F404537

General Info

Members Datasets Scaffolds Average Seq Length
318 198 636 123

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10116343|Ga0075365_101163432
Length 140
Sequence MRGDEWVGRVARDRLPDMSDVPLADRDLAALVPEWLDWKQVSVLLGVTPGKVRTMIREHELAQAVSEPGAGPRVPADFIQDGLVVKGLPGLLTLLHDHRFDDRECIAWLFTDDDLPGRPIDALRENRGSEVKRRAQVLEY

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
170 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2643221641 Nocardioides sp. Root122 Isolate Unclassified
195 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
196 2739367898 Nocardioides sp. CF479 Isolate Unclassified
197 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
198 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0.31
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0.31
Rhizoplane 9.75
Rhizosphere 80.19
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10116343 3300006038 Bacteria 1841
2 Ga0070658_10104379 3300005327 Bacteria 2345
3 Ga0070676_10389689 3300005328 Bacteria 967
4 Ga0070683_100032700 3300005329 Bacteria 4738
5 Ga0070683_100418244 3300005329 Bacteria 1279
6 Ga0068869_100361335 3300005334 Bacteria 1186
7 Ga0070666_10960035 3300005335 Bacteria 633
8 Ga0070682_100006616 3300005337 Bacteria 6501
9 Ga0070660_100046527 3300005339 Bacteria 3326
10 Ga0070673_100688596 3300005364 Bacteria 938
11 Ga0070659_100075365 3300005366 Bacteria 2689
12 Ga0070667_100407284 3300005367 Bacteria 1238
13 Ga0070663_100325501 3300005455 Bacteria 1237
14 Ga0070663_100602528 3300005455 Bacteria 924
15 Ga0070678_100137311 3300005456 Bacteria 1951
16 Ga0070678_101352395 3300005456 Bacteria 664
17 Ga0070678_101632578 3300005456 Bacteria 606
18 Ga0070662_100454555 3300005457 Bacteria 1063
19 Ga0070685_10096053 3300005466 Bacteria 1802
20 Ga0070679_101252913 3300005530 Bacteria 687
21 Ga0070684_100008351 3300005535 Bacteria 8087
22 Ga0070684_100248648 3300005535 Bacteria 1625
23 Ga0070684_101123558 3300005535 Bacteria 739
24 Ga0070686_100044443 3300005544 Bacteria 2792
25 Ga0070693_100693374 3300005547 Bacteria 745
26 Ga0070665_100000702 3300005548 Bacteria 44602
27 Ga0070665_102464847 3300005548 Bacteria 522
28 Ga0068857_100023775 3300005577 Bacteria 5395
29 Ga0068856_100059777 3300005614 Bacteria 3765
30 Ga0068856_100499882 3300005614 Bacteria 1237
31 Ga0068864_100231837 3300005618 Bacteria 1708
32 Ga0068864_101046262 3300005618 Bacteria 811
33 Ga0068866_10277252 3300005718 Bacteria 1037
34 Ga0068866_10453472 3300005718 Bacteria 839
35 Ga0068861_100400257 3300005719 Bacteria 1218
36 Ga0068863_100219126 3300005841 Bacteria 1833
37 Ga0068860_100016647 3300005843 Bacteria 7172
38 Ga0081455_10418911 3300005937 Bacteria 924
39 Ga0081540_1080678 3300005983 Bacteria 1466
40 Ga0081540_1344799 3300005983 Unclassified 510
41 Ga0075365_10015092 3300006038 Bacteria 4664
42 Ga0075365_10149480 3300006038 Bacteria 1625
43 Ga0075365_10186142 3300006038 Bacteria 1452
44 Ga0075365_10213292 3300006038 Bacteria 1354
45 Ga0075363_100436998 3300006048 Bacteria 772
46 Ga0075364_10171957 3300006051 Bacteria 1465
47 Ga0075367_10671238 3300006178 Bacteria 659
48 Ga0097621_100307648 3300006237 Bacteria 1401
49 Ga0097621_100925396 3300006237 Bacteria 813
50 Ga0075428_100656000 3300006844 Bacteria 1119
51 Ga0075434_101050160 3300006871 Bacteria 828
52 Ga0111539_10146901 3300009094 Bacteria 2761
53 Ga0105245_10016605 3300009098 Bacteria 6425
54 Ga0105243_10220541 3300009148 Bacteria 1676
55 Ga0105243_10423847 3300009148 Bacteria 1242
56 Ga0105243_11878294 3300009148 Bacteria 631
57 Ga0105248_10202725 3300009177 Bacteria 2235
58 Ga0105237_10081624 3300009545 Bacteria 3224
59 Ga0105238_10340971 3300009551 Bacteria 1487
60 Ga0105249_10545864 3300009553 Bacteria 1209
61 Ga0105249_10576916 3300009553 Bacteria 1178
62 Ga0105239_10001535 3300010375 Bacteria 30515
63 Ga0105246_11604690 3300011119 Bacteria 615
64 Ga0157369_10306190 3300013105 Bacteria 1652
65 Ga0157369_10320016 3300013105 Bacteria 1613
66 Ga0163162_10041208 3300013306 Bacteria 4620
67 Ga0157372_10006191 3300013307 Bacteria 12719
68 Ga0157375_10110802 3300013308 Bacteria 2843
69 Ga0157375_10329028 3300013308 Bacteria 1693
70 Ga0157375_10496124 3300013308 Bacteria 1385
71 Ga0163163_10381759 3300014325 Bacteria 1466
72 Ga0163163_10678256 3300014325 Bacteria 1094
73 Ga0157380_10652147 3300014326 Bacteria 1050
74 Ga0157380_13339370 3300014326 Bacteria 513
75 Ga0182008_10058315 3300014497 Bacteria 1906
76 Ga0157377_10809363 3300014745 Bacteria 692
77 Ga0157379_10028397 3300014968 Bacteria 4976
78 Ga0157376_11447729 3300014969 Bacteria 719
79 Ga0163161_10779016 3300017792 Bacteria 802
80 Ga0206353_12008521 3300020082 Bacteria 1733
81 Ga0207642_10166397 3300025899 Bacteria 1189
82 Ga0207680_10665520 3300025903 Bacteria 746
83 Ga0207671_10390520 3300025914 Bacteria 1106
84 Ga0207657_10061128 3300025919 Bacteria 3231
85 Ga0207652_10283751 3300025921 Bacteria 1494
86 Ga0207694_10285325 3300025924 Bacteria 1357
87 Ga0207687_10185705 3300025927 Bacteria 1614
88 Ga0207644_11286270 3300025931 Bacteria 615
89 Ga0207690_10324617 3300025932 Bacteria 1211
90 Ga0207690_10781636 3300025932 Bacteria 788
91 Ga0207704_10275817 3300025938 Bacteria 1275
92 Ga0207711_10168107 3300025941 Bacteria 1989
93 Ga0207689_10384642 3300025942 Bacteria 1169
94 Ga0207661_10731105 3300025944 Bacteria 911
95 Ga0207651_10499000 3300025960 Bacteria 1052
96 Ga0207712_10681219 3300025961 Bacteria 896
97 Ga0207640_10399456 3300025981 Bacteria 1119
98 Ga0207658_10567608 3300025986 Bacteria 1017
99 Ga0207703_10316245 3300026035 Bacteria 1428
100 Ga0207639_11050544 3300026041 Bacteria 763
101 Ga0207678_10558399 3300026067 Bacteria 1002
102 Ga0207708_10178845 3300026075 Bacteria 1684
103 Ga0207702_10056642 3300026078 Bacteria 3328
104 Ga0207702_12371879 3300026078 Bacteria 518
105 Ga0207641_10210521 3300026088 Bacteria 1798
106 Ga0207676_10146459 3300026095 Bacteria 2029
107 Ga0207676_11601745 3300026095 Bacteria 649
108 Ga0207674_10066597 3300026116 Bacteria 3627
109 Ga0207683_10021489 3300026121 Bacteria 5526
110 Ga0207683_10112695 3300026121 Bacteria 2436
111 Ga0207683_10599445 3300026121 Bacteria 1020
112 Ga0207683_10738941 3300026121 Bacteria 913
113 Ga0207698_10111639 3300026142 Bacteria 2293
114 Ga0207428_10049275 3300027907 Bacteria 3376
115 Ga0268266_10006059 3300028379 Bacteria 11144
116 Ga0268264_10068426 3300028381 Bacteria 3000
117 Ga0316181_1145085 3300030744 Bacteria 594
118 Ga0307408_100271193 3300031548 Bacteria 1409
119 Ga0307405_10108993 3300031731 Bacteria 1872
120 Ga0307413_10109512 3300031824 Bacteria 1846
121 Ga0307413_10373005 3300031824 Bacteria 1109
122 Ga0307410_10106665 3300031852 Bacteria 2019
123 Ga0307410_10124959 3300031852 Bacteria 1882
124 Ga0307410_10306913 3300031852 Bacteria 1254
125 Ga0307410_10993817 3300031852 Bacteria 723
126 Ga0307410_11626049 3300031852 Bacteria 571
127 Ga0307406_10104749 3300031901 Bacteria 1934
128 Ga0307406_11080744 3300031901 Bacteria 692
129 Ga0307407_10007819 3300031903 Bacteria 4867
130 Ga0307407_11014809 3300031903 Bacteria 642
131 Ga0307407_11613095 3300031903 Bacteria 515
132 Ga0307409_100010232 3300031995 Bacteria 5816
133 Ga0307409_100116733 3300031995 Bacteria 2250
134 Ga0307409_101059067 3300031995 Bacteria 831
135 Ga0307409_102131051 3300031995 Bacteria 590
136 Ga0307409_102156724 3300031995 Bacteria 587
137 Ga0307416_100029938 3300032002 Bacteria 4077
138 Ga0307416_100366144 3300032002 Bacteria 1466
139 Ga0307416_102583741 3300032002 Bacteria 606
140 Ga0307414_10274760 3300032004 Bacteria 1413
141 Ga0307415_100329303 3300032126 Bacteria 1277
142 Ga0307415_100357222 3300032126 Bacteria 1232
143 Ga0307415_101540729 3300032126 Bacteria 637
144 Ga0373947_0730681 3300035725 Bacteria 675
145 Ga0395900_0043143 3300037418 Bacteria 4648
146 Ga0395900_0881952 3300037418 Bacteria 819
147 Ga0395898_0795364 3300037466 Bacteria 886
148 Ga0395898_0911694 3300037466 Bacteria 817
149 Ga0395901_1269419 3300038443 Bacteria 699
150 Ga0436365_0025011 3300039437 Bacteria 1945
151 Ga0439438_181442 3300041405 Bacteria 500
152 Ga0451789_1196811 3300041443 Bacteria 629
153 Ga0451791_1670549 3300041451 Bacteria 1329
154 Ga0451791_1733940 3300041451 Bacteria 997
155 Ga0451793_0950880 3300041452 Bacteria 568
156 Ga0451802_0292558 3300041460 Bacteria 686
157 Ga0451807_2469616 3300041486 Bacteria 533
158 Ga0451833_0554662 3300041491 Bacteria 904
159 Ga0451833_0806232 3300041491 Bacteria 699
160 Ga0451841_0769592 3300041498 Bacteria 880
161 Ga0451851_0054364 3300041507 Bacteria 590
162 Ga0451853_0338334 3300041512 Bacteria 535
163 Ga0451853_1508163 3300041512 Bacteria 877
164 Ga0451853_1846828 3300041512 Bacteria 778
165 Ga0439431_0264105 3300041997 Bacteria 513
166 Ga0450907_023370 3300042146 Bacteria 1043
167 Ga0466965_0032100 3300044683 Bacteria 2565
168 Ga0466965_0399567 3300044683 Bacteria 759
169 Ga0466961_0322252 3300044693 Bacteria 942
170 Ga0466963_0126248 3300044694 Bacteria 1764
171 Ga0466957_0370137 3300044842 Bacteria 975
172 Ga0466960_0020309 3300044901 Bacteria 2940
173 Ga0466960_0036340 3300044901 Bacteria 2306
174 Ga0451576_0910256 3300045051 Bacteria 923
175 Ga0466967_0204781 3300045976 Bacteria 1870
176 Ga0466967_0323979 3300045976 Bacteria 1486
177 Ga0466967_0414835 3300045976 Bacteria 1311
178 Ga0495603_0016433 3300046455 Bacteria 4477
179 Ga0495629_0659513 3300046459 Bacteria 697
180 Ga0495641_0300519 3300046461 Bacteria 723
181 Ga0495653_0513498 3300046463 Bacteria 746
182 Ga0495582_0233204 3300046473 Bacteria 1054
183 Ga0495639_0144160 3300046475 Bacteria 1146
184 Ga0495640_0594087 3300046533 Bacteria 669
185 Ga0495634_0764989 3300046642 Bacteria 552
186 Ga0495635_0102440 3300046663 Bacteria 1957
187 Ga0495676_0438085 3300047321 Bacteria 863
188 Ga0495593_0283318 3300047673 Bacteria 829
189 Ga0496100_0120037 3300048903 Bacteria 1838
190 Ga0496100_0286059 3300048903 Bacteria 1230
191 Ga0496101_0149929 3300048904 Bacteria 1783
192 Ga0496102_0018443 3300048905 Bacteria 6133
193 Ga0496102_0030723 3300048905 Bacteria 4810
194 Ga0496102_0253874 3300048905 Bacteria 1658
195 Ga0496102_0627762 3300048905 Bacteria 998
196 Ga0496102_1059648 3300048905 Bacteria 731
197 Ga0496105_0027707 3300048908 Bacteria 4631
198 Ga0496107_0397610 3300048910 Bacteria 1025
199 Ga0496108_0100745 3300048911 Bacteria 2464
200 Ga0496108_0203278 3300048911 Bacteria 1719
201 Ga0496108_0477733 3300048911 Bacteria 1089
202 Ga0496109_0016439 3300048912 Bacteria 6470
203 Ga0496109_0093826 3300048912 Bacteria 2778
204 Ga0496110_0017676 3300048913 Bacteria 5964
205 Ga0496110_0134500 3300048913 Bacteria 2234
206 Ga0496110_0655494 3300048913 Bacteria 950
207 Ga0496111_0019130 3300048914 Bacteria 4752
208 Ga0496111_0151848 3300048914 Bacteria 1718
209 Ga0496113_0085992 3300048916 Bacteria 2416
210 Ga0496114_0001019 3300048917 Bacteria 21049
211 Ga0496114_0396647 3300048917 Bacteria 1222
212 Ga0496114_0707488 3300048917 Bacteria 883
213 Ga0496115_0017911 3300048918 Bacteria 5427
214 Ga0496124_0863948 3300048927 Bacteria 553
215 Ga0501031_0285489 3300049568 Bacteria 1070
216 Ga0501033_0681317 3300049570 Bacteria 701
217 Ga0501033_1129721 3300049570 Bacteria 520
218 Ga0501034_0068101 3300049571 Bacteria 3571
219 Ga0501034_0228953 3300049571 Bacteria 1808
220 Ga0501034_0959099 3300049571 Bacteria 741
221 Ga0501034_1491128 3300049571 Bacteria 550
222 Ga0501036_0092323 3300049572 Bacteria 2557
223 Ga0501036_1505580 3300049572 Bacteria 544
224 Ga0501037_0292784 3300049573 Bacteria 1132
225 Ga0501037_0629876 3300049573 Bacteria 718
226 Ga0501038_0044586 3300049574 Bacteria 3851
227 Ga0501038_0128455 3300049574 Bacteria 2084
228 Ga0501039_0291730 3300049575 Bacteria 1282
229 Ga0501039_0293905 3300049575 Bacteria 1277
230 Ga0501040_0020109 3300049576 Bacteria 4447
231 Ga0501040_0294653 3300049576 Bacteria 1160
232 Ga0501040_0543736 3300049576 Bacteria 838
233 Ga0501041_0031583 3300049577 Bacteria 3201
234 Ga0501042_0036215 3300049578 Bacteria 3500
235 Ga0501042_0126731 3300049578 Bacteria 1839
236 Ga0501042_0385449 3300049578 Bacteria 1015
237 Ga0501046_0075509 3300049580 Bacteria 2613
238 Ga0501047_0252797 3300049581 Bacteria 1611
239 Ga0501048_0389690 3300049582 Bacteria 995
240 Ga0501067_0000872 3300049583 Bacteria 16206
241 Ga0501067_0050633 3300049583 Bacteria 2301
242 Ga0501068_0033475 3300049584 Bacteria 3060
243 Ga0501068_0087232 3300049584 Bacteria 1921
244 Ga0501069_0019056 3300049585 Bacteria 3708
245 Ga0501069_0019245 3300049585 Bacteria 3690
246 Ga0501069_0202391 3300049585 Bacteria 1151
247 Ga0501069_0688295 3300049585 Bacteria 616
248 Ga0501070_0003335 3300049586 Bacteria 13946
249 Ga0501070_0004263 3300049586 Bacteria 12295
250 Ga0501070_0016827 3300049586 Bacteria 6138
251 Ga0501070_0029970 3300049586 Bacteria 4559
252 Ga0501071_0026627 3300049587 Bacteria 4060
253 Ga0501071_0053833 3300049587 Bacteria 2903
254 Ga0501071_0992529 3300049587 Bacteria 648
255 Ga0501071_1237257 3300049587 Bacteria 577
256 Ga0501072_0198073 3300049588 Bacteria 1601
257 Ga0501072_0282771 3300049588 Bacteria 1319
258 Ga0501073_0001612 3300049589 Bacteria 16717
259 Ga0501073_0017812 3300049589 Bacteria 5140
260 Ga0501073_0193580 3300049589 Bacteria 1407
261 Ga0501074_0004997 3300049590 Bacteria 9516
262 Ga0501074_0153863 3300049590 Bacteria 1643
263 Ga0501074_0667193 3300049590 Bacteria 734
264 Ga0501076_0057194 3300049592 Bacteria 3096
265 Ga0501076_0313365 3300049592 Bacteria 1287
266 Ga0501077_0047297 3300049593 Bacteria 2733
267 Ga0501077_0054897 3300049593 Bacteria 2530
268 Ga0501206_018428 3300049653 Bacteria 983
269 Ga0501217_164024 3300049661 Bacteria 672
270 Ga0501235_059142 3300049669 Bacteria 896
271 Ga0501243_049544 3300049675 Bacteria 755
272 Ga0501079_0009503 3300049741 Bacteria 7372
273 Ga0501079_0109332 3300049741 Bacteria 2147
274 Ga0501079_0125983 3300049741 Bacteria 1993
275 Ga0501079_0852344 3300049741 Bacteria 717
276 Ga0501080_0019186 3300049742 Bacteria 6332
277 Ga0501080_0041745 3300049742 Bacteria 4272
278 Ga0501080_0069229 3300049742 Bacteria 3282
279 Ga0501080_0741361 3300049742 Bacteria 864
280 Ga0501081_0488393 3300049743 Bacteria 917
281 Ga0501083_0020385 3300049744 Bacteria 4612
282 Ga0501083_0208791 3300049744 Bacteria 1273
283 Ga0501035_0204918 3300049822 Bacteria 1690
284 Ga0501035_0418833 3300049822 Bacteria 1112
285 Ga0501044_0166409 3300049823 Bacteria 2179
286 Ga0501044_0243892 3300049823 Bacteria 1740
287 Ga0501044_0294435 3300049823 Bacteria 1554
288 Ga0501045_0011283 3300049824 Bacteria 6271
289 Ga0501212_009502 3300049851 Bacteria 1372
290 nmdc:mga03683_105871_c1 3300050489 Bacteria 1239
291 nmdc:mga00v17_485626_c1 3300050491 Bacteria 801
292 nmdc:mga0yw44_111847_c1 3300050492 Bacteria 1751
293 nmdc:mga0yw44_18527_c1 3300050492 Bacteria 3816
294 nmdc:mga0yw44_224505_c1 3300050492 Bacteria 1246
295 nmdc:mga0yw44_268322_c1 3300050492 Bacteria 1139
296 nmdc:mga0yw44_341164_c1 3300050492 Bacteria 1008
297 nmdc:mga06z11_42568_c1 3300050494 Bacteria 2279
298 nmdc:mga06z11_725397_c1 3300050494 Bacteria 605
299 nmdc:mga04h51_98969_c1 3300050495 Bacteria 1060
300 nmdc:mga08y16_131369_c1 3300050511 Bacteria 2604
301 Ga0495601_0839169 3300053077 Bacteria 582
302 Ga0495619_0361296 3300053085 Bacteria 1004
303 Ga0500644_0047178 3300053088 Bacteria 1460
304 Ga0500573_0029383 3300053140 Bacteria 3168
305 Ga0501084_0081189 3300054114 Bacteria 2719
306 Ga0501084_0085283 3300054114 Bacteria 2651
307 Ga0501084_0124523 3300054114 Bacteria 2168
308 Ga0501084_0484515 3300054114 Bacteria 1045
309 Ga0501082_0030191 3300060353 Bacteria 4671
310 Ga0501082_0097850 3300060353 Bacteria 2537
311 Ga0501082_0130861 3300060353 Bacteria 2177
312 Ga0530510_0023467 3300061734 Bacteria 4396
313 Ga0530510_0179534 3300061734 Bacteria 1570
314 2644228847 2643221641 Bacteria 4490190
315 2731908076 2731639228 Bacteria 4187555
316 2740166971 2739367898 Bacteria 4367674
317 2799186156 2799112218 Bacteria 4315149
318 8054612707 8054609563 Bacteria 5170090
319 Ga0075365_10116343
320 Ga0070658_10104379
321 Ga0070676_10389689
322 Ga0070683_100032700
323 Ga0070683_100418244
324 Ga0068869_100361335
325 Ga0070666_10960035
326 Ga0070682_100006616
327 Ga0070660_100046527
328 Ga0070673_100688596
329 Ga0070659_100075365
330 Ga0070667_100407284
331 Ga0070663_100325501
332 Ga0070663_100602528
333 Ga0070678_100137311
334 Ga0070678_101352395
335 Ga0070678_101632578
336 Ga0070662_100454555
337 Ga0070685_10096053
338 Ga0070679_101252913
339 Ga0070684_100008351
340 Ga0070684_100248648
341 Ga0070684_101123558
342 Ga0070686_100044443
343 Ga0070693_100693374
344 Ga0070665_100000702
345 Ga0070665_102464847
346 Ga0068857_100023775
347 Ga0068856_100059777
348 Ga0068856_100499882
349 Ga0068864_100231837
350 Ga0068864_101046262
351 Ga0068866_10277252
352 Ga0068866_10453472
353 Ga0068861_100400257
354 Ga0068863_100219126
355 Ga0068860_100016647
356 Ga0081455_10418911
357 Ga0081540_1080678
358 Ga0081540_1344799
359 Ga0075365_10015092
360 Ga0075365_10149480
361 Ga0075365_10186142
362 Ga0075365_10213292
363 Ga0075363_100436998
364 Ga0075364_10171957
365 Ga0075367_10671238
366 Ga0097621_100307648
367 Ga0097621_100925396
368 Ga0075428_100656000
369 Ga0075434_101050160
370 Ga0111539_10146901
371 Ga0105245_10016605
372 Ga0105243_10220541
373 Ga0105243_10423847
374 Ga0105243_11878294
375 Ga0105248_10202725
376 Ga0105237_10081624
377 Ga0105238_10340971
378 Ga0105249_10545864
379 Ga0105249_10576916
380 Ga0105239_10001535
381 Ga0105246_11604690
382 Ga0157369_10306190
383 Ga0157369_10320016
384 Ga0163162_10041208
385 Ga0157372_10006191
386 Ga0157375_10110802
387 Ga0157375_10329028
388 Ga0157375_10496124
389 Ga0163163_10381759
390 Ga0163163_10678256
391 Ga0157380_10652147
392 Ga0157380_13339370
393 Ga0182008_10058315
394 Ga0157377_10809363
395 Ga0157379_10028397
396 Ga0157376_11447729
397 Ga0163161_10779016
398 Ga0206353_12008521
399 Ga0207642_10166397
400 Ga0207680_10665520
401 Ga0207671_10390520
402 Ga0207657_10061128
403 Ga0207652_10283751
404 Ga0207694_10285325
405 Ga0207687_10185705
406 Ga0207644_11286270
407 Ga0207690_10324617
408 Ga0207690_10781636
409 Ga0207704_10275817
410 Ga0207711_10168107
411 Ga0207689_10384642
412 Ga0207661_10731105
413 Ga0207651_10499000
414 Ga0207712_10681219
415 Ga0207640_10399456
416 Ga0207658_10567608
417 Ga0207703_10316245
418 Ga0207639_11050544
419 Ga0207678_10558399
420 Ga0207708_10178845
421 Ga0207702_10056642
422 Ga0207702_12371879
423 Ga0207641_10210521
424 Ga0207676_10146459
425 Ga0207676_11601745
426 Ga0207674_10066597
427 Ga0207683_10021489
428 Ga0207683_10112695
429 Ga0207683_10599445
430 Ga0207683_10738941
431 Ga0207698_10111639
432 Ga0207428_10049275
433 Ga0268266_10006059
434 Ga0268264_10068426
435 Ga0316181_1145085
436 Ga0307408_100271193
437 Ga0307405_10108993
438 Ga0307413_10109512
439 Ga0307413_10373005
440 Ga0307410_10106665
441 Ga0307410_10124959
442 Ga0307410_10306913
443 Ga0307410_10993817
444 Ga0307410_11626049
445 Ga0307406_10104749
446 Ga0307406_11080744
447 Ga0307407_10007819
448 Ga0307407_11014809
449 Ga0307407_11613095
450 Ga0307409_100010232
451 Ga0307409_100116733
452 Ga0307409_101059067
453 Ga0307409_102131051
454 Ga0307409_102156724
455 Ga0307416_100029938
456 Ga0307416_100366144
457 Ga0307416_102583741
458 Ga0307414_10274760
459 Ga0307415_100329303
460 Ga0307415_100357222
461 Ga0307415_101540729
462 Ga0373947_0730681
463 Ga0395900_0043143
464 Ga0395900_0881952
465 Ga0395898_0795364
466 Ga0395898_0911694
467 Ga0395901_1269419
468 Ga0436365_0025011
469 Ga0439438_181442
470 Ga0451789_1196811
471 Ga0451791_1670549
472 Ga0451791_1733940
473 Ga0451793_0950880
474 Ga0451802_0292558
475 Ga0451807_2469616
476 Ga0451833_0554662
477 Ga0451833_0806232
478 Ga0451841_0769592
479 Ga0451851_0054364
480 Ga0451853_0338334
481 Ga0451853_1508163
482 Ga0451853_1846828
483 Ga0439431_0264105
484 Ga0450907_023370
485 Ga0466965_0032100
486 Ga0466965_0399567
487 Ga0466961_0322252
488 Ga0466963_0126248
489 Ga0466957_0370137
490 Ga0466960_0020309
491 Ga0466960_0036340
492 Ga0451576_0910256
493 Ga0466967_0204781
494 Ga0466967_0323979
495 Ga0466967_0414835
496 Ga0495603_0016433
497 Ga0495629_0659513
498 Ga0495641_0300519
499 Ga0495653_0513498
500 Ga0495582_0233204
501 Ga0495639_0144160
502 Ga0495640_0594087
503 Ga0495634_0764989
504 Ga0495635_0102440
505 Ga0495676_0438085
506 Ga0495593_0283318
507 Ga0496100_0120037
508 Ga0496100_0286059
509 Ga0496101_0149929
510 Ga0496102_0018443
511 Ga0496102_0030723
512 Ga0496102_0253874
513 Ga0496102_0627762
514 Ga0496102_1059648
515 Ga0496105_0027707
516 Ga0496107_0397610
517 Ga0496108_0100745
518 Ga0496108_0203278
519 Ga0496108_0477733
520 Ga0496109_0016439
521 Ga0496109_0093826
522 Ga0496110_0017676
523 Ga0496110_0134500
524 Ga0496110_0655494
525 Ga0496111_0019130
526 Ga0496111_0151848
527 Ga0496113_0085992
528 Ga0496114_0001019
529 Ga0496114_0396647
530 Ga0496114_0707488
531 Ga0496115_0017911
532 Ga0496124_0863948
533 Ga0501031_0285489
534 Ga0501033_0681317
535 Ga0501033_1129721
536 Ga0501034_0068101
537 Ga0501034_0228953
538 Ga0501034_0959099
539 Ga0501034_1491128
540 Ga0501036_0092323
541 Ga0501036_1505580
542 Ga0501037_0292784
543 Ga0501037_0629876
544 Ga0501038_0044586
545 Ga0501038_0128455
546 Ga0501039_0291730
547 Ga0501039_0293905
548 Ga0501040_0020109
549 Ga0501040_0294653
550 Ga0501040_0543736
551 Ga0501041_0031583
552 Ga0501042_0036215
553 Ga0501042_0126731
554 Ga0501042_0385449
555 Ga0501046_0075509
556 Ga0501047_0252797
557 Ga0501048_0389690
558 Ga0501067_0000872
559 Ga0501067_0050633
560 Ga0501068_0033475
561 Ga0501068_0087232
562 Ga0501069_0019056
563 Ga0501069_0019245
564 Ga0501069_0202391
565 Ga0501069_0688295
566 Ga0501070_0003335
567 Ga0501070_0004263
568 Ga0501070_0016827
569 Ga0501070_0029970
570 Ga0501071_0026627
571 Ga0501071_0053833
572 Ga0501071_0992529
573 Ga0501071_1237257
574 Ga0501072_0198073
575 Ga0501072_0282771
576 Ga0501073_0001612
577 Ga0501073_0017812
578 Ga0501073_0193580
579 Ga0501074_0004997
580 Ga0501074_0153863
581 Ga0501074_0667193
582 Ga0501076_0057194
583 Ga0501076_0313365
584 Ga0501077_0047297
585 Ga0501077_0054897
586 Ga0501206_018428
587 Ga0501217_164024
588 Ga0501235_059142
589 Ga0501243_049544
590 Ga0501079_0009503
591 Ga0501079_0109332
592 Ga0501079_0125983
593 Ga0501079_0852344
594 Ga0501080_0019186
595 Ga0501080_0041745
596 Ga0501080_0069229
597 Ga0501080_0741361
598 Ga0501081_0488393
599 Ga0501083_0020385
600 Ga0501083_0208791
601 Ga0501035_0204918
602 Ga0501035_0418833
603 Ga0501044_0166409
604 Ga0501044_0243892
605 Ga0501044_0294435
606 Ga0501045_0011283
607 Ga0501212_009502
608 nmdc:mga03683_105871_c1
609 nmdc:mga00v17_485626_c1
610 nmdc:mga0yw44_111847_c1
611 nmdc:mga0yw44_18527_c1
612 nmdc:mga0yw44_224505_c1
613 nmdc:mga0yw44_268322_c1
614 nmdc:mga0yw44_341164_c1
615 nmdc:mga06z11_42568_c1
616 nmdc:mga06z11_725397_c1
617 nmdc:mga04h51_98969_c1
618 nmdc:mga08y16_131369_c1
619 Ga0495601_0839169
620 Ga0495619_0361296
621 Ga0500644_0047178
622 Ga0500573_0029383
623 Ga0501084_0081189
624 Ga0501084_0085283
625 Ga0501084_0124523
626 Ga0501084_0484515
627 Ga0501082_0030191
628 Ga0501082_0097850
629 Ga0501082_0130861
630 Ga0530510_0023467
631 Ga0530510_0179534
632 2644228847
633 2731908076
634 2740166971
635 2799186156
636 8054612707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18367

Rv2175c_C

Rv2175c C-terminal domain of unknown function

85

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.8917 16 56
4j2n-assembly1.cif.gz_B crystal structure of mycobacteriophage pukovnik xis 0.8841 14 49
2kfs-assembly1.cif.gz_A nmr structure of rv2175c 0.8738 15 121
6ama-assembly1.cif.gz_B structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8694 15 58
6ama-assembly1.cif.gz_A structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.864 14 58
ID Description Score Start End Superfamily
af_O53807_4_54_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8751 17 58 1.10.10.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8441 17 54 1.10.10.10
5i44H00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7857 17 45 1.10.1660.10
af_I6YDM0_1_267_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7744 15 58 1.10.10.10
af_Q58776_2_71_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7727 19 45 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1G9VEA0-F1-model_v4 Rv2175c C-terminal domain-containing protein 0.9816 1 121
AF-A1SLA2-F1-model_v4 Uncharacterized protein 0.9806 1 121 GO:0003677
AF-A0A4V1Z160-F1-model_v4 Transcriptional regulator 0.9793 15 121 GO:0003677
AF-A0A1A9GN86-F1-model_v4 DNA-binding protein 0.978 2 121 GO:0003677
AF-A0A1V1W1W2-F1-model_v4 Uncharacterized protein 0.9778 4 121 GO:0003677

Map