F404412

General Info

Members Datasets Scaffolds Average Seq Length
318 138 636 172

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1007724|JGI24746J21847_10077242
Length 175
Sequence MVRSALTPKSARLNKGPRTGAEYLPAATVIAGSMVALLPIVSATGWWPDWGLLMLIAWRLLRADAWPAWWAAPLGFVNDLILGSPIGLSVALWAAMMIAMDILDRRTQWRDYWIEWGIAALFIAIAELAQWRVAAMLGASMPLGVTAGPATVVGTLCFPGAAFLAARIDRWRLGR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
97 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
98 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
99 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
125 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
126 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
127 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
130 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
131 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
132 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
133 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
134 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
135 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 2.83
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 9.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007724 3300001977 Bacteria 1637
2 JGI24749J21850_1026979 3300002076 Archaea 820
3 JGI24751J29686_10040849 3300002459 Archaea 960
4 Ga0065715_10122261 3300005293 Bacteria 2202
5 Ga0070658_10099298 3300005327 Bacteria 2405
6 Ga0070676_10206938 3300005328 Unclassified 1289
7 Ga0070690_100731026 3300005330 Bacteria 762
8 Ga0070670_100010578 3300005331 Bacteria 7878
9 Ga0070670_100732684 3300005331 Bacteria 890
10 Ga0070670_100733829 3300005331 Bacteria 889
11 Ga0070670_100786259 3300005331 Bacteria 859
12 Ga0070677_10000387 3300005333 Bacteria 15436
13 Ga0070666_10445318 3300005335 Bacteria 935
14 Ga0070666_10549137 3300005335 Bacteria 840
15 Ga0070661_100203070 3300005344 Bacteria 1515
16 Ga0070668_100164084 3300005347 Bacteria 1804
17 Ga0070668_100341196 3300005347 Bacteria 1266
18 Ga0070669_100001885 3300005353 Bacteria 15125
19 Ga0070675_100000759 3300005354 Bacteria 22530
20 Ga0070675_100377471 3300005354 Bacteria 1261
21 Ga0070671_100008608 3300005355 Bacteria 8180
22 Ga0070671_100025890 3300005355 Bacteria 4817
23 Ga0070671_100037831 3300005355 Bacteria 4004
24 Ga0070674_100067060 3300005356 Bacteria 2523
25 Ga0070673_100123790 3300005364 Bacteria 2161
26 Ga0070667_100028385 3300005367 Bacteria 4658
27 Ga0070667_101834960 3300005367 Bacteria 571
28 Ga0070701_10252803 3300005438 Unclassified 1065
29 Ga0070705_100025657 3300005440 Bacteria 3198
30 Ga0070678_100029049 3300005456 Bacteria 3782
31 Ga0070662_100003179 3300005457 Bacteria 10207
32 Ga0070681_10794834 3300005458 Unclassified 863
33 Ga0068867_100141503 3300005459 Bacteria 1881
34 Ga0070672_100035837 3300005543 Bacteria 3773
35 Ga0070672_101191905 3300005543 Bacteria 678
36 Ga0070686_100258001 3300005544 Unclassified 1276
37 Ga0070664_100519157 3300005564 Archaea 1099
38 Ga0068854_100332453 3300005578 Unclassified 1238
39 Ga0068859_100221990 3300005617 Bacteria 1977
40 Ga0068859_100284872 3300005617 Bacteria 1745
41 Ga0068859_102521205 3300005617 Unclassified 566
42 Ga0068864_100343457 3300005618 Unclassified 1407
43 Ga0068864_100796233 3300005618 Bacteria 929
44 Ga0068866_10154756 3300005718 Unclassified 1331
45 Ga0068861_100083776 3300005719 Bacteria 2502
46 Ga0068870_10112329 3300005840 Archaea 1558
47 Ga0068863_100008298 3300005841 Bacteria 10151
48 Ga0068860_100483198 3300005843 Bacteria 1235
49 Ga0068862_100024450 3300005844 Bacteria 5070
50 Ga0068862_100055402 3300005844 Bacteria 3396
51 Ga0068862_100216162 3300005844 Bacteria 1734
52 Ga0075362_10327320 3300006177 Bacteria 764
53 Ga0068865_100477908 3300006881 Bacteria 1035
54 Ga0097620_100221995 3300006931 Bacteria 1977
55 Ga0097620_102520913 3300006931 Unclassified 566
56 Ga0111539_11481245 3300009094 Bacteria 787
57 Ga0105248_10036731 3300009177 Bacteria 5478
58 Ga0105248_10256458 3300009177 Bacteria 1969
59 Ga0105249_10004822 3300009553 Bacteria 11640
60 Ga0163162_10240173 3300013306 Bacteria 1943
61 Ga0163162_10627119 3300013306 Bacteria 1200
62 Ga0157375_10029327 3300013308 Bacteria 5172
63 Ga0157380_10043018 3300014326 Bacteria 3534
64 Ga0157380_10055233 3300014326 Bacteria 3153
65 Ga0157380_10105128 3300014326 Bacteria 2360
66 Ga0163161_10198027 3300017792 Bacteria 1547
67 Ga0207697_10002046 3300025315 Bacteria 10637
68 Ga0207682_10000531 3300025893 Bacteria 17503
69 Ga0207642_10341466 3300025899 Bacteria 880
70 Ga0207688_10769695 3300025901 Bacteria 610
71 Ga0207645_10027398 3300025907 Bacteria 3680
72 Ga0207643_10127881 3300025908 Archaea 1509
73 Ga0207662_10392196 3300025918 Archaea 940
74 Ga0207681_10093272 3300025923 Bacteria 2154
75 Ga0207650_10025596 3300025925 Bacteria 4204
76 Ga0207650_10575501 3300025925 Bacteria 945
77 Ga0207659_10192825 3300025926 Unclassified 1622
78 Ga0207659_10906633 3300025926 Bacteria 758
79 Ga0207644_10012002 3300025931 Bacteria 5745
80 Ga0207644_10040142 3300025931 Bacteria 3307
81 Ga0207644_10074120 3300025931 Bacteria 2497
82 Ga0207644_10585016 3300025931 Bacteria 926
83 Ga0207706_10002907 3300025933 Bacteria 16556
84 Ga0207669_10042354 3300025937 Bacteria 2657
85 Ga0207704_10941884 3300025938 Archaea 728
86 Ga0207691_10001856 3300025940 Bacteria 20649
87 Ga0207711_10027931 3300025941 Bacteria 4743
88 Ga0207711_10080073 3300025941 Bacteria 2852
89 Ga0207679_10384463 3300025945 Unclassified 1231
90 Ga0207651_10000378 3300025960 Bacteria 18962
91 Ga0207712_10008722 3300025961 Bacteria 6413
92 Ga0207668_10023641 3300025972 Bacteria 3954
93 Ga0207668_10098913 3300025972 Bacteria 2162
94 Ga0207668_10607658 3300025972 Bacteria 953
95 Ga0207640_10179887 3300025981 Unclassified 1584
96 Ga0207658_10035023 3300025986 Bacteria 3593
97 Ga0207658_10241431 3300025986 Bacteria 1531
98 Ga0207639_10973934 3300026041 Archaea 794
99 Ga0207678_10006948 3300026067 Bacteria 10046
100 Ga0207641_10379978 3300026088 Bacteria 1352
101 Ga0207648_10123770 3300026089 Bacteria 2274
102 Ga0207648_10197370 3300026089 Bacteria 1784
103 Ga0207676_10042385 3300026095 Bacteria 3501
104 Ga0207676_10151261 3300026095 Bacteria 1999
105 Ga0207676_10783745 3300026095 Bacteria 929
106 Ga0207675_100125598 3300026118 Bacteria 2430
107 Ga0207683_10009649 3300026121 Bacteria 8227
108 Ga0209974_10121806 3300027876 Bacteria 925
109 Ga0268265_10016308 3300028380 Bacteria 5100
110 Ga0268265_10018314 3300028380 Bacteria 4851
111 Ga0268264_10197993 3300028381 Bacteria 1836
112 Ga0268264_10233211 3300028381 Bacteria 1701
113 Ga0307408_100019917 3300031548 Bacteria 4520
114 Ga0307408_100070845 3300031548 Bacteria 2575
115 Ga0307408_100133748 3300031548 Bacteria 1938
116 Ga0307408_100169950 3300031548 Bacteria 1740
117 Ga0307408_101268923 3300031548 Unclassified 689
118 Ga0307405_10001153 3300031731 Bacteria 10864
119 Ga0307405_10007132 3300031731 Bacteria 5557
120 Ga0307405_10022560 3300031731 Bacteria 3561
121 Ga0307405_10050221 3300031731 Bacteria 2582
122 Ga0307405_10059571 3300031731 Bacteria 2407
123 Ga0307405_10108579 3300031731 Bacteria 1875
124 Ga0307405_10144855 3300031731 Bacteria 1662
125 Ga0307405_10332773 3300031731 Bacteria 1164
126 Ga0307413_10013649 3300031824 Bacteria 4093
127 Ga0307413_10055022 3300031824 Bacteria 2418
128 Ga0307413_10079507 3300031824 Bacteria 2096
129 Ga0307413_10108263 3300031824 Bacteria 1854
130 Ga0307413_10209872 3300031824 Bacteria 1413
131 Ga0307413_10217651 3300031824 Unclassified 1392
132 Ga0307413_10226055 3300031824 Bacteria 1370
133 Ga0307413_10372710 3300031824 Bacteria 1109
134 Ga0307413_10438850 3300031824 Bacteria 1033
135 Ga0307413_10545209 3300031824 Archaea 940
136 Ga0307410_10000582 3300031852 Bacteria 15008
137 Ga0307410_10005129 3300031852 Bacteria 6885
138 Ga0307410_10008742 3300031852 Bacteria 5636
139 Ga0307410_10045010 3300031852 Bacteria 2935
140 Ga0307410_10046399 3300031852 Bacteria 2898
141 Ga0307410_10051606 3300031852 Bacteria 2773
142 Ga0307410_10097692 3300031852 Bacteria 2099
143 Ga0307410_10109499 3300031852 Bacteria 1996
144 Ga0307410_10158514 3300031852 Bacteria 1693
145 Ga0307410_10251459 3300031852 Bacteria 1374
146 Ga0307410_10377083 3300031852 Bacteria 1140
147 Ga0307410_10385762 3300031852 Bacteria 1128
148 Ga0307410_10472580 3300031852 Bacteria 1027
149 Ga0307410_10604975 3300031852 Bacteria 915
150 Ga0307410_11241298 3300031852 Bacteria 650
151 Ga0307406_10009132 3300031901 Bacteria 5551
152 Ga0307406_10039921 3300031901 Bacteria 2915
153 Ga0307406_10058656 3300031901 Bacteria 2474
154 Ga0307406_10064605 3300031901 Bacteria 2376
155 Ga0307406_10098590 3300031901 Bacteria 1984
156 Ga0307406_10298984 3300031901 Bacteria 1236
157 Ga0307406_10327067 3300031901 Unclassified 1188
158 Ga0307407_10008336 3300031903 Bacteria 4750
159 Ga0307407_10011357 3300031903 Bacteria 4236
160 Ga0307407_10013061 3300031903 Bacteria 4017
161 Ga0307407_10020811 3300031903 Bacteria 3369
162 Ga0307407_10055236 3300031903 Bacteria 2294
163 Ga0307407_10153624 3300031903 Bacteria 1498
164 Ga0307407_10298823 3300031903 Unclassified 1122
165 Ga0307407_10343918 3300031903 Bacteria 1054
166 Ga0307407_10648834 3300031903 Bacteria 790
167 Ga0307407_11166919 3300031903 Bacteria 601
168 Ga0307412_10018140 3300031911 Bacteria 4227
169 Ga0307412_10025732 3300031911 Bacteria 3648
170 Ga0307412_10027050 3300031911 Bacteria 3572
171 Ga0307412_10031802 3300031911 Bacteria 3336
172 Ga0307412_10057234 3300031911 Bacteria 2602
173 Ga0307412_10074633 3300031911 Bacteria 2324
174 Ga0307412_10137974 3300031911 Bacteria 1782
175 Ga0307412_10153965 3300031911 Bacteria 1700
176 Ga0307412_10218274 3300031911 Bacteria 1460
177 Ga0307412_10298978 3300031911 Bacteria 1271
178 Ga0307412_10925980 3300031911 Bacteria 765
179 Ga0307412_11227934 3300031911 Bacteria 672
180 Ga0307409_100020159 3300031995 Bacteria 4537
181 Ga0307409_100033268 3300031995 Bacteria 3750
182 Ga0307409_100040653 3300031995 Bacteria 3464
183 Ga0307409_100046734 3300031995 Bacteria 3279
184 Ga0307409_100070821 3300031995 Bacteria 2769
185 Ga0307409_100088392 3300031995 Bacteria 2529
186 Ga0307409_100129162 3300031995 Bacteria 2156
187 Ga0307409_100174313 3300031995 Bacteria 1896
188 Ga0307409_100188168 3300031995 Bacteria 1835
189 Ga0307409_100257131 3300031995 Bacteria 1600
190 Ga0307409_100315284 3300031995 Bacteria 1461
191 Ga0307409_100343560 3300031995 Bacteria 1405
192 Ga0307409_100376192 3300031995 Bacteria 1349
193 Ga0307409_100406116 3300031995 Unclassified 1302
194 Ga0307409_100551816 3300031995 Bacteria 1131
195 Ga0307409_100855373 3300031995 Bacteria 920
196 Ga0307409_100891080 3300031995 Bacteria 903
197 Ga0307416_100001945 3300032002 Bacteria 11564
198 Ga0307416_100003309 3300032002 Bacteria 9424
199 Ga0307416_100086161 3300032002 Bacteria 2676
200 Ga0307416_100090084 3300032002 Bacteria 2629
201 Ga0307416_100107817 3300032002 Bacteria 2446
202 Ga0307416_100158675 3300032002 Bacteria 2087
203 Ga0307416_100166659 3300032002 Bacteria 2044
204 Ga0307416_100172632 3300032002 Bacteria 2015
205 Ga0307416_100232518 3300032002 Bacteria 1778
206 Ga0307416_100322318 3300032002 Bacteria 1548
207 Ga0307416_100396189 3300032002 Bacteria 1416
208 Ga0307416_100539576 3300032002 Bacteria 1238
209 Ga0307416_101809149 3300032002 Bacteria 715
210 Ga0307414_10014930 3300032004 Bacteria 4675
211 Ga0307414_10033926 3300032004 Bacteria 3378
212 Ga0307414_10049589 3300032004 Bacteria 2904
213 Ga0307414_10081554 3300032004 Bacteria 2369
214 Ga0307414_10086598 3300032004 Bacteria 2312
215 Ga0307414_10114563 3300032004 Bacteria 2060
216 Ga0307414_10121314 3300032004 Bacteria 2010
217 Ga0307414_10127105 3300032004 Bacteria 1971
218 Ga0307414_10173800 3300032004 Bacteria 1725
219 Ga0307414_10373604 3300032004 Bacteria 1230
220 Ga0307414_10528960 3300032004 Unclassified 1047
221 Ga0307414_11578160 3300032004 Bacteria 611
222 Ga0307411_10012078 3300032005 Bacteria 4692
223 Ga0307411_10014259 3300032005 Bacteria 4415
224 Ga0307411_10018440 3300032005 Bacteria 4003
225 Ga0307411_10019120 3300032005 Bacteria 3948
226 Ga0307411_10031528 3300032005 Bacteria 3263
227 Ga0307411_10045611 3300032005 Bacteria 2820
228 Ga0307411_10079098 3300032005 Bacteria 2256
229 Ga0307411_10096629 3300032005 Bacteria 2077
230 Ga0307411_10097663 3300032005 Bacteria 2068
231 Ga0307411_10116995 3300032005 Bacteria 1920
232 Ga0307411_10169151 3300032005 Bacteria 1646
233 Ga0307411_10187906 3300032005 Bacteria 1574
234 Ga0307411_10193357 3300032005 Bacteria 1555
235 Ga0307411_10220445 3300032005 Bacteria 1471
236 Ga0307411_10256448 3300032005 Unclassified 1378
237 Ga0307411_10282804 3300032005 Bacteria 1321
238 Ga0307411_10344978 3300032005 Bacteria 1211
239 Ga0307411_10475488 3300032005 Bacteria 1051
240 Ga0307411_10688756 3300032005 Bacteria 889
241 Ga0307415_100001816 3300032126 Bacteria 10457
242 Ga0307415_100001952 3300032126 Bacteria 10151
243 Ga0307415_100002407 3300032126 Bacteria 9327
244 Ga0307415_100031164 3300032126 Bacteria 3431
245 Ga0307415_100045298 3300032126 Bacteria 2948
246 Ga0307415_100075345 3300032126 Bacteria 2388
247 Ga0307415_100084161 3300032126 Bacteria 2281
248 Ga0307415_100094241 3300032126 Bacteria 2176
249 Ga0307415_100161808 3300032126 Bacteria 1736
250 Ga0307415_100210234 3300032126 Bacteria 1551
251 Ga0307415_100237489 3300032126 Bacteria 1472
252 Ga0307415_100387651 3300032126 Bacteria 1189
253 Ga0307415_100608550 3300032126 Bacteria 973
254 Ga0307415_100883039 3300032126 Unclassified 823
255 Ga0307415_100985960 3300032126 Unclassified 782
256 Ga0307415_101234723 3300032126 Bacteria 705
257 Ga0395899_0111061 3300037312 Bacteria 1971
258 Ga0395900_0000572 3300037418 Bacteria 50991
259 Ga0395898_0110888 3300037466 Bacteria 2630
260 Ga0395905_0000165 3300037471 Bacteria 109385
261 Ga0395905_0393138 3300037471 Bacteria 1281
262 Ga0395905_0416457 3300037471 Unclassified 1239
263 Ga0395905_0715249 3300037471 Bacteria 904
264 Ga0395901_0001927 3300038443 Bacteria 21367
265 Ga0395901_0923520 3300038443 Bacteria 853
266 Ga0439449_0307520 3300042007 Unclassified 599
267 Ga0439452_058087 3300042010 Bacteria 872
268 Ga0450898_011969 3300042134 Bacteria 1427
269 Ga0439464_0002429 3300042439 Bacteria 4582
270 Ga0439464_0022937 3300042439 Bacteria 1722
271 Ga0466965_0082362 3300044683 Bacteria 1628
272 Ga0466965_0459787 3300044683 Bacteria 710
273 Ga0466960_0177553 3300044901 Unclassified 1153
274 Ga0466960_0330066 3300044901 Bacteria 866
275 Ga0495584_0105340 3300046491 Bacteria 1426
276 Ga0495585_0183386 3300046492 Bacteria 1075
277 Ga0495620_0073560 3300046515 Bacteria 1393
278 Ga0495663_0022130 3300046525 Bacteria 1835
279 Ga0495642_0021704 3300046528 Bacteria 2527
280 Ga0495621_0001343 3300046539 Bacteria 6357
281 Ga0495621_0002902 3300046539 Bacteria 4671
282 Ga0495597_0153941 3300046542 Bacteria 942
283 Ga0495659_0022275 3300046664 Bacteria 2142
284 Ga0495669_0043787 3300046684 Bacteria 1993
285 Ga0495669_0094044 3300046684 Bacteria 1387
286 Ga0495670_0037330 3300046691 Bacteria 2421
287 Ga0495670_0137561 3300046691 Bacteria 1276
288 Ga0495670_0458220 3300046691 Unclassified 691
289 Ga0495636_0493129 3300047318 Unclassified 592
290 Ga0495677_0154496 3300047445 Unclassified 884
291 Ga0495677_0221554 3300047445 Bacteria 737
292 Ga0496100_0405824 3300048903 Bacteria 1039
293 Ga0496104_0639144 3300048907 Bacteria 973
294 Ga0496108_1041366 3300048911 Unclassified 697
295 Ga0496109_0076096 3300048912 Bacteria 3087
296 Ga0496109_0239529 3300048912 Bacteria 1707
297 Ga0496110_0035724 3300048913 Bacteria 4313
298 Ga0496111_0166145 3300048914 Bacteria 1639
299 Ga0496112_0083014 3300048915 Bacteria 3168
300 Ga0496114_0043778 3300048917 Bacteria 3712
301 Ga0501067_0111481 3300049583 Bacteria 1521
302 Ga0501068_0296345 3300049584 Bacteria 1035
303 Ga0501214_015430 3300049659 Bacteria 911
304 Ga0501233_022189 3300049668 Bacteria 1369
305 Ga0501235_038640 3300049669 Bacteria 1088
306 Ga0501249_024318 3300049679 Bacteria 1334
307 Ga0501257_030079 3300049686 Bacteria 1306
308 Ga0501259_045873 3300049688 Bacteria 874
309 Ga0501229_058326 3300049706 Bacteria 583
310 Ga0501267_009025 3300049764 Bacteria 991
311 Ga0501267_012533 3300049764 Bacteria 875
312 Ga0501268_014190 3300049765 Bacteria 1295
313 Ga0501271_046537 3300049768 Bacteria 578
314 Ga0501283_065676 3300049779 Bacteria 661
315 Ga0501212_007750 3300049851 Bacteria 1480
316 nmdc:mga07m45_567489_c1 3300050496 Unclassified 656
317 nmdc:mga08y16_1258710_c1 3300050511 Bacteria 708
318 2896430148 2896429255 Bacteria 2557483
319 JGI24746J21847_1007724
320 JGI24749J21850_1026979
321 JGI24751J29686_10040849
322 Ga0065715_10122261
323 Ga0070658_10099298
324 Ga0070676_10206938
325 Ga0070690_100731026
326 Ga0070670_100010578
327 Ga0070670_100732684
328 Ga0070670_100733829
329 Ga0070670_100786259
330 Ga0070677_10000387
331 Ga0070666_10445318
332 Ga0070666_10549137
333 Ga0070661_100203070
334 Ga0070668_100164084
335 Ga0070668_100341196
336 Ga0070669_100001885
337 Ga0070675_100000759
338 Ga0070675_100377471
339 Ga0070671_100008608
340 Ga0070671_100025890
341 Ga0070671_100037831
342 Ga0070674_100067060
343 Ga0070673_100123790
344 Ga0070667_100028385
345 Ga0070667_101834960
346 Ga0070701_10252803
347 Ga0070705_100025657
348 Ga0070678_100029049
349 Ga0070662_100003179
350 Ga0070681_10794834
351 Ga0068867_100141503
352 Ga0070672_100035837
353 Ga0070672_101191905
354 Ga0070686_100258001
355 Ga0070664_100519157
356 Ga0068854_100332453
357 Ga0068859_100221990
358 Ga0068859_100284872
359 Ga0068859_102521205
360 Ga0068864_100343457
361 Ga0068864_100796233
362 Ga0068866_10154756
363 Ga0068861_100083776
364 Ga0068870_10112329
365 Ga0068863_100008298
366 Ga0068860_100483198
367 Ga0068862_100024450
368 Ga0068862_100055402
369 Ga0068862_100216162
370 Ga0075362_10327320
371 Ga0068865_100477908
372 Ga0097620_100221995
373 Ga0097620_102520913
374 Ga0111539_11481245
375 Ga0105248_10036731
376 Ga0105248_10256458
377 Ga0105249_10004822
378 Ga0163162_10240173
379 Ga0163162_10627119
380 Ga0157375_10029327
381 Ga0157380_10043018
382 Ga0157380_10055233
383 Ga0157380_10105128
384 Ga0163161_10198027
385 Ga0207697_10002046
386 Ga0207682_10000531
387 Ga0207642_10341466
388 Ga0207688_10769695
389 Ga0207645_10027398
390 Ga0207643_10127881
391 Ga0207662_10392196
392 Ga0207681_10093272
393 Ga0207650_10025596
394 Ga0207650_10575501
395 Ga0207659_10192825
396 Ga0207659_10906633
397 Ga0207644_10012002
398 Ga0207644_10040142
399 Ga0207644_10074120
400 Ga0207644_10585016
401 Ga0207706_10002907
402 Ga0207669_10042354
403 Ga0207704_10941884
404 Ga0207691_10001856
405 Ga0207711_10027931
406 Ga0207711_10080073
407 Ga0207679_10384463
408 Ga0207651_10000378
409 Ga0207712_10008722
410 Ga0207668_10023641
411 Ga0207668_10098913
412 Ga0207668_10607658
413 Ga0207640_10179887
414 Ga0207658_10035023
415 Ga0207658_10241431
416 Ga0207639_10973934
417 Ga0207678_10006948
418 Ga0207641_10379978
419 Ga0207648_10123770
420 Ga0207648_10197370
421 Ga0207676_10042385
422 Ga0207676_10151261
423 Ga0207676_10783745
424 Ga0207675_100125598
425 Ga0207683_10009649
426 Ga0209974_10121806
427 Ga0268265_10016308
428 Ga0268265_10018314
429 Ga0268264_10197993
430 Ga0268264_10233211
431 Ga0307408_100019917
432 Ga0307408_100070845
433 Ga0307408_100133748
434 Ga0307408_100169950
435 Ga0307408_101268923
436 Ga0307405_10001153
437 Ga0307405_10007132
438 Ga0307405_10022560
439 Ga0307405_10050221
440 Ga0307405_10059571
441 Ga0307405_10108579
442 Ga0307405_10144855
443 Ga0307405_10332773
444 Ga0307413_10013649
445 Ga0307413_10055022
446 Ga0307413_10079507
447 Ga0307413_10108263
448 Ga0307413_10209872
449 Ga0307413_10217651
450 Ga0307413_10226055
451 Ga0307413_10372710
452 Ga0307413_10438850
453 Ga0307413_10545209
454 Ga0307410_10000582
455 Ga0307410_10005129
456 Ga0307410_10008742
457 Ga0307410_10045010
458 Ga0307410_10046399
459 Ga0307410_10051606
460 Ga0307410_10097692
461 Ga0307410_10109499
462 Ga0307410_10158514
463 Ga0307410_10251459
464 Ga0307410_10377083
465 Ga0307410_10385762
466 Ga0307410_10472580
467 Ga0307410_10604975
468 Ga0307410_11241298
469 Ga0307406_10009132
470 Ga0307406_10039921
471 Ga0307406_10058656
472 Ga0307406_10064605
473 Ga0307406_10098590
474 Ga0307406_10298984
475 Ga0307406_10327067
476 Ga0307407_10008336
477 Ga0307407_10011357
478 Ga0307407_10013061
479 Ga0307407_10020811
480 Ga0307407_10055236
481 Ga0307407_10153624
482 Ga0307407_10298823
483 Ga0307407_10343918
484 Ga0307407_10648834
485 Ga0307407_11166919
486 Ga0307412_10018140
487 Ga0307412_10025732
488 Ga0307412_10027050
489 Ga0307412_10031802
490 Ga0307412_10057234
491 Ga0307412_10074633
492 Ga0307412_10137974
493 Ga0307412_10153965
494 Ga0307412_10218274
495 Ga0307412_10298978
496 Ga0307412_10925980
497 Ga0307412_11227934
498 Ga0307409_100020159
499 Ga0307409_100033268
500 Ga0307409_100040653
501 Ga0307409_100046734
502 Ga0307409_100070821
503 Ga0307409_100088392
504 Ga0307409_100129162
505 Ga0307409_100174313
506 Ga0307409_100188168
507 Ga0307409_100257131
508 Ga0307409_100315284
509 Ga0307409_100343560
510 Ga0307409_100376192
511 Ga0307409_100406116
512 Ga0307409_100551816
513 Ga0307409_100855373
514 Ga0307409_100891080
515 Ga0307416_100001945
516 Ga0307416_100003309
517 Ga0307416_100086161
518 Ga0307416_100090084
519 Ga0307416_100107817
520 Ga0307416_100158675
521 Ga0307416_100166659
522 Ga0307416_100172632
523 Ga0307416_100232518
524 Ga0307416_100322318
525 Ga0307416_100396189
526 Ga0307416_100539576
527 Ga0307416_101809149
528 Ga0307414_10014930
529 Ga0307414_10033926
530 Ga0307414_10049589
531 Ga0307414_10081554
532 Ga0307414_10086598
533 Ga0307414_10114563
534 Ga0307414_10121314
535 Ga0307414_10127105
536 Ga0307414_10173800
537 Ga0307414_10373604
538 Ga0307414_10528960
539 Ga0307414_11578160
540 Ga0307411_10012078
541 Ga0307411_10014259
542 Ga0307411_10018440
543 Ga0307411_10019120
544 Ga0307411_10031528
545 Ga0307411_10045611
546 Ga0307411_10079098
547 Ga0307411_10096629
548 Ga0307411_10097663
549 Ga0307411_10116995
550 Ga0307411_10169151
551 Ga0307411_10187906
552 Ga0307411_10193357
553 Ga0307411_10220445
554 Ga0307411_10256448
555 Ga0307411_10282804
556 Ga0307411_10344978
557 Ga0307411_10475488
558 Ga0307411_10688756
559 Ga0307415_100001816
560 Ga0307415_100001952
561 Ga0307415_100002407
562 Ga0307415_100031164
563 Ga0307415_100045298
564 Ga0307415_100075345
565 Ga0307415_100084161
566 Ga0307415_100094241
567 Ga0307415_100161808
568 Ga0307415_100210234
569 Ga0307415_100237489
570 Ga0307415_100387651
571 Ga0307415_100608550
572 Ga0307415_100883039
573 Ga0307415_100985960
574 Ga0307415_101234723
575 Ga0395899_0111061
576 Ga0395900_0000572
577 Ga0395898_0110888
578 Ga0395905_0000165
579 Ga0395905_0393138
580 Ga0395905_0416457
581 Ga0395905_0715249
582 Ga0395901_0001927
583 Ga0395901_0923520
584 Ga0439449_0307520
585 Ga0439452_058087
586 Ga0450898_011969
587 Ga0439464_0002429
588 Ga0439464_0022937
589 Ga0466965_0082362
590 Ga0466965_0459787
591 Ga0466960_0177553
592 Ga0466960_0330066
593 Ga0495584_0105340
594 Ga0495585_0183386
595 Ga0495620_0073560
596 Ga0495663_0022130
597 Ga0495642_0021704
598 Ga0495621_0001343
599 Ga0495621_0002902
600 Ga0495597_0153941
601 Ga0495659_0022275
602 Ga0495669_0043787
603 Ga0495669_0094044
604 Ga0495670_0037330
605 Ga0495670_0137561
606 Ga0495670_0458220
607 Ga0495636_0493129
608 Ga0495677_0154496
609 Ga0495677_0221554
610 Ga0496100_0405824
611 Ga0496104_0639144
612 Ga0496108_1041366
613 Ga0496109_0076096
614 Ga0496109_0239529
615 Ga0496110_0035724
616 Ga0496111_0166145
617 Ga0496112_0083014
618 Ga0496114_0043778
619 Ga0501067_0111481
620 Ga0501068_0296345
621 Ga0501214_015430
622 Ga0501233_022189
623 Ga0501235_038640
624 Ga0501249_024318
625 Ga0501257_030079
626 Ga0501259_045873
627 Ga0501229_058326
628 Ga0501267_009025
629 Ga0501267_012533
630 Ga0501268_014190
631 Ga0501271_046537
632 Ga0501283_065676
633 Ga0501212_007750
634 nmdc:mga07m45_567489_c1
635 nmdc:mga08y16_1258710_c1
636 2896430148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

24

141

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5753 22 170
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.5693 22 170
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.5665 24 173
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.5479 13 170
4z7f-assembly1.cif.gz_A crystal structure of folt bound with folic acid 0.5369 19 168
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8123 18 167 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7985 18 167 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7662 24 170 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6908 24 170 1.10.1760.20
af_Q2FZ00_2_162_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5985 22 170 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A519QXW1-F1-model_v4 Rod shape-determining protein MreD 0.9534 23 172 GO:0005886
GO:0008360
AF-G6EJ85-F1-model_v4 Rod shape-determining protein MreD 0.9531 23 173 GO:0016020
AF-A0A5D0X3J4-F1-model_v4 Rod shape-determining protein MreD 0.9525 22 174 GO:0005886
GO:0008360
AF-A0A2W6SCP0-F1-model_v4 Rod shape-determining protein MreD 0.9492 24 174 GO:0005886
GO:0008360
AF-I9WBH3-F1-model_v4 Rod shape-determining protein MreD 0.9492 23 172 GO:0016020

Map