F404494

General Info

Members Datasets Scaffolds Average Seq Length
318 176 636 321

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100065938|Ga0070694_1000659382
Length 362
Sequence MVRTAISFVCHVYVDYNRSAIKPLAVYRASKPVGWMGERGKMNVFASRFALAALIALVVGTTGLRQFAAVAQETDDPVKINIYKRFVDNRVPNPDAAYQAARDYLQKYQKDKDQYTDYLNKWVAAYERDDRKRQLGGLINEKKFDEAYAVGAKILADEPDYLRAQIDLGYAGYLAASSKNESHNADALMYARKAIQAIEGGKAPGEWAPFKGKDDTLAYLNYAVGFLTLKTSPDQTIDSLIKAAQYESDIRRTPSTYYFLAVAYESGPYKTLSTAYQTNFANKPETPESKAALEKLNVVMDRIIDAYARAIQTAGSDPKTEQSRKDWLAAMSTYYKFRHGGSDAGMTEFIASSMQKPLPPKP

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
154 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
155 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
156 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
161 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
162 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
163 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
164 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
165 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
166 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.14
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 18.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100065938 3300005444 Bacteria 2482
2 JGI24751J29686_10000044 3300002459 Bacteria 77576
3 Ga0065714_10064531 3300005288 Bacteria 40961
4 Ga0065704_10009331 3300005289 Bacteria 3539
5 Ga0065712_10000123 3300005290 Bacteria 89338
6 Ga0065712_10091607 3300005290 Bacteria 2345
7 Ga0065715_10000524 3300005293 Bacteria 17576
8 Ga0065715_10005979 3300005293 Bacteria 4816
9 Ga0065715_10095758 3300005293 Bacteria 4013
10 Ga0065715_10166196 3300005293 Bacteria 1573
11 Ga0065715_10215873 3300005293 Bacteria 1293
12 Ga0065707_10021136 3300005295 Unclassified 1887
13 Ga0070690_100002071 3300005330 Bacteria 10712
14 Ga0070670_100000144 3300005331 Bacteria 66583
15 Ga0070670_100081638 3300005331 Bacteria 2777
16 Ga0070670_100093096 3300005331 Bacteria 2592
17 Ga0070670_100152100 3300005331 Unclassified 2003
18 Ga0070677_10058103 3300005333 Unclassified 1587
19 Ga0068869_100131457 3300005334 Bacteria 1924
20 Ga0068869_100235802 3300005334 Unclassified 1456
21 Ga0068869_100384801 3300005334 Bacteria 1150
22 Ga0070680_100000868 3300005336 Bacteria 21466
23 Ga0070680_100079752 3300005336 Unclassified 2699
24 Ga0070680_100146516 3300005336 Bacteria 1981
25 Ga0070682_100023587 3300005337 Bacteria 3654
26 Ga0068868_100015413 3300005338 Bacteria 5653
27 Ga0070687_100034504 3300005343 Bacteria 2505
28 Ga0070692_10045788 3300005345 Bacteria 2258
29 Ga0070692_10047339 3300005345 Bacteria 2225
30 Ga0070669_100065695 3300005353 Bacteria 2673
31 Ga0070669_100120897 3300005353 Bacteria 1998
32 Ga0070669_100270507 3300005353 Unclassified 1358
33 Ga0070671_100050656 3300005355 Bacteria 3453
34 Ga0070673_100079047 3300005364 Bacteria 2662
35 Ga0070705_100031135 3300005440 Bacteria 2951
36 Ga0070705_100068322 3300005440 Unclassified 2138
37 Ga0070700_100000062 3300005441 Bacteria 79866
38 Ga0070700_100042627 3300005441 Bacteria 2788
39 Ga0070700_100042773 3300005441 Bacteria 2783
40 Ga0070700_100070306 3300005441 Bacteria 2231
41 Ga0070694_100072949 3300005444 Unclassified 2369
42 Ga0070694_100098411 3300005444 Bacteria 2065
43 Ga0070678_100137218 3300005456 Unclassified 1952
44 Ga0070681_10000032 3300005458 Bacteria 99533
45 Ga0070681_10082184 3300005458 Bacteria 3177
46 Ga0068867_100057847 3300005459 Bacteria 2872
47 Ga0068867_100358139 3300005459 Bacteria 1219
48 Ga0070706_100000137 3300005467 Bacteria 91778
49 Ga0070698_100052661 3300005471 Bacteria 4139
50 Ga0070698_100083693 3300005471 Unclassified 3179
51 Ga0070699_100087656 3300005518 Unclassified 2717
52 Ga0070679_100000331 3300005530 Bacteria 40170
53 Ga0070697_100110313 3300005536 Bacteria 2292
54 Ga0070697_100135442 3300005536 Bacteria 2068
55 Ga0068853_100008694 3300005539 Bacteria 8166
56 Ga0070672_100054051 3300005543 Bacteria 3142
57 Ga0070686_100063228 3300005544 Unclassified 2397
58 Ga0070695_100143430 3300005545 Bacteria 1659
59 Ga0070696_100026922 3300005546 Unclassified 3914
60 Ga0070696_100041461 3300005546 Bacteria 3180
61 Ga0070696_100047657 3300005546 Bacteria 2974
62 Ga0070696_100052500 3300005546 Bacteria 2836
63 Ga0070693_100035663 3300005547 Bacteria 2760
64 Ga0070693_100043111 3300005547 Bacteria 2546
65 Ga0070693_100061132 3300005547 Bacteria 2189
66 Ga0070693_100088382 3300005547 Bacteria 1863
67 Ga0070693_100169085 3300005547 Bacteria 1398
68 Ga0070704_100114673 3300005549 Bacteria 2057
69 Ga0070704_100173340 3300005549 Bacteria 1718
70 Ga0068855_100391347 3300005563 Bacteria 1525
71 Ga0070664_100263195 3300005564 Bacteria 1552
72 Ga0068857_100234272 3300005577 Bacteria 1680
73 Ga0068854_100226883 3300005578 Bacteria 1480
74 Ga0068854_100349669 3300005578 Bacteria 1209
75 Ga0068856_100005019 3300005614 Bacteria 13105
76 Ga0070702_100057419 3300005615 Bacteria 2251
77 Ga0070702_100081954 3300005615 Unclassified 1935
78 Ga0068852_100244672 3300005616 Bacteria 1716
79 Ga0068859_100059388 3300005617 Bacteria 3853
80 Ga0068859_100085780 3300005617 Bacteria 3194
81 Ga0068859_100207446 3300005617 Bacteria 2045
82 Ga0068859_100286963 3300005617 Bacteria 1739
83 Ga0068859_100337997 3300005617 Unclassified 1600
84 Ga0068864_100095032 3300005618 Bacteria 2635
85 Ga0068864_100197324 3300005618 Unclassified 1847
86 Ga0068861_100036588 3300005719 Bacteria 3645
87 Ga0068851_10020249 3300005834 Bacteria 3219
88 Ga0068870_10016170 3300005840 Unclassified 3558
89 Ga0068858_100011207 3300005842 Bacteria 8472
90 Ga0068858_100120657 3300005842 Bacteria 2451
91 Ga0068858_100149908 3300005842 Bacteria 2192
92 Ga0068858_100192015 3300005842 Bacteria 1930
93 Ga0068860_100058989 3300005843 Bacteria 3649
94 Ga0068860_100117073 3300005843 Bacteria 2549
95 Ga0068862_100048237 3300005844 Bacteria 3636
96 Ga0068862_100500381 3300005844 Unclassified 1153
97 Ga0081539_10002223 3300005985 Bacteria 28295
98 Ga0070716_100118481 3300006173 Bacteria 1653
99 Ga0070716_100323742 3300006173 Bacteria 1081
100 Ga0097621_100060869 3300006237 Bacteria 3096
101 Ga0097621_100349909 3300006237 Unclassified 1314
102 Ga0068871_100007057 3300006358 Bacteria 8006
103 Ga0075428_100124974 3300006844 Bacteria 2800
104 Ga0075428_100379772 3300006844 Bacteria 1515
105 Ga0075430_100018769 3300006846 Bacteria 5885
106 Ga0075430_100071451 3300006846 Unclassified 2911
107 Ga0075431_100110445 3300006847 Bacteria 2838
108 Ga0075431_100242037 3300006847 Bacteria 1835
109 Ga0075431_100287492 3300006847 Bacteria 1664
110 Ga0075433_10032196 3300006852 Bacteria 4490
111 Ga0075433_10134747 3300006852 Unclassified 2195
112 Ga0075434_100052842 3300006871 Bacteria 4038
113 Ga0075434_100083269 3300006871 Bacteria 3196
114 Ga0075434_100194519 3300006871 Bacteria 2048
115 Ga0075429_100030137 3300006880 Bacteria 4713
116 Ga0075429_100056376 3300006880 Bacteria 3420
117 Ga0097620_100059388 3300006931 Bacteria 3853
118 Ga0097620_100085787 3300006931 Bacteria 3194
119 Ga0097620_100207434 3300006931 Bacteria 2045
120 Ga0097620_100286978 3300006931 Bacteria 1739
121 Ga0097620_100337979 3300006931 Unclassified 1600
122 Ga0075435_100055646 3300007076 Bacteria 3196
123 Ga0075435_100073725 3300007076 Unclassified 2791
124 Ga0105251_10013672 3300009011 Bacteria 4530
125 Ga0105240_10149093 3300009093 Bacteria 2788
126 Ga0111539_10001877 3300009094 Bacteria 27899
127 Ga0111539_10014810 3300009094 Bacteria 9727
128 Ga0111539_10043278 3300009094 Bacteria 5399
129 Ga0111539_10171340 3300009094 Bacteria 2536
130 Ga0105247_10013467 3300009101 Unclassified 4905
131 Ga0105247_10021387 3300009101 Bacteria 3893
132 Ga0105247_10058107 3300009101 Bacteria 2392
133 Ga0105247_10096347 3300009101 Unclassified 1886
134 Ga0114129_10043048 3300009147 Bacteria 6356
135 Ga0114129_10058424 3300009147 Bacteria 5394
136 Ga0114129_10122198 3300009147 Bacteria 3583
137 Ga0114129_10150580 3300009147 Bacteria 3184
138 Ga0114129_10374114 3300009147 Bacteria 1882
139 Ga0105243_10005877 3300009148 Bacteria 9505
140 Ga0105243_10193639 3300009148 Bacteria 1778
141 Ga0105243_10224092 3300009148 Bacteria 1664
142 Ga0105241_10032755 3300009174 Bacteria 3899
143 Ga0105241_10056761 3300009174 Bacteria 3002
144 Ga0105241_10191937 3300009174 Unclassified 1701
145 Ga0105242_10084537 3300009176 Bacteria 2659
146 Ga0105242_10116511 3300009176 Bacteria 2286
147 Ga0105242_10424366 3300009176 Unclassified 1247
148 Ga0105248_10246623 3300009177 Bacteria 2011
149 Ga0105237_10000903 3300009545 Bacteria 39910
150 Ga0105237_10060286 3300009545 Bacteria 3796
151 Ga0105237_10121011 3300009545 Bacteria 2612
152 Ga0105237_10320411 3300009545 Bacteria 1554
153 Ga0105249_10027188 3300009553 Bacteria 5161
154 Ga0105249_10317329 3300009553 Bacteria 1569
155 Ga0105239_10399375 3300010375 Bacteria 1556
156 Ga0105239_10509906 3300010375 Bacteria 1368
157 Ga0105246_10110752 3300011119 Unclassified 2016
158 Ga0105246_10224637 3300011119 Bacteria 1474
159 Ga0157373_10035538 3300013100 Bacteria 3577
160 Ga0157373_10042199 3300013100 Bacteria 3261
161 Ga0157373_10061624 3300013100 Bacteria 2657
162 Ga0157378_10368175 3300013297 Unclassified 1408
163 Ga0157378_10524764 3300013297 Bacteria 1186
164 Ga0163162_10068160 3300013306 Unclassified 3609
165 Ga0163162_10083796 3300013306 Bacteria 3263
166 Ga0163162_10186707 3300013306 Bacteria 2200
167 Ga0163162_10227755 3300013306 Bacteria 1994
168 Ga0157372_10065715 3300013307 Bacteria 4074
169 Ga0157372_10072716 3300013307 Unclassified 3875
170 Ga0157372_10281406 3300013307 Bacteria 1934
171 Ga0157375_10064085 3300013308 Bacteria 3658
172 Ga0157375_10854991 3300013308 Unclassified 1056
173 Ga0163163_10008742 3300014325 Bacteria 9012
174 Ga0163163_10092461 3300014325 Plasmid 3040
175 Ga0163163_10514180 3300014325 Bacteria 1259
176 Ga0157380_10048226 3300014326 Bacteria 3354
177 Ga0157380_10066581 3300014326 Bacteria 2897
178 Ga0157379_10083874 3300014968 Unclassified 2856
179 Ga0157379_10249046 3300014968 Bacteria 1613
180 Ga0207656_10011393 3300025321 Bacteria 3360
181 Ga0207653_10004969 3300025885 Bacteria 4153
182 Ga0207710_10000927 3300025900 Bacteria 15620
183 Ga0207684_10000314 3300025910 Bacteria 68706
184 Ga0207654_10165856 3300025911 Unclassified 1430
185 Ga0207707_10000062 3300025912 Bacteria 108192
186 Ga0207695_10156385 3300025913 Bacteria 2214
187 Ga0207671_10006486 3300025914 Bacteria 10414
188 Ga0207671_10154342 3300025914 Bacteria 1775
189 Ga0207671_10378299 3300025914 Unclassified 1125
190 Ga0207660_10000300 3300025917 Bacteria 32727
191 Ga0207660_10087436 3300025917 Unclassified 2303
192 Ga0207662_10012023 3300025918 Bacteria 4813
193 Ga0207662_10071604 3300025918 Bacteria 2099
194 Ga0207652_10000175 3300025921 Bacteria 68407
195 Ga0207646_10108206 3300025922 Bacteria 2494
196 Ga0207681_10055606 3300025923 Bacteria 2696
197 Ga0207681_10162110 3300025923 Bacteria 1687
198 Ga0207681_10244162 3300025923 Unclassified 1399
199 Ga0207694_10000938 3300025924 Bacteria 25703
200 Ga0207694_10297918 3300025924 Unclassified 1327
201 Ga0207650_10000047 3300025925 Bacteria 175675
202 Ga0207650_10078426 3300025925 Bacteria 2499
203 Ga0207650_10139081 3300025925 Bacteria 1908
204 Ga0207644_10043181 3300025931 Bacteria 3198
205 Ga0207706_10074174 3300025933 Bacteria 2992
206 Ga0207686_10317485 3300025934 Bacteria 1163
207 Ga0207709_10015344 3300025935 Bacteria 4247
208 Ga0207709_10092805 3300025935 Bacteria 1977
209 Ga0207691_10057968 3300025940 Bacteria 3523
210 Ga0207711_10137810 3300025941 Bacteria 2193
211 Ga0207711_10235320 3300025941 Bacteria 1678
212 Ga0207711_10245171 3300025941 Bacteria 1644
213 Ga0207689_10206022 3300025942 Bacteria 1624
214 Ga0207667_10450309 3300025949 Bacteria 1308
215 Ga0207651_10100144 3300025960 Bacteria 2148
216 Ga0207712_10016093 3300025961 Bacteria 4836
217 Ga0207640_10074165 3300025981 Unclassified 2302
218 Ga0207640_10181276 3300025981 Bacteria 1579
219 Ga0207658_10153946 3300025986 Bacteria 1877
220 Ga0207677_10300681 3300026023 Bacteria 1325
221 Ga0207703_10039870 3300026035 Bacteria 3756
222 Ga0207703_10046596 3300026035 Bacteria 3492
223 Ga0207639_10053024 3300026041 Bacteria 3092
224 Ga0207639_10103626 3300026041 Bacteria 2305
225 Ga0207708_10000246 3300026075 Bacteria 42577
226 Ga0207708_10024966 3300026075 Bacteria 4521
227 Ga0207708_10035497 3300026075 Bacteria 3794
228 Ga0207708_10049314 3300026075 Bacteria 3205
229 Ga0207708_10093090 3300026075 Bacteria 2326
230 Ga0207708_10131816 3300026075 Bacteria 1955
231 Ga0207702_10027481 3300026078 Bacteria 4725
232 Ga0207641_10057958 3300026088 Bacteria 3295
233 Ga0207641_10127828 3300026088 Bacteria 2278
234 Ga0207641_10203673 3300026088 Unclassified 1826
235 Ga0207641_10543024 3300026088 Bacteria 1133
236 Ga0207648_10244644 3300026089 Bacteria 1598
237 Ga0207676_10013809 3300026095 Bacteria 5798
238 Ga0207676_10261551 3300026095 Bacteria 1563
239 Ga0207674_10069269 3300026116 Bacteria 3549
240 Ga0207674_10103088 3300026116 Bacteria 2833
241 Ga0207674_10295212 3300026116 Unclassified 1569
242 Ga0207674_10386250 3300026116 Bacteria 1353
243 Ga0207675_100023867 3300026118 Bacteria 5688
244 Ga0207675_100218550 3300026118 Unclassified 1835
245 Ga0207698_10104147 3300026142 Bacteria 2360
246 Ga0207428_10021917 3300027907 Bacteria 5401
247 Ga0207428_10040137 3300027907 Bacteria 3799
248 Ga0268265_10074767 3300028380 Bacteria 2652
249 Ga0268265_10156622 3300028380 Unclassified 1929
250 Ga0268264_10239097 3300028381 Bacteria 1681
251 Ga0268264_10408263 3300028381 Bacteria 1307
252 Ga0307408_100124939 3300031548 Unclassified 1999
253 Ga0307405_10050826 3300031731 Bacteria 2569
254 Ga0307405_10078138 3300031731 Bacteria 2153
255 Ga0307413_10021241 3300031824 Bacteria 3471
256 Ga0307409_100246213 3300031995 Unclassified 1631
257 Ga0307416_100289804 3300032002 Unclassified 1620
258 Ga0307415_100009349 3300032126 Bacteria 5488
259 Ga0307415_100217450 3300032126 Bacteria 1529
260 Ga0373940_0047441 3300035088 Unclassified 1198
261 Ga0373951_0001105 3300035091 Bacteria 7190
262 Ga0373951_0038641 3300035091 Bacteria 1145
263 Ga0373941_0006153 3300035115 Bacteria 2873
264 Ga0439464_0016242 3300042439 Bacteria 2011
265 Ga0451576_0407585 3300045051 Unclassified 1426
266 Ga0451576_0818840 3300045051 Unclassified 978
267 Ga0496102_0052770 3300048905 Bacteria 3706
268 Ga0496103_0103329 3300048906 Bacteria 1805
269 Ga0496104_0183712 3300048907 Bacteria 2001
270 Ga0496105_0430918 3300048908 Bacteria 1043
271 Ga0496106_0099545 3300048909 Bacteria 2254
272 Ga0496106_0288636 3300048909 Bacteria 1315
273 Ga0496107_0042016 3300048910 Bacteria 3284
274 Ga0496108_0448466 3300048911 Bacteria 1127
275 Ga0496112_0154656 3300048915 Bacteria 2261
276 Ga0496112_0363652 3300048915 Unclassified 1389
277 Ga0501292_000725 3300049515 Bacteria 3999
278 Ga0501296_000594 3300049519 Bacteria 3548
279 Ga0501296_002198 3300049519 Unclassified 2020
280 Ga0501298_000250 3300049521 Bacteria 6964
281 Ga0501038_0002453 3300049574 Bacteria 17278
282 Ga0501207_018923 3300049654 Bacteria 1087
283 Ga0501216_004540 3300049660 Bacteria 2064
284 Ga0501223_016826 3300049663 Bacteria 1445
285 Ga0501224_011512 3300049664 Bacteria 1301
286 Ga0501227_017432 3300049665 Unclassified 1622
287 Ga0501240_006376 3300049673 Bacteria 1450
288 Ga0501249_017874 3300049679 Unclassified 1529
289 Ga0501253_005206 3300049683 Bacteria 1692
290 Ga0501257_020184 3300049686 Bacteria 1563
291 Ga0501257_042710 3300049686 Unclassified 1116
292 Ga0501260_002588 3300049689 Unclassified 1574
293 Ga0501225_0036971 3300049705 Bacteria 1346
294 Ga0501245_010487 3300049708 Bacteria 1339
295 Ga0501268_003804 3300049765 Unclassified 2089
296 Ga0501270_004388 3300049767 Bacteria 1581
297 Ga0501272_002268 3300049769 Bacteria 1892
298 Ga0501272_013875 3300049769 Unclassified 927
299 Ga0501283_001308 3300049779 Bacteria 3266
300 Ga0501212_005329 3300049851 Bacteria 1694
301 Ga0501226_000304 3300049853 Bacteria 7386
302 nmdc:mga05p37_204556_c1 3300050507 Bacteria 2389
303 nmdc:mga05p37_42757_c1 3300050507 Bacteria 5569
304 nmdc:mga05p37_64268_c1 3300050507 Bacteria 4515
305 nmdc:mga09592_118020_c1 3300050508 Bacteria 2277
306 nmdc:mga09592_75506_c1 3300050508 Bacteria 2865
307 nmdc:mga0qj67_176953_c1 3300050509 Bacteria 1733
308 nmdc:mga06r32_101245_c1 3300050510 Bacteria 2827
309 nmdc:mga06r32_275091_c1 3300050510 Bacteria 1671
310 nmdc:mga08y16_116375_c1 3300050511 Bacteria 2783
311 nmdc:mga08y16_43432_c1 3300050511 Bacteria 4710
312 nmdc:mga0n895_72419_c1 3300050512 Bacteria 3418
313 nmdc:mga0n895_88867_c1 3300050512 Bacteria 3090
314 nmdc:mga0rr50_113483_c1 3300050513 Bacteria 2147
315 nmdc:mga0a205_22946_c1 3300050515 Bacteria 5917
316 nmdc:mga0a205_30169_c1 3300050515 Bacteria 5191
317 Ga0501084_0223527 3300054114 Unclassified 1589
318 Ga0530510_0051872 3300061734 Bacteria 2964
319 Ga0070694_100065938
320 JGI24751J29686_10000044
321 Ga0065714_10064531
322 Ga0065704_10009331
323 Ga0065712_10000123
324 Ga0065712_10091607
325 Ga0065715_10000524
326 Ga0065715_10005979
327 Ga0065715_10095758
328 Ga0065715_10166196
329 Ga0065715_10215873
330 Ga0065707_10021136
331 Ga0070690_100002071
332 Ga0070670_100000144
333 Ga0070670_100081638
334 Ga0070670_100093096
335 Ga0070670_100152100
336 Ga0070677_10058103
337 Ga0068869_100131457
338 Ga0068869_100235802
339 Ga0068869_100384801
340 Ga0070680_100000868
341 Ga0070680_100079752
342 Ga0070680_100146516
343 Ga0070682_100023587
344 Ga0068868_100015413
345 Ga0070687_100034504
346 Ga0070692_10045788
347 Ga0070692_10047339
348 Ga0070669_100065695
349 Ga0070669_100120897
350 Ga0070669_100270507
351 Ga0070671_100050656
352 Ga0070673_100079047
353 Ga0070705_100031135
354 Ga0070705_100068322
355 Ga0070700_100000062
356 Ga0070700_100042627
357 Ga0070700_100042773
358 Ga0070700_100070306
359 Ga0070694_100072949
360 Ga0070694_100098411
361 Ga0070678_100137218
362 Ga0070681_10000032
363 Ga0070681_10082184
364 Ga0068867_100057847
365 Ga0068867_100358139
366 Ga0070706_100000137
367 Ga0070698_100052661
368 Ga0070698_100083693
369 Ga0070699_100087656
370 Ga0070679_100000331
371 Ga0070697_100110313
372 Ga0070697_100135442
373 Ga0068853_100008694
374 Ga0070672_100054051
375 Ga0070686_100063228
376 Ga0070695_100143430
377 Ga0070696_100026922
378 Ga0070696_100041461
379 Ga0070696_100047657
380 Ga0070696_100052500
381 Ga0070693_100035663
382 Ga0070693_100043111
383 Ga0070693_100061132
384 Ga0070693_100088382
385 Ga0070693_100169085
386 Ga0070704_100114673
387 Ga0070704_100173340
388 Ga0068855_100391347
389 Ga0070664_100263195
390 Ga0068857_100234272
391 Ga0068854_100226883
392 Ga0068854_100349669
393 Ga0068856_100005019
394 Ga0070702_100057419
395 Ga0070702_100081954
396 Ga0068852_100244672
397 Ga0068859_100059388
398 Ga0068859_100085780
399 Ga0068859_100207446
400 Ga0068859_100286963
401 Ga0068859_100337997
402 Ga0068864_100095032
403 Ga0068864_100197324
404 Ga0068861_100036588
405 Ga0068851_10020249
406 Ga0068870_10016170
407 Ga0068858_100011207
408 Ga0068858_100120657
409 Ga0068858_100149908
410 Ga0068858_100192015
411 Ga0068860_100058989
412 Ga0068860_100117073
413 Ga0068862_100048237
414 Ga0068862_100500381
415 Ga0081539_10002223
416 Ga0070716_100118481
417 Ga0070716_100323742
418 Ga0097621_100060869
419 Ga0097621_100349909
420 Ga0068871_100007057
421 Ga0075428_100124974
422 Ga0075428_100379772
423 Ga0075430_100018769
424 Ga0075430_100071451
425 Ga0075431_100110445
426 Ga0075431_100242037
427 Ga0075431_100287492
428 Ga0075433_10032196
429 Ga0075433_10134747
430 Ga0075434_100052842
431 Ga0075434_100083269
432 Ga0075434_100194519
433 Ga0075429_100030137
434 Ga0075429_100056376
435 Ga0097620_100059388
436 Ga0097620_100085787
437 Ga0097620_100207434
438 Ga0097620_100286978
439 Ga0097620_100337979
440 Ga0075435_100055646
441 Ga0075435_100073725
442 Ga0105251_10013672
443 Ga0105240_10149093
444 Ga0111539_10001877
445 Ga0111539_10014810
446 Ga0111539_10043278
447 Ga0111539_10171340
448 Ga0105247_10013467
449 Ga0105247_10021387
450 Ga0105247_10058107
451 Ga0105247_10096347
452 Ga0114129_10043048
453 Ga0114129_10058424
454 Ga0114129_10122198
455 Ga0114129_10150580
456 Ga0114129_10374114
457 Ga0105243_10005877
458 Ga0105243_10193639
459 Ga0105243_10224092
460 Ga0105241_10032755
461 Ga0105241_10056761
462 Ga0105241_10191937
463 Ga0105242_10084537
464 Ga0105242_10116511
465 Ga0105242_10424366
466 Ga0105248_10246623
467 Ga0105237_10000903
468 Ga0105237_10060286
469 Ga0105237_10121011
470 Ga0105237_10320411
471 Ga0105249_10027188
472 Ga0105249_10317329
473 Ga0105239_10399375
474 Ga0105239_10509906
475 Ga0105246_10110752
476 Ga0105246_10224637
477 Ga0157373_10035538
478 Ga0157373_10042199
479 Ga0157373_10061624
480 Ga0157378_10368175
481 Ga0157378_10524764
482 Ga0163162_10068160
483 Ga0163162_10083796
484 Ga0163162_10186707
485 Ga0163162_10227755
486 Ga0157372_10065715
487 Ga0157372_10072716
488 Ga0157372_10281406
489 Ga0157375_10064085
490 Ga0157375_10854991
491 Ga0163163_10008742
492 Ga0163163_10092461
493 Ga0163163_10514180
494 Ga0157380_10048226
495 Ga0157380_10066581
496 Ga0157379_10083874
497 Ga0157379_10249046
498 Ga0207656_10011393
499 Ga0207653_10004969
500 Ga0207710_10000927
501 Ga0207684_10000314
502 Ga0207654_10165856
503 Ga0207707_10000062
504 Ga0207695_10156385
505 Ga0207671_10006486
506 Ga0207671_10154342
507 Ga0207671_10378299
508 Ga0207660_10000300
509 Ga0207660_10087436
510 Ga0207662_10012023
511 Ga0207662_10071604
512 Ga0207652_10000175
513 Ga0207646_10108206
514 Ga0207681_10055606
515 Ga0207681_10162110
516 Ga0207681_10244162
517 Ga0207694_10000938
518 Ga0207694_10297918
519 Ga0207650_10000047
520 Ga0207650_10078426
521 Ga0207650_10139081
522 Ga0207644_10043181
523 Ga0207706_10074174
524 Ga0207686_10317485
525 Ga0207709_10015344
526 Ga0207709_10092805
527 Ga0207691_10057968
528 Ga0207711_10137810
529 Ga0207711_10235320
530 Ga0207711_10245171
531 Ga0207689_10206022
532 Ga0207667_10450309
533 Ga0207651_10100144
534 Ga0207712_10016093
535 Ga0207640_10074165
536 Ga0207640_10181276
537 Ga0207658_10153946
538 Ga0207677_10300681
539 Ga0207703_10039870
540 Ga0207703_10046596
541 Ga0207639_10053024
542 Ga0207639_10103626
543 Ga0207708_10000246
544 Ga0207708_10024966
545 Ga0207708_10035497
546 Ga0207708_10049314
547 Ga0207708_10093090
548 Ga0207708_10131816
549 Ga0207702_10027481
550 Ga0207641_10057958
551 Ga0207641_10127828
552 Ga0207641_10203673
553 Ga0207641_10543024
554 Ga0207648_10244644
555 Ga0207676_10013809
556 Ga0207676_10261551
557 Ga0207674_10069269
558 Ga0207674_10103088
559 Ga0207674_10295212
560 Ga0207674_10386250
561 Ga0207675_100023867
562 Ga0207675_100218550
563 Ga0207698_10104147
564 Ga0207428_10021917
565 Ga0207428_10040137
566 Ga0268265_10074767
567 Ga0268265_10156622
568 Ga0268264_10239097
569 Ga0268264_10408263
570 Ga0307408_100124939
571 Ga0307405_10050826
572 Ga0307405_10078138
573 Ga0307413_10021241
574 Ga0307409_100246213
575 Ga0307416_100289804
576 Ga0307415_100009349
577 Ga0307415_100217450
578 Ga0373940_0047441
579 Ga0373951_0001105
580 Ga0373951_0038641
581 Ga0373941_0006153
582 Ga0439464_0016242
583 Ga0451576_0407585
584 Ga0451576_0818840
585 Ga0496102_0052770
586 Ga0496103_0103329
587 Ga0496104_0183712
588 Ga0496105_0430918
589 Ga0496106_0099545
590 Ga0496106_0288636
591 Ga0496107_0042016
592 Ga0496108_0448466
593 Ga0496112_0154656
594 Ga0496112_0363652
595 Ga0501292_000725
596 Ga0501296_000594
597 Ga0501296_002198
598 Ga0501298_000250
599 Ga0501038_0002453
600 Ga0501207_018923
601 Ga0501216_004540
602 Ga0501223_016826
603 Ga0501224_011512
604 Ga0501227_017432
605 Ga0501240_006376
606 Ga0501249_017874
607 Ga0501253_005206
608 Ga0501257_020184
609 Ga0501257_042710
610 Ga0501260_002588
611 Ga0501225_0036971
612 Ga0501245_010487
613 Ga0501268_003804
614 Ga0501270_004388
615 Ga0501272_002268
616 Ga0501272_013875
617 Ga0501283_001308
618 Ga0501212_005329
619 Ga0501226_000304
620 nmdc:mga05p37_204556_c1
621 nmdc:mga05p37_42757_c1
622 nmdc:mga05p37_64268_c1
623 nmdc:mga09592_118020_c1
624 nmdc:mga09592_75506_c1
625 nmdc:mga0qj67_176953_c1
626 nmdc:mga06r32_101245_c1
627 nmdc:mga06r32_275091_c1
628 nmdc:mga08y16_116375_c1
629 nmdc:mga08y16_43432_c1
630 nmdc:mga0n895_72419_c1
631 nmdc:mga0n895_88867_c1
632 nmdc:mga0rr50_113483_c1
633 nmdc:mga0a205_22946_c1
634 nmdc:mga0a205_30169_c1
635 Ga0501084_0223527
636 Ga0530510_0051872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vfk-assembly1.cif.gz_A de novo designed tetrahedral nanoparticle t33_dn10 displaying 4 copies of bg505-sosip trimer on the surface 0.8653 84 223
6vl6-assembly1.cif.gz_B de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.859 86 203
3kd7-assembly1.cif.gz_A designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.8571 86 205
6vl6-assembly1.cif.gz_B de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.8433 86 203
6vfi-assembly1.cif.gz_B de novo designed octahedral nanoparticle o43_dn18 0.8382 85 224
ID Description Score Start End Superfamily
af_Q8R368_287_409_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8089 86 205 1.25.40.10
af_Q9XYW6_12_119_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8084 86 201 1.25.40.10
af_A0A0R4ID80_285_407_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8049 86 205 1.25.40.10
af_Q58823_4_115_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7999 86 203 1.25.40.10
af_Q9UNE7_24_139_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7951 86 201 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V8QH89-F1-model_v4 Uncharacterized protein 0.9675 22 320
AF-A0A7W0XDL1-F1-model_v4 Uncharacterized protein 0.9671 231 320
AF-A0A838RUP3-F1-model_v4 Uncharacterized protein 0.9569 53 320
AF-A0A7W0XDL1-F1-model_v4 Uncharacterized protein 0.9467 231 320
AF-A0A7V9Q7H5-F1-model_v4 Tetratricopeptide repeat protein 0.9207 167 320

Map