 1077
119 Ga0157371_10373428 3300013102 Bacteria 1040
120 Ga0157371_10902598 3300013102 Bacteria 670
121 Ga0157370_10069217 3300013104 Bacteria 3333
122 Ga0157370_10107391 3300013104 Bacteria 2611
123 Ga0157370_12008588 3300013104 Bacteria 518
124 Ga0157369_10078620 3300013105 Bacteria 3534
125 Ga0157369_10476429 3300013105 Bacteria 1292
126 Ga0157369_10611614 3300013105 Bacteria 1125
127 Ga0157369_10653486 3300013105 Bacteria 1084
128 Ga0157369_11547865 3300013105 Bacteria 674
129 Ga0157374_10453974 3300013296 Bacteria 1283
130 Ga0157374_11101616 3300013296 Bacteria 814
131 Ga0157374_12021330 3300013296 Bacteria 603
132 Ga0157378_10411641 3300013297 Bacteria 1335
133 Ga0157378_11295332 3300013297 Bacteria 770
134 Ga0163162_11090773 3300013306 Bacteria 904
135 Ga0157372_10388559 3300013307 Bacteria 1626
136 Ga0157372_10410785 3300013307 Bacteria 1577
137 Ga0157372_10428786 3300013307 Bacteria 1541
138 Ga0157372_10548471 3300013307 Bacteria 1348
139 Ga0157372_10555745 3300013307 Bacteria 1338
140 Ga0157372_11036066 3300013307 Bacteria 950
141 Ga0157372_13356370 3300013307 Unclassified 510
142 Ga0157372_13419569 3300013307 Unclassified 505
143 Ga0157375_10647535 3300013308 Bacteria 1213
144 Ga0157375_11691153 3300013308 Bacteria 749
145 Ga0157375_12994386 3300013308 Bacteria 564
146 Ga0157375_13314256 3300013308 Bacteria 537
147 Ga0163163_10858985 3300014325 Bacteria 971
148 Ga0163163_12960688 3300014325 Bacteria 530
149 Ga0157380_10602872 3300014326 Bacteria 1087
150 Ga0182008_10254033 3300014497 Bacteria 907
151 Ga0182008_10776119 3300014497 Bacteria 554
152 Ga0157377_10318140 3300014745 Bacteria 1033
153 Ga0157379_10247578 3300014968 Bacteria 1617
154 Ga0197907_10591940 3300020069 Bacteria 572
155 Ga0206349_1416075 3300020075 Unclassified 535
156 Ga0206355_1090848 3300020076 Bacteria 1829
157 Ga0206355_1278587 3300020076 Bacteria 1053
158 Ga0206354_10796742 3300020081 Bacteria 1172
159 Ga0206353_11731660 3300020082 Bacteria 3196
160 Ga0154015_1067623 3300020610 Bacteria 870
161 Ga0224712_10002936 3300022467 Bacteria 4316
162 Ga0207682_10017434 3300025893 Bacteria 2805
163 Ga0207692_10605073 3300025898 Unclassified 705
164 Ga0207680_10226727 3300025903 Bacteria 1283
165 Ga0207645_10204942 3300025907 Bacteria 1298
166 Ga0207643_10158601 3300025908 Bacteria 1360
167 Ga0207705_10111625 3300025909 Bacteria 2020
168 Ga0207654_10088566 3300025911 Bacteria 1881
169 Ga0207695_10000534 3300025913 Bacteria 79293
170 Ga0207663_11054398 3300025916 Bacteria 653
171 Ga0207662_10925269 3300025918 Bacteria 618
172 Ga0207652_10701402 3300025921 Bacteria 903
173 Ga0207681_10177447 3300025923 Bacteria 1620
174 Ga0207681_10274849 3300025923 Bacteria 1324
175 Ga0207694_10294095 3300025924 Bacteria 1336
176 Ga0207650_10726939 3300025925 Bacteria 839
177 Ga0207650_11141568 3300025925 Bacteria 663
178 Ga0207650_11697358 3300025925 Unclassified 535
179 Ga0207659_10031407 3300025926 Bacteria 3635
180 Ga0207659_10093945 3300025926 Bacteria 2246
181 Ga0207659_10196643 3300025926 Bacteria 1607
182 Ga0207687_10113262 3300025927 Bacteria 2017
183 Ga0207700_10067544 3300025928 Bacteria 2737
184 Ga0207664_10086202 3300025929 Bacteria 2565
185 Ga0207664_10546114 3300025929 Bacteria 1039
186 Ga0207644_10017799 3300025931 Bacteria 4805
187 Ga0207644_10340015 3300025931 Bacteria 1217
188 Ga0207644_10634317 3300025931 Bacteria 889
189 Ga0207644_10660859 3300025931 Bacteria 870
190 Ga0207690_10805986 3300025932 Bacteria 776
191 Ga0207706_10470930 3300025933 Bacteria 1086
192 Ga0207706_11108294 3300025933 Bacteria 661
193 Ga0207669_10009013 3300025937 Bacteria 4723
194 Ga0207669_10704649 3300025937 Bacteria 830
195 Ga0207669_11763451 3300025937 Bacteria 529
196 Ga0207691_10009551 3300025940 Bacteria 9308
197 Ga0207691_10909599 3300025940 Bacteria 736
198 Ga0207711_10265398 3300025941 Bacteria 1579
199 Ga0207711_10632682 3300025941 Bacteria 998
200 Ga0207711_10697846 3300025941 Bacteria 947
201 Ga0207661_10675008 3300025944 Bacteria 950
202 Ga0207679_10151522 3300025945 Bacteria 1888
203 Ga0207679_11161210 3300025945 Bacteria 708
204 Ga0207679_12165102 3300025945 Bacteria 505
205 Ga0207651_10003118 3300025960 Bacteria 8064
206 Ga0207651_10344617 3300025960 Bacteria 1253
207 Ga0207651_11037309 3300025960 Bacteria 734
208 Ga0207651_11632695 3300025960 Bacteria 581
209 Ga0207712_11158783 3300025961 Bacteria 689
210 Ga0207668_10873361 3300025972 Bacteria 799
211 Ga0207668_10913309 3300025972 Bacteria 782
212 Ga0207668_10971878 3300025972 Bacteria 758
213 Ga0207658_10944134 3300025986 Bacteria 786
214 Ga0207658_11438215 3300025986 Unclassified 631
215 Ga0207677_10172653 3300026023 Bacteria 1692
216 Ga0207677_10448542 3300026023 Bacteria 1105
217 Ga0207677_11145144 3300026023 Unclassified 710
218 Ga0207703_10626762 3300026035 Bacteria 1019
219 Ga0207639_10515203 3300026041 Bacteria 1095
220 Ga0207678_10493607 3300026067 Bacteria 1067
221 Ga0207702_10774083 3300026078 Unclassified 948
222 Ga0207702_11450111 3300026078 Bacteria 680
223 Ga0207641_10543223 3300026088 Bacteria 1133
224 Ga0207641_10907573 3300026088 Unclassified 875
225 Ga0207648_10510639 3300026089 Bacteria 1100
226 Ga0207648_10703656 3300026089 Bacteria 936
227 Ga0207648_11659143 3300026089 Bacteria 600
228 Ga0207676_10157504 3300026095 Bacteria 1964
229 Ga0207676_11109346 3300026095 Bacteria 782
230 Ga0207674_10233953 3300026116 Bacteria 1785
231 Ga0207675_101635140 3300026118 Bacteria 664
232 Ga0207683_11684845 3300026121 Bacteria 583
233 Ga0268264_10562430 3300028381 Bacteria 1120
234 Ga0268264_11947453 3300028381 Bacteria 597
235 Ga0265777_100033 3300030877 Bacteria 4295
236 Ga0307405_10230212 3300031731 Bacteria 1366
237 Ga0307405_10433491 3300031731 Bacteria 1038
238 Ga0307413_10520937 3300031824 Bacteria 959
239 Ga0307413_10652593 3300031824 Bacteria 868
240 Ga0307413_10762935 3300031824 Bacteria 810
241 Ga0307410_10467544 3300031852 Bacteria 1032
242 Ga0307406_10466039 3300031901 Bacteria 1017
243 Ga0307407_10799015 3300031903 Bacteria 718
244 Ga0307412_10539679 3300031911 Bacteria 978
245 Ga0307412_11154581 3300031911 Bacteria 692
246 Ga0307409_100090703 3300031995 Bacteria 2503
247 Ga0307409_100868062 3300031995 Bacteria 914
248 Ga0307409_101137036 3300031995 Bacteria 803
249 Ga0307411_10489940 3300032005 Bacteria 1037
250 Ga0307411_10591152 3300032005 Bacteria 953
251 Ga0307411_11677077 3300032005 Bacteria 588
252 Ga0307411_11819553 3300032005 Bacteria 566
253 Ga0307415_100583817 3300032126 Bacteria 992
254 Ga0373952_0217706 3300035092 Bacteria 566
255 Ga0373943_0893039 3300035170 Bacteria 531
256 Ga0373942_0315597 3300035207 Unclassified 545
257 Ga0373933_0053645 3300035724 Bacteria 2415
258 Ga0373937_0473451 3300036401 Bacteria 1190
259 Ga0373937_0595833 3300036401 Bacteria 1049
260 Ga0373937_0676350 3300036401 Bacteria 978
261 Ga0395900_0573424 3300037418 Bacteria 1071
262 Ga0395905_0218138 3300037471 Bacteria 1786
263 Ga0395905_0373187 3300037471 Bacteria 1320
264 Ga0395905_0406779 3300037471 Bacteria 1256
265 Ga0395901_0463406 3300038443 Bacteria 1295
266 Ga0395901_0731739 3300038443 Bacteria 984
267 Ga0436365_0023550 3300039437 Bacteria 628
268 Ga0451787_016429 3300041441 Unclassified 518
269 Ga0451853_1682487 3300041512 Bacteria 621
270 Ga0450923_168831 3300042125 Bacteria 536
271 Ga0451577_1484007 3300042876 Bacteria 600
272 Ga0451576_0169982 3300045051 Bacteria 2275
273 Ga0495651_0586450 3300046462 Unclassified 705
274 Ga0495580_0180859 3300046472 Bacteria 1456
275 Ga0495580_0883615 3300046472 Unclassified 575
276 Ga0495582_0122049 3300046473 Bacteria 1469
277 Ga0495662_0494125 3300046476 Unclassified 600
278 Ga0495628_0385881 3300046516 Bacteria 1025
279 Ga0495630_0359942 3300046517 Bacteria 1114
280 Ga0495630_1080476 3300046517 Bacteria 609
281 Ga0495652_0181755 3300046529 Bacteria 1613
282 Ga0495652_0754729 3300046529 Bacteria 651
283 Ga0495640_0242842 3300046533 Bacteria 1130
284 Ga0495640_0583787 3300046533 Bacteria 676
285 Ga0495586_0428419 3300046535 Bacteria 762
286 Ga0495587_0270223 3300046536 Bacteria 954
287 Ga0495645_0941252 3300046543 Unclassified 511
288 Ga0495659_0171167 3300046664 Bacteria 881
289 Ga0495599_0799360 3300046678 Unclassified 539
290 Ga0495613_0238229 3300046689 Bacteria 1273
291 Ga0495600_0364943 3300046809 Bacteria 903
292 Ga0495604_0259435 3300047317 Bacteria 1182
293 Ga0495636_0544429 3300047318 Unclassified 564
294 Ga0495674_0684653 3300047319 Bacteria 806
295 Ga0495674_1338686 3300047319 Unclassified 536
296 Ga0495680_0076944 3300047322 Bacteria 2529
297 Ga0495675_0127322 3300047444 Bacteria 1584
298 Ga0495684_0162035 3300047471 Bacteria 1668
299 Ga0495684_0497865 3300047471 Bacteria 838
300 Ga0496113_0587993 3300048916 Bacteria 892
301 Ga0501034_0067165 3300049571 Bacteria 3599
302 Ga0501034_0775754 3300049571 Bacteria 853
303 Ga0501034_1318315 3300049571 Bacteria 598
304 Ga0501047_0452748 3300049581 Bacteria 1113
305 Ga0501047_0888763 3300049581 Bacteria 704
306 Ga0501080_0224017 3300049742 Bacteria 1720
307 Ga0501083_0295090 3300049744 Bacteria 1054
308 Ga0501044_0002343 3300049823 Bacteria 21608
309 Ga0501044_0723515 3300049823 Bacteria 879
310 nmdc:mga05p37_950845_c1 3300050507 Bacteria 919
311 nmdc:mga09592_1204000_c1 3300050508 Bacteria 626
312 nmdc:mga09592_295217_c1 3300050508 Bacteria 1405
313 nmdc:mga06r32_1586279_c1 3300050510 Bacteria 593
314 nmdc:mga06r32_863654_c1 3300050510 Bacteria 863
315 nmdc:mga06r32_91093_c1 3300050510 Bacteria 2979
316 nmdc:mga08y16_482395_c1 3300050511 Bacteria 1261
317 nmdc:mga0rr50_440829_c1 3300050513 Bacteria 1103
318 Ga0590071_177433 3300059421 Bacteria 558
319 Ga0111539_12532799
320 Ga0070658_11180342
321 Ga0070658_11489749
322 Ga0070676_10025168
323 Ga0070676_11048592
324 Ga0070683_101118667
325 Ga0070683_102114023
326 Ga0070690_101119727
327 Ga0070670_100143674
328 Ga0070670_100509316
329 Ga0070677_10014617
330 Ga0070666_10304803
331 Ga0070666_10416032
332 Ga0068868_100163673
333 Ga0068868_100954243
334 Ga0068868_101277500
335 Ga0070661_100410017
336 Ga0070692_10357743
337 Ga0070692_11070082
338 Ga0070668_100919200
339 Ga0070675_100010673
340 Ga0070675_100157529
341 Ga0070675_100347673
342 Ga0070671_100077947
343 Ga0070671_100215287
344 Ga0070671_100621995
345 Ga0070671_100968515
346 Ga0070671_101878258
347 Ga0070674_100286053
348 Ga0070674_100530460
349 Ga0070674_100647773
350 Ga0070674_101186507
351 Ga0070673_100066769
352 Ga0070673_100511617
353 Ga0070673_101702008
354 Ga0070667_100432521
355 Ga0070667_100731079
356 Ga0070714_100023283
357 Ga0070714_100028337
358 Ga0070714_100331616
359 Ga0070713_100239770
360 Ga0070713_100848798
361 Ga0070710_10289802
362 Ga0070663_100503842
363 Ga0070681_11664966
364 Ga0068867_100591304
365 Ga0070706_102027299
366 Ga0070679_100578392
367 Ga0070679_101329274
368 Ga0070684_100541529
369 Ga0070672_100003420
370 Ga0070672_101033899
371 Ga0070686_101262349
372 Ga0070665_100459684
373 Ga0070665_100737963
374 Ga0070665_100868927
375 Ga0070665_101391939
376 Ga0070665_101455010
377 Ga0070665_101907431
378 Ga0068855_100253048
379 Ga0068855_100710753
380 Ga0070664_100332434
381 Ga0070664_100386888
382 Ga0068857_100509945
383 Ga0068854_101347640
384 Ga0068854_101416582
385 Ga0068856_100248382
386 Ga0068856_100710107
387 Ga0068852_100510655
388 Ga0068852_101130992
389 Ga0068852_102248794
390 Ga0068852_102331539
391 Ga0068859_100840143
392 Ga0068864_100181108
393 Ga0068861_100466350
394 Ga0068863_100508636
395 Ga0068863_101502987
396 Ga0068858_101835934
397 Ga0068858_101917141
398 Ga0068860_100384585
399 Ga0068860_101534710
400 Ga0068860_102337695
401 Ga0068862_101560264
402 Ga0070717_10097732
403 Ga0070717_11909997
404 Ga0097621_100677765
405 Ga0097621_100767436
406 Ga0068871_101114354
407 Ga0068871_101953580
408 Ga0075428_101262180
409 Ga0075428_102321107
410 Ga0075430_100021518
411 Ga0075431_100196759
412 Ga0075431_100473577
413 Ga0075429_100288634
414 Ga0075429_100825225
415 Ga0097620_100840153
416 Ga0075435_100380769
417 Ga0105240_10010542
418 Ga0105240_10715151
419 Ga0105245_10133636
420 Ga0105245_11466524
421 Ga0105247_11246059
422 Ga0114129_11642775
423 Ga0105243_10558877
424 Ga0105243_10648237
425 Ga0105241_10109507
426 Ga0105248_10361287
427 Ga0105248_10660523
428 Ga0105248_10876677
429 Ga0105248_11193581
430 Ga0105237_11348027
431 Ga0105238_10067706
432 Ga0105238_11729974
433 Ga0105239_10679276
434 Ga0105239_11936396
435 Ga0105246_11679935
436 Ga0157371_10349237
437 Ga0157371_10373428
438 Ga0157371_10902598
439 Ga0157370_10069217
440 Ga0157370_10107391
441 Ga0157370_12008588
442 Ga0157369_10078620
443 Ga0157369_10476429
444 Ga0157369_10611614
445 Ga0157369_10653486
446 Ga0157369_11547865
447 Ga0157374_10453974
448 Ga0157374_11101616
449 Ga0157374_12021330
450 Ga0157378_10411641
451 Ga0157378_11295332
452 Ga0163162_11090773
453 Ga0157372_10388559
454 Ga0157372_10410785
455 Ga0157372_10428786
456 Ga0157372_10548471
457 Ga0157372_10555745
458 Ga0157372_11036066
459 Ga0157372_13356370
460 Ga0157372_13419569
461 Ga0157375_10647535
462 Ga0157375_11691153
463 Ga0157375_12994386
464 Ga0157375_13314256
465 Ga0163163_10858985
466 Ga0163163_12960688
467 Ga0157380_10602872
468 Ga0182008_10254033
469 Ga0182008_10776119
470 Ga0157377_10318140
471 Ga0157379_10247578
472 Ga0197907_10591940
473 Ga0206349_1416075
474 Ga0206355_1090848
475 Ga0206355_1278587
476 Ga0206354_10796742
477 Ga0206353_11731660
478 Ga0154015_1067623
479 Ga0224712_10002936
480 Ga0207682_10017434
481 Ga0207692_10605073
482 Ga0207680_10226727
483 Ga0207645_10204942
484 Ga0207643_10158601
485 Ga0207705_10111625
486 Ga0207654_10088566
487 Ga0207695_10000534
488 Ga0207663_11054398
489 Ga0207662_10925269
490 Ga0207652_10701402
491 Ga0207681_10177447
492 Ga0207681_10274849
493 Ga0207694_10294095
494 Ga0207650_10726939
495 Ga0207650_11141568
496 Ga0207650_11697358
497 Ga0207659_10031407
498 Ga0207659_10093945
499 Ga0207659_10196643
500 Ga0207687_10113262
501 Ga0207700_10067544
502 Ga0207664_10086202
503 Ga0207664_10546114
504 Ga0207644_10017799
505 Ga0207644_10340015
506 Ga0207644_10634317
507 Ga0207644_10660859
508 Ga0207690_10805986
509 Ga0207706_10470930
510 Ga0207706_11108294
511 Ga0207669_10009013
512 Ga0207669_10704649
513 Ga0207669_11763451
514 Ga0207691_10009551
515 Ga0207691_10909599
516 Ga0207711_10265398
517 Ga0207711_10632682
518 Ga0207711_10697846
519 Ga0207661_10675008
520 Ga0207679_10151522
521 Ga0207679_11161210
522 Ga0207679_12165102
523 Ga0207651_10003118
524 Ga0207651_10344617
525 Ga0207651_11037309
526 Ga0207651_11632695
527 Ga0207712_11158783
528 Ga0207668_10873361
529 Ga0207668_10913309
530 Ga0207668_10971878
531 Ga0207658_10944134
532 Ga0207658_11438215
533 Ga0207677_10172653
534 Ga0207677_10448542
535 Ga0207677_11145144
536 Ga0207703_10626762
537 Ga0207639_10515203
538 Ga0207678_10493607
539 Ga0207702_10774083
540 Ga0207702_11450111
541 Ga0207641_10543223
542 Ga0207641_10907573
543 Ga0207648_10510639
544 Ga0207648_10703656
545 Ga0207648_11659143
546 Ga0207676_10157504
547 Ga0207676_11109346
548 Ga0207674_10233953
549 Ga0207675_101635140
550 Ga0207683_11684845
551 Ga0268264_10562430
552 Ga0268264_11947453
553 Ga0265777_100033
554 Ga0307405_10230212
555 Ga0307405_10433491
556 Ga0307413_10520937
557 Ga0307413_10652593
558 Ga0307413_10762935
559 Ga0307410_10467544
560 Ga0307406_10466039
561 Ga0307407_10799015
562 Ga0307412_10539679
563 Ga0307412_11154581
564 Ga0307409_100090703
565 Ga0307409_100868062
566 Ga0307409_101137036
567 Ga0307411_10489940
568 Ga0307411_10591152
569 Ga0307411_11677077
570 Ga0307411_11819553
571 Ga0307415_100583817
572 Ga0373952_0217706
573 Ga0373943_0893039
574 Ga0373942_0315597
575 Ga0373933_0053645
576 Ga0373937_0473451
577 Ga0373937_0595833
578 Ga0373937_0676350
579 Ga0395900_0573424
580 Ga0395905_0218138
581 Ga0395905_0373187
582 Ga0395905_0406779
583 Ga0395901_0463406
584 Ga0395901_0731739
585 Ga0436365_0023550
586 Ga0451787_016429
587 Ga0451853_1682487
588 Ga0450923_168831
589 Ga0451577_1484007
590 Ga0451576_0169982
591 Ga0495651_0586450
592 Ga0495580_0180859
593 Ga0495580_0883615
594 Ga0495582_0122049
595 Ga0495662_0494125
596 Ga0495628_0385881
597 Ga0495630_0359942
598 Ga0495630_1080476
599 Ga0495652_0181755
600 Ga0495652_0754729
601 Ga0495640_0242842
602 Ga0495640_0583787
603 Ga0495586_0428419
604 Ga0495587_0270223
605 Ga0495645_0941252
606 Ga0495659_0171167
607 Ga0495599_0799360
608 Ga0495613_0238229
609 Ga0495600_0364943
610 Ga0495604_0259435
611 Ga0495636_0544429
612 Ga0495674_0684653
613 Ga0495674_1338686
614 Ga0495680_0076944
615 Ga0495675_0127322
616 Ga0495684_0162035
617 Ga0495684_0497865
618 Ga0496113_0587993
619 Ga0501034_0067165
620 Ga0501034_0775754
621 Ga0501034_1318315
622 Ga0501047_0452748
623 Ga0501047_0888763
624 Ga0501080_0224017
625 Ga0501083_0295090
626 Ga0501044_0002343
627 Ga0501044_0723515
628 nmdc:mga05p37_950845_c1
629 nmdc:mga09592_1204000_c1
630 nmdc:mga09592_295217_c1
631 nmdc:mga06r32_1586279_c1
632 nmdc:mga06r32_863654_c1
633 nmdc:mga06r32_91093_c1
634 nmdc:mga08y16_482395_c1
635 nmdc:mga0rr50_440829_c1
636 Ga0590071_177433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

5

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9186 10 118
8c97-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9002 10 118
8c9a-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.8977 11 118
8c93-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.8802 10 118
8c9a-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.88 11 118
ID Description Score Start End Superfamily
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8457 12 120 3.90.470.10
af_I1K1P2_86_208_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8417 10 120 3.90.470.10
5mmiT00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8397 10 118 3.90.470.10
af_Q8IKG3_166_294_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.833 10 115 3.90.470.10
af_A0A0P0YAA5_35_146_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.828 10 119 3.90.470.10
ID Description Score Start End GO Terms
AF-Q6MJ19-F1-model_v4 Large ribosomal subunit protein uL22 (50S ribosomal protein L22) 0.8576 10 118 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1F9Q5B9-F1-model_v4 Large ribosomal subunit protein uL22 0.851 10 118 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1F5P5E9-F1-model_v4 Large ribosomal subunit protein uL22 0.8484 10 120 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A4D6SUV8-F1-model_v4 Large ribosomal subunit protein uL22c 0.8482 10 120 GO:0003735
GO:0006412
GO:0009507
GO:0015934
GO:0019843
AF-A0A0Q5QQR9-F1-model_v4 Large ribosomal subunit protein uL22 0.8479 10 120 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map