F404443

General Info

Members Datasets Scaffolds Average Seq Length
318 191 636 313

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10192278|Ga0065707_101922781
Length 339
Sequence VSGHRTPRRRPVQQVTLARYKREASVAVSYLVLVVLVAIIAPSFLQTANLRDLAMNNAAVLIVAVGMTLVILTGEIDISVGSQFAVCTYLAGSLAKAGLPPLLLLPVVVAAGALMGAVGGWFVARLKMPSIVVTLALMVAWRDGLRWVTEGTWVQDLPANFQWFGLGQTAGQIVVIVLALAVLASFGWALRNLAAGRAVYAVGSDAEAARLAGINPQSVVLTTFVLMGALVGLAALLNAMRFSIVPSNAGIGLELKAIAAVVVGGTAITGGRGSILGTLIGVALLGTIGTALTFIGINPFWEKAIQGAIILAAVVSDVVVSRLAKPGAGDFGLRTETQQ

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10192278 3300005295 Bacteria 1355
2 JGI24748J21848_1000012 3300002074 Bacteria 152599
3 JGI24034J26672_10000003 3300002239 Bacteria 501747
4 Ga0065712_10135275 3300005290 Unclassified 1504
5 Ga0065715_10003377 3300005293 Bacteria 7018
6 Ga0065715_10092476 3300005293 Bacteria 5107
7 Ga0065707_10125559 3300005295 Bacteria 2021
8 Ga0065707_10258038 3300005295 Bacteria 1105
9 Ga0070676_10005525 3300005328 Bacteria 6736
10 Ga0070683_100000003 3300005329 Bacteria 375084
11 Ga0070690_100150473 3300005330 Bacteria 1587
12 Ga0070670_100027907 3300005331 Bacteria 4857
13 Ga0068869_100027031 3300005334 Bacteria 3997
14 Ga0068869_100048209 3300005334 Bacteria 3079
15 Ga0070680_100000445 3300005336 Bacteria 28155
16 Ga0068868_100013990 3300005338 Bacteria 5902
17 Ga0068868_100288630 3300005338 Unclassified 1390
18 Ga0070660_100034349 3300005339 Bacteria 3831
19 Ga0070689_100062610 3300005340 Bacteria 2895
20 Ga0070689_100067437 3300005340 Unclassified 2789
21 Ga0070689_100134108 3300005340 Bacteria 1988
22 Ga0070692_10084409 3300005345 Bacteria 1716
23 Ga0070668_100010366 3300005347 Bacteria 6922
24 Ga0070669_100005934 3300005353 Bacteria 8815
25 Ga0070669_100029976 3300005353 Bacteria 3923
26 Ga0070669_100141768 3300005353 Bacteria 1853
27 Ga0070669_100405551 3300005353 Unclassified 1116
28 Ga0070675_100001776 3300005354 Bacteria 15913
29 Ga0070675_100019346 3300005354 Bacteria 5425
30 Ga0070675_100054884 3300005354 Bacteria 3279
31 Ga0070671_100024223 3300005355 Bacteria 4967
32 Ga0070674_100055384 3300005356 Bacteria 2746
33 Ga0070674_100127003 3300005356 Bacteria 1896
34 Ga0070673_100455021 3300005364 Bacteria 1152
35 Ga0070688_100016755 3300005365 Bacteria 4195
36 Ga0070688_100062944 3300005365 Bacteria 2350
37 Ga0070667_100024393 3300005367 Bacteria 5023
38 Ga0070701_10046873 3300005438 Bacteria 2224
39 Ga0070705_100038890 3300005440 Bacteria 2696
40 Ga0070700_100072719 3300005441 Bacteria 2199
41 Ga0070694_100045710 3300005444 Bacteria 2936
42 Ga0070678_100072705 3300005456 Bacteria 2579
43 Ga0070662_100006441 3300005457 Bacteria 7566
44 Ga0070662_100009904 3300005457 Bacteria 6244
45 Ga0070681_10000067 3300005458 Bacteria 75697
46 Ga0068867_100053417 3300005459 Bacteria 2984
47 Ga0068867_100326512 3300005459 Bacteria 1273
48 Ga0070685_10006793 3300005466 Bacteria 5840
49 Ga0070707_100002461 3300005468 Bacteria 17647
50 Ga0070707_100022426 3300005468 Bacteria 5970
51 Ga0070707_100042108 3300005468 Bacteria 4371
52 Ga0070698_100001987 3300005471 Bacteria 22694
53 Ga0070698_100090284 3300005471 Bacteria 3047
54 Ga0070698_100103159 3300005471 Bacteria 2822
55 Ga0070699_100002830 3300005518 Bacteria 15479
56 Ga0070699_100051855 3300005518 Bacteria 3552
57 Ga0070699_100104952 3300005518 Bacteria 2479
58 Ga0070699_100377699 3300005518 Bacteria 1279
59 Ga0070679_100000055 3300005530 Bacteria 84504
60 Ga0070684_100000014 3300005535 Bacteria 158815
61 Ga0070697_100000726 3300005536 Bacteria 24563
62 Ga0068853_100034378 3300005539 Bacteria 4302
63 Ga0068853_100189576 3300005539 Bacteria 1868
64 Ga0070686_100138670 3300005544 Bacteria 1690
65 Ga0070695_100065848 3300005545 Bacteria 2360
66 Ga0070696_100087931 3300005546 Bacteria 2207
67 Ga0070665_100093864 3300005548 Bacteria 3006
68 Ga0068855_100057176 3300005563 Bacteria 4573
69 Ga0070664_100005667 3300005564 Bacteria 10055
70 Ga0070664_100010754 3300005564 Bacteria 7419
71 Ga0070664_100130132 3300005564 Bacteria 2210
72 Ga0068857_100030625 3300005577 Bacteria 4752
73 Ga0068854_100191974 3300005578 Bacteria 1601
74 Ga0068856_100002448 3300005614 Bacteria 19099
75 Ga0070702_100008499 3300005615 Bacteria 4976
76 Ga0068852_100007823 3300005616 Bacteria 7825
77 Ga0068859_100044128 3300005617 Bacteria 4481
78 Ga0068859_100075708 3300005617 Bacteria 3406
79 Ga0068859_100373940 3300005617 Unclassified 1520
80 Ga0068864_100008776 3300005618 Bacteria 8332
81 Ga0068864_100243633 3300005618 Unclassified 1666
82 Ga0068861_100016526 3300005719 Bacteria 5223
83 Ga0068861_100182785 3300005719 Bacteria 1747
84 Ga0068870_10006970 3300005840 Bacteria 5013
85 Ga0068870_10009471 3300005840 Bacteria 4434
86 Ga0068863_100048363 3300005841 Bacteria 4033
87 Ga0068863_100135293 3300005841 Unclassified 2354
88 Ga0068858_100000277 3300005842 Bacteria 55193
89 Ga0068858_100011485 3300005842 Bacteria 8358
90 Ga0068858_100078147 3300005842 Bacteria 3075
91 Ga0068858_100115414 3300005842 Bacteria 2509
92 Ga0068860_100003946 3300005843 Bacteria 15240
93 Ga0068860_100045794 3300005843 Bacteria 4171
94 Ga0068860_100149774 3300005843 Bacteria 2246
95 Ga0068860_100326475 3300005843 Bacteria 1507
96 Ga0068862_100022371 3300005844 Bacteria 5289
97 Ga0068862_100025681 3300005844 Bacteria 4947
98 Ga0068862_100032515 3300005844 Bacteria 4408
99 Ga0068862_100032877 3300005844 Bacteria 4381
100 Ga0068862_100154225 3300005844 Bacteria 2046
101 Ga0068862_100171076 3300005844 Bacteria 1945
102 Ga0081455_10010906 3300005937 Bacteria 9169
103 Ga0097621_100009961 3300006237 Bacteria 6927
104 Ga0097621_100013495 3300006237 Bacteria 6091
105 Ga0068871_100004200 3300006358 Bacteria 9975
106 Ga0075428_100139158 3300006844 Bacteria 2639
107 Ga0075431_100037093 3300006847 Bacteria 5023
108 Ga0075431_100046767 3300006847 Bacteria 4463
109 Ga0075433_10131464 3300006852 Unclassified 2224
110 Ga0068865_100025799 3300006881 Bacteria 3870
111 Ga0068865_100031389 3300006881 Bacteria 3542
112 Ga0097620_100044128 3300006931 Bacteria 4481
113 Ga0097620_100075705 3300006931 Bacteria 3406
114 Ga0097620_100373939 3300006931 Unclassified 1520
115 Ga0105251_10055003 3300009011 Bacteria 1888
116 Ga0105240_10080588 3300009093 Bacteria 4003
117 Ga0111539_10003757 3300009094 Bacteria 19991
118 Ga0111539_10009349 3300009094 Bacteria 12378
119 Ga0111539_10296916 3300009094 Bacteria 1880
120 Ga0105245_10111362 3300009098 Bacteria 2546
121 Ga0105245_10189768 3300009098 Bacteria 1968
122 Ga0105245_10237008 3300009098 Bacteria 1767
123 Ga0114129_10023646 3300009147 Bacteria 8710
124 Ga0114129_10074192 3300009147 Bacteria 4739
125 Ga0114129_10099191 3300009147 Bacteria 4031
126 Ga0114129_10147435 3300009147 Bacteria 3222
127 Ga0114129_10705391 3300009147 Unclassified 1296
128 Ga0105243_10331373 3300009148 Bacteria 1390
129 Ga0105241_10060685 3300009174 Bacteria 2909
130 Ga0105242_10031660 3300009176 Bacteria 4227
131 Ga0105248_10065038 3300009177 Bacteria 4094
132 Ga0105248_10569776 3300009177 Unclassified 1278
133 Ga0105238_10186339 3300009551 Bacteria 2052
134 Ga0105249_10015349 3300009553 Bacteria 6778
135 Ga0105249_10523089 3300009553 Bacteria 1234
136 Ga0105239_10015854 3300010375 Bacteria 8340
137 Ga0105239_10044206 3300010375 Bacteria 4883
138 Ga0105239_10299404 3300010375 Bacteria 1811
139 Ga0105246_10041205 3300011119 Bacteria 3120
140 Ga0105246_10135068 3300011119 Bacteria 1848
141 Ga0157373_10005313 3300013100 Bacteria 9675
142 Ga0157373_10175287 3300013100 Bacteria 1509
143 Ga0157378_10035148 3300013297 Unclassified 4431
144 Ga0157378_10085676 3300013297 Bacteria 2854
145 Ga0157378_10183237 3300013297 Bacteria 1971
146 Ga0157378_10188209 3300013297 Bacteria 1945
147 Ga0163162_10003874 3300013306 Bacteria 14361
148 Ga0163162_10011644 3300013306 Bacteria 8575
149 Ga0163162_10012961 3300013306 Bacteria 8136
150 Ga0163162_10228053 3300013306 Bacteria 1993
151 Ga0157375_10004447 3300013308 Bacteria 12172
152 Ga0157375_10048183 3300013308 Bacteria 4167
153 Ga0157375_10237490 3300013308 Bacteria 1982
154 Ga0163163_10026186 3300014325 Bacteria 5571
155 Ga0163163_10027424 3300014325 Bacteria 5456
156 Ga0163163_10074552 3300014325 Unclassified 3385
157 Ga0163163_10254898 3300014325 Bacteria 1805
158 Ga0163163_10406915 3300014325 Bacteria 1419
159 Ga0157380_10008051 3300014326 Bacteria 7510
160 Ga0157377_10009042 3300014745 Bacteria 4880
161 Ga0157376_10025792 3300014969 Unclassified 4634
162 Ga0157376_10075453 3300014969 Bacteria 2878
163 Ga0157376_10235087 3300014969 Bacteria 1704
164 Ga0163161_10003966 3300017792 Bacteria 10378
165 Ga0163161_10298803 3300017792 Bacteria 1268
166 Ga0207672_1000116 3300025223 Bacteria 10720
167 Ga0207697_10019062 3300025315 Bacteria 2810
168 Ga0207697_10083882 3300025315 Unclassified 1345
169 Ga0207710_10000001 3300025900 Bacteria 1797433
170 Ga0207688_10125932 3300025901 Bacteria 1498
171 Ga0207647_10001939 3300025904 Bacteria 15813
172 Ga0207645_10001143 3300025907 Bacteria 21895
173 Ga0207643_10000274 3300025908 Bacteria 35744
174 Ga0207643_10007143 3300025908 Bacteria 5992
175 Ga0207707_10000003 3300025912 Bacteria 642592
176 Ga0207660_10012092 3300025917 Bacteria 5642
177 Ga0207662_10004734 3300025918 Bacteria 7186
178 Ga0207662_10121395 3300025918 Unclassified 1639
179 Ga0207657_10022160 3300025919 Bacteria 5958
180 Ga0207649_10015553 3300025920 Bacteria 4274
181 Ga0207652_10000111 3300025921 Bacteria 88571
182 Ga0207646_10000897 3300025922 Bacteria 38370
183 Ga0207646_10045521 3300025922 Bacteria 3940
184 Ga0207646_10234924 3300025922 Bacteria 1656
185 Ga0207681_10005433 3300025923 Bacteria 7824
186 Ga0207681_10014958 3300025923 Bacteria 4834
187 Ga0207681_10080529 3300025923 Bacteria 2297
188 Ga0207681_10183154 3300025923 Bacteria 1597
189 Ga0207694_10077257 3300025924 Bacteria 2609
190 Ga0207650_10038883 3300025925 Bacteria 3477
191 Ga0207650_10241972 3300025925 Bacteria 1459
192 Ga0207659_10005941 3300025926 Bacteria 7448
193 Ga0207659_10024155 3300025926 Bacteria 4069
194 Ga0207659_10204019 3300025926 Bacteria 1581
195 Ga0207687_10067943 3300025927 Bacteria 2537
196 Ga0207644_10002534 3300025931 Bacteria 11751
197 Ga0207706_10001283 3300025933 Bacteria 25311
198 Ga0207706_10036148 3300025933 Bacteria 4388
199 Ga0207706_10102869 3300025933 Bacteria 2513
200 Ga0207670_10023754 3300025936 Bacteria 3820
201 Ga0207669_10085196 3300025937 Bacteria 2039
202 Ga0207704_10075588 3300025938 Bacteria 2154
203 Ga0207704_10247777 3300025938 Unclassified 1335
204 Ga0207691_10001424 3300025940 Bacteria 23863
205 Ga0207691_10039645 3300025940 Bacteria 4358
206 Ga0207691_10112293 3300025940 Unclassified 2422
207 Ga0207691_10127144 3300025940 Bacteria 2254
208 Ga0207711_10012909 3300025941 Bacteria 6938
209 Ga0207689_10005943 3300025942 Bacteria 10803
210 Ga0207661_10000014 3300025944 Bacteria 322246
211 Ga0207661_10034441 3300025944 Bacteria 3938
212 Ga0207679_10005955 3300025945 Bacteria 7669
213 Ga0207679_10034539 3300025945 Bacteria 3569
214 Ga0207679_10272922 3300025945 Bacteria 1447
215 Ga0207667_10024452 3300025949 Bacteria 6632
216 Ga0207651_10024550 3300025960 Bacteria 3732
217 Ga0207651_10039237 3300025960 Bacteria 3121
218 Ga0207651_10153047 3300025960 Bacteria 1798
219 Ga0207712_10001486 3300025961 Bacteria 15926
220 Ga0207712_10136647 3300025961 Bacteria 1876
221 Ga0207668_10010617 3300025972 Bacteria 5572
222 Ga0207640_10029900 3300025981 Bacteria 3350
223 Ga0207658_10043189 3300025986 Unclassified 3276
224 Ga0207677_10011861 3300026023 Bacteria 4987
225 Ga0207677_10040576 3300026023 Bacteria 3069
226 Ga0207703_10000080 3300026035 Bacteria 111786
227 Ga0207703_10154812 3300026035 Bacteria 2002
228 Ga0207639_10047879 3300026041 Bacteria 3233
229 Ga0207639_10077980 3300026041 Bacteria 2613
230 Ga0207708_10029339 3300026075 Bacteria 4169
231 Ga0207708_10086142 3300026075 Bacteria 2417
232 Ga0207708_10111242 3300026075 Bacteria 2126
233 Ga0207708_10231880 3300026075 Bacteria 1482
234 Ga0207702_10015024 3300026078 Bacteria 6420
235 Ga0207641_10020856 3300026088 Bacteria 5386
236 Ga0207648_10095382 3300026089 Bacteria 2602
237 Ga0207676_10018290 3300026095 Bacteria 5092
238 Ga0207674_10010122 3300026116 Bacteria 10721
239 Ga0207674_10021816 3300026116 Bacteria 6892
240 Ga0207674_10070075 3300026116 Bacteria 3525
241 Ga0207675_100001718 3300026118 Bacteria 21938
242 Ga0207675_100031253 3300026118 Bacteria 4960
243 Ga0207683_10040584 3300026121 Bacteria 4062
244 Ga0207428_10001192 3300027907 Bacteria 27970
245 Ga0207428_10001571 3300027907 Bacteria 23797
246 Ga0268266_10177900 3300028379 Bacteria 1935
247 Ga0268265_10031637 3300028380 Bacteria 3823
248 Ga0268265_10075435 3300028380 Bacteria 2641
249 Ga0268265_10088413 3300028380 Unclassified 2468
250 Ga0268265_10182857 3300028380 Bacteria 1803
251 Ga0268264_10012914 3300028381 Bacteria 6866
252 Ga0268264_10076169 3300028381 Bacteria 2854
253 Ga0373923_0080933 3300035111 Bacteria 1409
254 Ga0373954_0043288 3300035118 Bacteria 2100
255 Ga0373935_0340523 3300035692 Bacteria 1068
256 Ga0373927_0003916 3300035695 Bacteria 10552
257 Ga0373937_0043117 3300036401 Bacteria 4117
258 Ga0373937_0330473 3300036401 Bacteria 1443
259 Ga0395900_0032118 3300037418 Bacteria 5397
260 Ga0395905_0004155 3300037471 Bacteria 15146
261 Ga0395901_0008231 3300038443 Bacteria 10535
262 Ga0242420_013938 3300038996 Unclassified 1374
263 Ga0453683_0163278 3300044673 Bacteria 1410
264 Ga0495651_0026523 3300046462 Bacteria 4513
265 Ga0495651_0034399 3300046462 Bacteria 3948
266 Ga0495653_0089022 3300046463 Unclassified 2263
267 Ga0495580_0034420 3300046472 Bacteria 3647
268 Ga0495664_0000501 3300046477 Bacteria 19511
269 Ga0495664_0189527 3300046477 Bacteria 1247
270 Ga0495608_0072193 3300046511 Bacteria 2252
271 Ga0495628_0012328 3300046516 Bacteria 7206
272 Ga0495652_0046068 3300046529 Bacteria 3745
273 Ga0495665_0097212 3300046531 Unclassified 1546
274 Ga0495665_0167643 3300046531 Bacteria 1144
275 Ga0495586_0049073 3300046535 Bacteria 2282
276 Ga0495587_0021378 3300046536 Bacteria 3990
277 Ga0495667_0016103 3300046559 Bacteria 5054
278 Ga0495667_0088094 3300046559 Bacteria 2012
279 Ga0495635_0143414 3300046663 Unclassified 1626
280 Ga0495657_0133742 3300046675 Unclassified 1551
281 Ga0495599_0010262 3300046678 Bacteria 5732
282 Ga0495646_0065227 3300046680 Bacteria 2156
283 Ga0495613_0081597 3300046689 Bacteria 2349
284 Ga0495604_0087590 3300047317 Bacteria 2319
285 Ga0495604_0259833 3300047317 Bacteria 1181
286 Ga0495674_0016307 3300047319 Bacteria 6928
287 Ga0495680_0116324 3300047322 Bacteria 1977
288 Ga0495675_0127827 3300047444 Bacteria 1581
289 Ga0495684_0002980 3300047471 Bacteria 13323
290 Ga0495602_0004645 3300048088 Bacteria 14331
291 Ga0495602_0084197 3300048088 Bacteria 2661
292 Ga0496109_0000017 3300048912 Bacteria 200904
293 Ga0496109_0172112 3300048912 Bacteria 2032
294 Ga0496110_0433615 3300048913 Bacteria 1198
295 Ga0501038_0207760 3300049574 Bacteria 1568
296 Ga0501039_0119927 3300049575 Bacteria 2061
297 Ga0501040_0070456 3300049576 Unclassified 2413
298 Ga0501040_0175832 3300049576 Bacteria 1516
299 Ga0501046_0157543 3300049580 Bacteria 1709
300 Ga0501048_0027835 3300049582 Bacteria 4105
301 Ga0501072_0062489 3300049588 Bacteria 2938
302 Ga0501074_0073553 3300049590 Bacteria 2455
303 Ga0501075_0034722 3300049591 Bacteria 3756
304 Ga0501076_0031512 3300049592 Bacteria 4135
305 Ga0501079_0020539 3300049741 Bacteria 5050
306 Ga0501079_0111582 3300049741 Bacteria 2125
307 Ga0501081_0040417 3300049743 Bacteria 3194
308 Ga0501045_0157882 3300049824 Bacteria 1688
309 nmdc:mga05p37_8151_c1 3300050507 Bacteria 12384
310 nmdc:mga06r32_66288_c1 3300050510 Unclassified 3484
311 nmdc:mga08y16_12690_c1 3300050511 Bacteria 8864
312 nmdc:mga08y16_31601_c1 3300050511 Bacteria 5568
313 nmdc:mga0n895_202022_c1 3300050512 Bacteria 2018
314 nmdc:mga0a205_76344_c1 3300050515 Bacteria 3238
315 Ga0500577_0008822 3300053142 Bacteria 2895
316 Ga0501082_0001403 3300060353 Bacteria 21228
317 Ga0501082_0017845 3300060353 Bacteria 6112
318 Ga0501082_0205661 3300060353 Bacteria 1713
319 Ga0065707_10192278
320 JGI24748J21848_1000012
321 JGI24034J26672_10000003
322 Ga0065712_10135275
323 Ga0065715_10003377
324 Ga0065715_10092476
325 Ga0065707_10125559
326 Ga0065707_10258038
327 Ga0070676_10005525
328 Ga0070683_100000003
329 Ga0070690_100150473
330 Ga0070670_100027907
331 Ga0068869_100027031
332 Ga0068869_100048209
333 Ga0070680_100000445
334 Ga0068868_100013990
335 Ga0068868_100288630
336 Ga0070660_100034349
337 Ga0070689_100062610
338 Ga0070689_100067437
339 Ga0070689_100134108
340 Ga0070692_10084409
341 Ga0070668_100010366
342 Ga0070669_100005934
343 Ga0070669_100029976
344 Ga0070669_100141768
345 Ga0070669_100405551
346 Ga0070675_100001776
347 Ga0070675_100019346
348 Ga0070675_100054884
349 Ga0070671_100024223
350 Ga0070674_100055384
351 Ga0070674_100127003
352 Ga0070673_100455021
353 Ga0070688_100016755
354 Ga0070688_100062944
355 Ga0070667_100024393
356 Ga0070701_10046873
357 Ga0070705_100038890
358 Ga0070700_100072719
359 Ga0070694_100045710
360 Ga0070678_100072705
361 Ga0070662_100006441
362 Ga0070662_100009904
363 Ga0070681_10000067
364 Ga0068867_100053417
365 Ga0068867_100326512
366 Ga0070685_10006793
367 Ga0070707_100002461
368 Ga0070707_100022426
369 Ga0070707_100042108
370 Ga0070698_100001987
371 Ga0070698_100090284
372 Ga0070698_100103159
373 Ga0070699_100002830
374 Ga0070699_100051855
375 Ga0070699_100104952
376 Ga0070699_100377699
377 Ga0070679_100000055
378 Ga0070684_100000014
379 Ga0070697_100000726
380 Ga0068853_100034378
381 Ga0068853_100189576
382 Ga0070686_100138670
383 Ga0070695_100065848
384 Ga0070696_100087931
385 Ga0070665_100093864
386 Ga0068855_100057176
387 Ga0070664_100005667
388 Ga0070664_100010754
389 Ga0070664_100130132
390 Ga0068857_100030625
391 Ga0068854_100191974
392 Ga0068856_100002448
393 Ga0070702_100008499
394 Ga0068852_100007823
395 Ga0068859_100044128
396 Ga0068859_100075708
397 Ga0068859_100373940
398 Ga0068864_100008776
399 Ga0068864_100243633
400 Ga0068861_100016526
401 Ga0068861_100182785
402 Ga0068870_10006970
403 Ga0068870_10009471
404 Ga0068863_100048363
405 Ga0068863_100135293
406 Ga0068858_100000277
407 Ga0068858_100011485
408 Ga0068858_100078147
409 Ga0068858_100115414
410 Ga0068860_100003946
411 Ga0068860_100045794
412 Ga0068860_100149774
413 Ga0068860_100326475
414 Ga0068862_100022371
415 Ga0068862_100025681
416 Ga0068862_100032515
417 Ga0068862_100032877
418 Ga0068862_100154225
419 Ga0068862_100171076
420 Ga0081455_10010906
421 Ga0097621_100009961
422 Ga0097621_100013495
423 Ga0068871_100004200
424 Ga0075428_100139158
425 Ga0075431_100037093
426 Ga0075431_100046767
427 Ga0075433_10131464
428 Ga0068865_100025799
429 Ga0068865_100031389
430 Ga0097620_100044128
431 Ga0097620_100075705
432 Ga0097620_100373939
433 Ga0105251_10055003
434 Ga0105240_10080588
435 Ga0111539_10003757
436 Ga0111539_10009349
437 Ga0111539_10296916
438 Ga0105245_10111362
439 Ga0105245_10189768
440 Ga0105245_10237008
441 Ga0114129_10023646
442 Ga0114129_10074192
443 Ga0114129_10099191
444 Ga0114129_10147435
445 Ga0114129_10705391
446 Ga0105243_10331373
447 Ga0105241_10060685
448 Ga0105242_10031660
449 Ga0105248_10065038
450 Ga0105248_10569776
451 Ga0105238_10186339
452 Ga0105249_10015349
453 Ga0105249_10523089
454 Ga0105239_10015854
455 Ga0105239_10044206
456 Ga0105239_10299404
457 Ga0105246_10041205
458 Ga0105246_10135068
459 Ga0157373_10005313
460 Ga0157373_10175287
461 Ga0157378_10035148
462 Ga0157378_10085676
463 Ga0157378_10183237
464 Ga0157378_10188209
465 Ga0163162_10003874
466 Ga0163162_10011644
467 Ga0163162_10012961
468 Ga0163162_10228053
469 Ga0157375_10004447
470 Ga0157375_10048183
471 Ga0157375_10237490
472 Ga0163163_10026186
473 Ga0163163_10027424
474 Ga0163163_10074552
475 Ga0163163_10254898
476 Ga0163163_10406915
477 Ga0157380_10008051
478 Ga0157377_10009042
479 Ga0157376_10025792
480 Ga0157376_10075453
481 Ga0157376_10235087
482 Ga0163161_10003966
483 Ga0163161_10298803
484 Ga0207672_1000116
485 Ga0207697_10019062
486 Ga0207697_10083882
487 Ga0207710_10000001
488 Ga0207688_10125932
489 Ga0207647_10001939
490 Ga0207645_10001143
491 Ga0207643_10000274
492 Ga0207643_10007143
493 Ga0207707_10000003
494 Ga0207660_10012092
495 Ga0207662_10004734
496 Ga0207662_10121395
497 Ga0207657_10022160
498 Ga0207649_10015553
499 Ga0207652_10000111
500 Ga0207646_10000897
501 Ga0207646_10045521
502 Ga0207646_10234924
503 Ga0207681_10005433
504 Ga0207681_10014958
505 Ga0207681_10080529
506 Ga0207681_10183154
507 Ga0207694_10077257
508 Ga0207650_10038883
509 Ga0207650_10241972
510 Ga0207659_10005941
511 Ga0207659_10024155
512 Ga0207659_10204019
513 Ga0207687_10067943
514 Ga0207644_10002534
515 Ga0207706_10001283
516 Ga0207706_10036148
517 Ga0207706_10102869
518 Ga0207670_10023754
519 Ga0207669_10085196
520 Ga0207704_10075588
521 Ga0207704_10247777
522 Ga0207691_10001424
523 Ga0207691_10039645
524 Ga0207691_10112293
525 Ga0207691_10127144
526 Ga0207711_10012909
527 Ga0207689_10005943
528 Ga0207661_10000014
529 Ga0207661_10034441
530 Ga0207679_10005955
531 Ga0207679_10034539
532 Ga0207679_10272922
533 Ga0207667_10024452
534 Ga0207651_10024550
535 Ga0207651_10039237
536 Ga0207651_10153047
537 Ga0207712_10001486
538 Ga0207712_10136647
539 Ga0207668_10010617
540 Ga0207640_10029900
541 Ga0207658_10043189
542 Ga0207677_10011861
543 Ga0207677_10040576
544 Ga0207703_10000080
545 Ga0207703_10154812
546 Ga0207639_10047879
547 Ga0207639_10077980
548 Ga0207708_10029339
549 Ga0207708_10086142
550 Ga0207708_10111242
551 Ga0207708_10231880
552 Ga0207702_10015024
553 Ga0207641_10020856
554 Ga0207648_10095382
555 Ga0207676_10018290
556 Ga0207674_10010122
557 Ga0207674_10021816
558 Ga0207674_10070075
559 Ga0207675_100001718
560 Ga0207675_100031253
561 Ga0207683_10040584
562 Ga0207428_10001192
563 Ga0207428_10001571
564 Ga0268266_10177900
565 Ga0268265_10031637
566 Ga0268265_10075435
567 Ga0268265_10088413
568 Ga0268265_10182857
569 Ga0268264_10012914
570 Ga0268264_10076169
571 Ga0373923_0080933
572 Ga0373954_0043288
573 Ga0373935_0340523
574 Ga0373927_0003916
575 Ga0373937_0043117
576 Ga0373937_0330473
577 Ga0395900_0032118
578 Ga0395905_0004155
579 Ga0395901_0008231
580 Ga0242420_013938
581 Ga0453683_0163278
582 Ga0495651_0026523
583 Ga0495651_0034399
584 Ga0495653_0089022
585 Ga0495580_0034420
586 Ga0495664_0000501
587 Ga0495664_0189527
588 Ga0495608_0072193
589 Ga0495628_0012328
590 Ga0495652_0046068
591 Ga0495665_0097212
592 Ga0495665_0167643
593 Ga0495586_0049073
594 Ga0495587_0021378
595 Ga0495667_0016103
596 Ga0495667_0088094
597 Ga0495635_0143414
598 Ga0495657_0133742
599 Ga0495599_0010262
600 Ga0495646_0065227
601 Ga0495613_0081597
602 Ga0495604_0087590
603 Ga0495604_0259833
604 Ga0495674_0016307
605 Ga0495680_0116324
606 Ga0495675_0127827
607 Ga0495684_0002980
608 Ga0495602_0004645
609 Ga0495602_0084197
610 Ga0496109_0000017
611 Ga0496109_0172112
612 Ga0496110_0433615
613 Ga0501038_0207760
614 Ga0501039_0119927
615 Ga0501040_0070456
616 Ga0501040_0175832
617 Ga0501046_0157543
618 Ga0501048_0027835
619 Ga0501072_0062489
620 Ga0501074_0073553
621 Ga0501075_0034722
622 Ga0501076_0031512
623 Ga0501079_0020539
624 Ga0501079_0111582
625 Ga0501081_0040417
626 Ga0501045_0157882
627 nmdc:mga05p37_8151_c1
628 nmdc:mga06r32_66288_c1
629 nmdc:mga08y16_12690_c1
630 nmdc:mga08y16_31601_c1
631 nmdc:mga0n895_202022_c1
632 nmdc:mga0a205_76344_c1
633 Ga0500577_0008822
634 Ga0501082_0001403
635 Ga0501082_0017845
636 Ga0501082_0205661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

49

314

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.3697 40 252
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.3086 40 252
7zc2-assembly1.cif.gz_A dipeptide and tripeptide permease c (dtpc) 0.2739 5 266
7zc2-assembly1.cif.gz_A dipeptide and tripeptide permease c (dtpc) 0.2522 5 266
4cad-assembly2.cif.gz_F mechanism of farnesylated caax protein processing by the integral membrane protease rce1 0.2494 4 261
ID Description Score Start End Superfamily
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7955 35 252 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7704 35 252 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7569 39 252 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7498 36 252 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7089 40 252 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A538S5P7-F1-model_v4 ABC transporter permease 0.8856 3 262 GO:0005886
GO:0022857
AF-A0A831X197-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.8805 2 272 GO:0005886
GO:0022857
AF-A0A7T9GJ84-F1-model_v4 deleted 0.8763 12 262
AF-A0A831X197-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.8744 2 272 GO:0005886
GO:0022857
AF-A0A1C6FYB2-F1-model_v4 Ribose transport system permease protein rbsC 0.8717 3 264 GO:0005886
GO:0022857

Map