F404317

General Info

Members Datasets Scaffolds Average Seq Length
317 188 634 251

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0039927|Ga0496112_0039927_1213_2058
Length 281
Sequence VITVGARLDLPDNFPLDLDVIATDFDRTLVWEDGTLRPRTLQALHDARDAGLHVIVVTGRMVQSVRRFLEPAELNEPVICYQGAVVADADGKWLRHEPIPLALALEALAALKEEGYDPNVYIDDELYVSDLTQAARDYADFQHLTIHEVGDTLEWLSAPPTKLVAVGDPKALDGVEARMKATFAGRLYISKSLPYFLEFAQAGVTKGAGLDFLSQHMSFTKERTVAFGDGENDVELVEWPAYGVAVENAHARVKAVADWVCPSAAEEGVAQVIEALLDSKR

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 1.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.15
Rhizosphere 90.22
Stem 0
Stem Tuber 0
Unclassified 12.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0039927 3300048915 Bacteria 4587
2 Ga0070658_10050110 3300005327 Bacteria 3384
3 Ga0070680_100013057 3300005336 Bacteria 6465
4 Ga0070680_100085644 3300005336 Bacteria 2604
5 Ga0070680_100193227 3300005336 Bacteria 1715
6 Ga0070680_100367416 3300005336 Unclassified 1224
7 Ga0070682_100228581 3300005337 Unclassified 1328
8 Ga0070660_100003610 3300005339 Bacteria 10692
9 Ga0070660_100127533 3300005339 Unclassified 2034
10 Ga0070691_10043039 3300005341 Bacteria 2138
11 Ga0070671_100005697 3300005355 Bacteria 9923
12 Ga0070714_100183417 3300005435 Bacteria 1906
13 Ga0070713_100026442 3300005436 Bacteria 4556
14 Ga0070713_100504407 3300005436 Bacteria 1142
15 Ga0070700_100124535 3300005441 Unclassified 1731
16 Ga0070708_100037220 3300005445 Bacteria 4244
17 Ga0070708_100356217 3300005445 Unclassified 1379
18 Ga0070662_100149312 3300005457 Bacteria 1818
19 Ga0070681_10021771 3300005458 Bacteria 6429
20 Ga0068867_100522640 3300005459 Bacteria 1023
21 Ga0070707_100023557 3300005468 Bacteria 5822
22 Ga0070707_100183694 3300005468 Unclassified 2039
23 Ga0070707_100238348 3300005468 Bacteria 1771
24 Ga0070698_100047104 3300005471 Bacteria 4407
25 Ga0070698_100062771 3300005471 Bacteria 3747
26 Ga0070699_100056246 3300005518 Bacteria 3406
27 Ga0070679_100007403 3300005530 Bacteria 10259
28 Ga0070679_100034245 3300005530 Bacteria 5033
29 Ga0070679_100533413 3300005530 Unclassified 1117
30 Ga0070684_100120015 3300005535 Bacteria 2365
31 Ga0070704_100133327 3300005549 Bacteria 1929
32 Ga0070704_100149379 3300005549 Unclassified 1835
33 Ga0068855_100302656 3300005563 Bacteria 1770
34 Ga0068855_100654542 3300005563 Bacteria 1128
35 Ga0068857_100004208 3300005577 Bacteria 12121
36 Ga0068857_100676742 3300005577 Bacteria 979
37 Ga0070702_100223653 3300005615 Bacteria 1260
38 Ga0070702_100247927 3300005615 Unclassified 1205
39 Ga0068852_100306381 3300005616 Bacteria 1539
40 Ga0068864_100386399 3300005618 Unclassified 1328
41 Ga0068861_100043721 3300005719 Bacteria 3364
42 Ga0068861_100678968 3300005719 Bacteria 955
43 Ga0068863_100246721 3300005841 Unclassified 1724
44 Ga0068858_100530902 3300005842 Unclassified 1138
45 Ga0068862_100401187 3300005844 Unclassified 1283
46 Ga0081455_10011558 3300005937 Bacteria 8860
47 Ga0081455_10025889 3300005937 Bacteria 5406
48 Ga0081455_10051045 3300005937 Bacteria 3550
49 Ga0081455_10114119 3300005937 Bacteria 2141
50 Ga0070717_10004804 3300006028 Bacteria 9829
51 Ga0070717_10009913 3300006028 Bacteria 7169
52 Ga0070717_10074124 3300006028 Bacteria 2845
53 Ga0070712_100103858 3300006175 Bacteria 2108
54 Ga0070712_100105452 3300006175 Bacteria 2093
55 Ga0075428_100040412 3300006844 Bacteria 5132
56 Ga0075433_10088581 3300006852 Bacteria 2735
57 Ga0075433_10286794 3300006852 Bacteria 1458
58 Ga0075434_100058612 3300006871 Bacteria 3827
59 Ga0075434_100076677 3300006871 Bacteria 3338
60 Ga0075434_100611081 3300006871 Unclassified 1109
61 Ga0075435_100000425 3300007076 Bacteria 25950
62 Ga0105240_10065570 3300009093 Bacteria 4507
63 Ga0111539_10011439 3300009094 Bacteria 11138
64 Ga0105245_10016596 3300009098 Bacteria 6426
65 Ga0105245_10077882 3300009098 Bacteria 3024
66 Ga0105245_10086830 3300009098 Bacteria 2870
67 Ga0105243_10034160 3300009148 Bacteria 3935
68 Ga0105243_10111986 3300009148 Bacteria 2285
69 Ga0105243_10193419 3300009148 Bacteria 1778
70 Ga0105243_10321026 3300009148 Bacteria 1411
71 Ga0105242_10071310 3300009176 Bacteria 2883
72 Ga0105249_10018144 3300009553 Bacteria 6255
73 Ga0105249_10249376 3300009553 Bacteria 1759
74 Ga0105249_10326963 3300009553 Bacteria 1546
75 Ga0105239_10097690 3300010375 Bacteria 3246
76 Ga0105239_10694819 3300010375 Bacteria 1163
77 Ga0105246_10033421 3300011119 Bacteria 3419
78 Ga0157369_10041482 3300013105 Bacteria 5024
79 Ga0157374_10155849 3300013296 Bacteria 2223
80 Ga0157378_10128822 3300013297 Unclassified 2340
81 Ga0163162_10030881 3300013306 Bacteria 5310
82 Ga0157372_10153021 3300013307 Bacteria 2663
83 Ga0157372_10328344 3300013307 Bacteria 1781
84 Ga0157372_10449157 3300013307 Unclassified 1502
85 Ga0157380_10022219 3300014326 Bacteria 4771
86 Ga0157377_10012892 3300014745 Unclassified 4215
87 Ga0157377_10300199 3300014745 Bacteria 1060
88 Ga0157376_10128180 3300014969 Bacteria 2260
89 Ga0206356_11550448 3300020070 Bacteria 2679
90 Ga0206354_10836211 3300020081 Bacteria 9146
91 Ga0206353_10055291 3300020082 Bacteria 1897
92 Ga0206353_11280148 3300020082 Bacteria 2817
93 Ga0206353_11397641 3300020082 Bacteria 1131
94 Ga0206353_12063208 3300020082 Bacteria 6359
95 Ga0207642_10003064 3300025899 Bacteria 5237
96 Ga0207688_10022313 3300025901 Bacteria 3463
97 Ga0207705_10015347 3300025909 Bacteria 5495
98 Ga0207705_10057883 3300025909 Bacteria 2796
99 Ga0207684_10044441 3300025910 Bacteria 3767
100 Ga0207654_10051284 3300025911 Unclassified 2374
101 Ga0207707_10120443 3300025912 Bacteria 2294
102 Ga0207693_10001250 3300025915 Bacteria 22628
103 Ga0207693_10002660 3300025915 Bacteria 15522
104 Ga0207693_10003465 3300025915 Bacteria 13466
105 Ga0207693_10280283 3300025915 Bacteria 1306
106 Ga0207663_10066552 3300025916 Bacteria 2307
107 Ga0207660_10049573 3300025917 Bacteria 2978
108 Ga0207660_10070789 3300025917 Bacteria 2536
109 Ga0207660_10072061 3300025917 Bacteria 2515
110 Ga0207662_10005385 3300025918 Bacteria 6816
111 Ga0207657_10002431 3300025919 Bacteria 20110
112 Ga0207657_10012680 3300025919 Bacteria 8307
113 Ga0207657_10109327 3300025919 Bacteria 2285
114 Ga0207657_10110452 3300025919 Unclassified 2271
115 Ga0207652_10095434 3300025921 Bacteria 2620
116 Ga0207652_10127250 3300025921 Bacteria 2270
117 Ga0207646_10080232 3300025922 Bacteria 2917
118 Ga0207694_10162646 3300025924 Unclassified 1804
119 Ga0207687_10051408 3300025927 Bacteria 2873
120 Ga0207687_10060728 3300025927 Bacteria 2667
121 Ga0207700_10027281 3300025928 Bacteria 3997
122 Ga0207700_10102877 3300025928 Bacteria 2282
123 Ga0207664_10022510 3300025929 Bacteria 4708
124 Ga0207664_10146952 3300025929 Bacteria 2000
125 Ga0207644_10067610 3300025931 Unclassified 2605
126 Ga0207686_10025679 3300025934 Unclassified 3430
127 Ga0207669_10096298 3300025937 Bacteria 1942
128 Ga0207704_10477458 3300025938 Bacteria 1000
129 Ga0207665_10000620 3300025939 Bacteria 23807
130 Ga0207665_10114527 3300025939 Bacteria 1898
131 Ga0207661_10015609 3300025944 Bacteria 5594
132 Ga0207661_10021897 3300025944 Bacteria 4799
133 Ga0207661_10027417 3300025944 Bacteria 4351
134 Ga0207667_10088703 3300025949 Unclassified 3198
135 Ga0207667_10115846 3300025949 Bacteria 2762
136 Ga0207667_10615031 3300025949 Unclassified 1094
137 Ga0207651_10163911 3300025960 Unclassified 1746
138 Ga0207712_10138729 3300025961 Bacteria 1863
139 Ga0207712_10248767 3300025961 Bacteria 1436
140 Ga0207668_10028132 3300025972 Bacteria 3672
141 Ga0207677_10122348 3300026023 Bacteria 1960
142 Ga0207708_10014102 3300026075 Bacteria 5973
143 Ga0207702_10646298 3300026078 Bacteria 1040
144 Ga0207648_10002092 3300026089 Bacteria 21746
145 Ga0207676_10255091 3300026095 Unclassified 1581
146 Ga0207674_10004772 3300026116 Bacteria 16254
147 Ga0207675_100061808 3300026118 Bacteria 3497
148 Ga0207675_100604998 3300026118 Bacteria 1099
149 Ga0207683_10003272 3300026121 Bacteria 14117
150 Ga0207698_10240876 3300026142 Bacteria 1648
151 Ga0209998_10007522 3300027717 Bacteria 2260
152 Ga0207428_10065051 3300027907 Bacteria 2878
153 Ga0207428_10444556 3300027907 Unclassified 946
154 Ga0268265_10105387 3300028380 Unclassified 2288
155 Ga0268265_10589156 3300028380 Bacteria 1061
156 Ga0265319_1015457 3300028563 Bacteria 2959
157 Ga0265318_10001232 3300028577 Bacteria 15562
158 Ga0265322_10003108 3300028654 Bacteria 5057
159 Ga0265322_10006101 3300028654 Bacteria 3551
160 Ga0265322_10070499 3300028654 Unclassified 991
161 Ga0265338_10002043 3300028800 Bacteria 31202
162 Ga0265338_10009388 3300028800 Bacteria 11676
163 Ga0265338_10012558 3300028800 Bacteria 9649
164 Ga0265338_10037666 3300028800 Bacteria 4597
165 Ga0265324_10015591 3300029957 Bacteria 2791
166 Ga0265330_10000741 3300031235 Bacteria 20624
167 Ga0265332_10003115 3300031238 Bacteria 8082
168 Ga0265325_10002787 3300031241 Bacteria 11670
169 Ga0265329_10003397 3300031242 Bacteria 6946
170 Ga0265329_10010356 3300031242 Bacteria 3428
171 Ga0265340_10006981 3300031247 Bacteria 6164
172 Ga0265339_10025811 3300031249 Bacteria 3368
173 Ga0265331_10025493 3300031250 Bacteria 2984
174 Ga0265327_10042028 3300031251 Bacteria 2457
175 Ga0265316_10005340 3300031344 Bacteria 12519
176 Ga0265316_10216165 3300031344 Bacteria 1416
177 Ga0265313_10009549 3300031595 Bacteria 6279
178 Ga0265313_10016149 3300031595 Bacteria 4306
179 Ga0265313_10023412 3300031595 Bacteria 3326
180 Ga0265314_10016400 3300031711 Bacteria 5852
181 Ga0265342_10007955 3300031712 Bacteria 7680
182 Ga0373961_0071168 3300035241 Unclassified 1076
183 Ga0373935_0030796 3300035692 Bacteria 3326
184 Ga0373933_0126377 3300035724 Bacteria 1605
185 Ga0373937_0036551 3300036401 Bacteria 4476
186 Ga0395899_0059200 3300037312 Bacteria 2823
187 Ga0395899_0098414 3300037312 Bacteria 2113
188 Ga0395900_0072461 3300037418 Bacteria 3541
189 Ga0395900_0091944 3300037418 Bacteria 3117
190 Ga0395900_0132143 3300037418 Bacteria 2558
191 Ga0395900_0169308 3300037418 Bacteria 2225
192 Ga0395898_0105973 3300037466 Bacteria 2696
193 Ga0395898_0395722 3300037466 Bacteria 1317
194 Ga0395905_0063764 3300037471 Bacteria 3448
195 Ga0395905_0070273 3300037471 Bacteria 3280
196 Ga0395905_0224141 3300037471 Bacteria 1759
197 Ga0395905_0312552 3300037471 Bacteria 1460
198 Ga0395905_0375899 3300037471 Bacteria 1314
199 Ga0395901_0003265 3300038443 Bacteria 16325
200 Ga0395901_0032943 3300038443 Bacteria 5346
201 Ga0395901_0099842 3300038443 Bacteria 3044
202 Ga0395901_0278195 3300038443 Unclassified 1739
203 Ga0395901_0531549 3300038443 Bacteria 1193
204 Ga0436365_0799603 3300039437 Bacteria 4200
205 Ga0436363_1393263 3300039450 Bacteria 1363
206 Ga0466963_0006197 3300044694 Bacteria 7064
207 Ga0466970_0028857 3300044765 Bacteria 2918
208 Ga0466957_0001589 3300044842 Bacteria 11934
209 Ga0466957_0066583 3300044842 Bacteria 2221
210 Ga0466957_0077647 3300044842 Bacteria 2064
211 Ga0466959_0100234 3300045049 Bacteria 2074
212 Ga0466959_0202555 3300045049 Bacteria 1381
213 Ga0451576_0141735 3300045051 Bacteria 2506
214 Ga0466958_0001586 3300045836 Bacteria 10913
215 Ga0466958_0109162 3300045836 Unclassified 1726
216 Ga0466958_0126284 3300045836 Bacteria 1604
217 Ga0466967_0023400 3300045976 Bacteria 5061
218 Ga0466967_0030672 3300045976 Bacteria 4514
219 Ga0466967_0038353 3300045976 Bacteria 4108
220 Ga0466967_0232375 3300045976 Bacteria 1756
221 Ga0466967_0272171 3300045976 Unclassified 1623
222 Ga0466967_0528620 3300045976 Unclassified 1159
223 Ga0495592_0153250 3300046454 Bacteria 1592
224 Ga0495629_0037049 3300046459 Bacteria 3438
225 Ga0495629_0220172 3300046459 Bacteria 1309
226 Ga0495605_0042908 3300046474 Bacteria 2245
227 Ga0495585_0048319 3300046492 Bacteria 2366
228 Ga0495596_0024909 3300046500 Bacteria 2421
229 Ga0495630_0077012 3300046517 Bacteria 2514
230 Ga0495652_0062981 3300046529 Bacteria 3125
231 Ga0495652_0114568 3300046529 Bacteria 2162
232 Ga0495665_0001846 3300046531 Bacteria 11445
233 Ga0495587_0101692 3300046536 Bacteria 1655
234 Ga0495609_0085764 3300046538 Bacteria 1373
235 Ga0495609_0100741 3300046538 Bacteria 1252
236 Ga0495645_0065779 3300046543 Bacteria 2623
237 Ga0495645_0134865 3300046543 Bacteria 1727
238 Ga0495667_0069588 3300046559 Bacteria 2297
239 Ga0495634_0044825 3300046642 Bacteria 2991
240 Ga0495634_0053503 3300046642 Bacteria 2704
241 Ga0495635_0030378 3300046663 Bacteria 3755
242 Ga0495635_0105096 3300046663 Bacteria 1929
243 Ga0495659_0015342 3300046664 Bacteria 2518
244 Ga0495661_0092107 3300046665 Bacteria 1723
245 Ga0495657_0075803 3300046675 Bacteria 2186
246 Ga0495657_0092338 3300046675 Bacteria 1940
247 Ga0495646_0054007 3300046680 Bacteria 2419
248 Ga0495658_0000138 3300046683 Bacteria 40395
249 Ga0495624_0047695 3300046690 Bacteria 2721
250 Ga0495624_0063460 3300046690 Bacteria 2309
251 Ga0495624_0282918 3300046690 Bacteria 1001
252 Ga0495589_0107608 3300046794 Unclassified 1347
253 Ga0495674_0047298 3300047319 Bacteria 3815
254 Ga0495680_0013016 3300047322 Bacteria 7278
255 Ga0495680_0041159 3300047322 Bacteria 3675
256 Ga0495677_0010536 3300047445 Bacteria 3393
257 Ga0495684_0048141 3300047471 Bacteria 3260
258 Ga0495602_0095615 3300048088 Bacteria 2452
259 Ga0495602_0211518 3300048088 Bacteria 1471
260 Ga0496100_0107053 3300048903 Unclassified 1936
261 Ga0496100_0112902 3300048903 Bacteria 1890
262 Ga0496101_0021464 3300048904 Bacteria 4438
263 Ga0496102_0022042 3300048905 Bacteria 5641
264 Ga0496102_0048793 3300048905 Bacteria 3850
265 Ga0496102_0066225 3300048905 Bacteria 3310
266 Ga0496103_0004788 3300048906 Bacteria 8181
267 Ga0496105_0024178 3300048908 Bacteria 4935
268 Ga0496105_0026948 3300048908 Bacteria 4691
269 Ga0496105_0127423 3300048908 Unclassified 2099
270 Ga0496105_0330849 3300048908 Bacteria 1219
271 Ga0496107_0013867 3300048910 Bacteria 5633
272 Ga0496109_0048778 3300048912 Bacteria 3853
273 Ga0496109_0070498 3300048912 Bacteria 3208
274 Ga0496110_0017936 3300048913 Bacteria 5928
275 Ga0496110_0111412 3300048913 Bacteria 2460
276 Ga0496110_0397065 3300048913 Bacteria 1257
277 Ga0496111_0020214 3300048914 Bacteria 4632
278 Ga0496111_0113124 3300048914 Bacteria 2000
279 Ga0496112_0015452 3300048915 Bacteria 7127
280 Ga0496112_0155387 3300048915 Bacteria 2254
281 Ga0496113_0037273 3300048916 Bacteria 3567
282 Ga0496113_0161787 3300048916 Unclassified 1770
283 Ga0496114_0010801 3300048917 Bacteria 7267
284 Ga0496114_0052500 3300048917 Bacteria 3396
285 Ga0496114_0871503 3300048917 Bacteria 781
286 Ga0496115_0103754 3300048918 Bacteria 2333
287 Ga0496115_0135769 3300048918 Bacteria 2028
288 Ga0501067_0024340 3300049583 Bacteria 3358
289 Ga0501067_0029851 3300049583 Bacteria 3022
290 Ga0501067_0076523 3300049583 Bacteria 1854
291 Ga0501068_0032549 3300049584 Bacteria 3102
292 Ga0501068_0035757 3300049584 Bacteria 2966
293 Ga0501069_0037815 3300049585 Bacteria 2663
294 Ga0501069_0114769 3300049585 Bacteria 1536
295 Ga0501070_0002784 3300049586 Bacteria 15263
296 Ga0501072_0169259 3300049588 Bacteria 1744
297 Ga0501073_0108338 3300049589 Bacteria 1928
298 Ga0501074_0107551 3300049590 Bacteria 1997
299 Ga0501080_0256339 3300049742 Bacteria 1594
300 nmdc:mga05p37_445923_c1 3300050507 Bacteria 1499
301 nmdc:mga05p37_8321_c1 3300050507 Bacteria 12267
302 nmdc:mga06r32_40717_c1 3300050510 Bacteria 4411
303 nmdc:mga08y16_37178_c1 3300050511 Bacteria 5114
304 nmdc:mga08y16_82126_c1 3300050511 Bacteria 3360
305 nmdc:mga0n895_64684_c1 3300050512 Bacteria 3618
306 nmdc:mga0rr50_3922_c1 3300050513 Bacteria 8652
307 nmdc:mga08x19_392265_c1 3300050514 Unclassified 973
308 nmdc:mga0a205_131972_c1 3300050515 Bacteria 2398
309 Ga0495601_0046354 3300053077 Bacteria 2736
310 Ga0495601_0204696 3300053077 Bacteria 1289
311 Ga0495595_0047635 3300053084 Bacteria 1978
312 Ga0495619_0027183 3300053085 Bacteria 3685
313 Ga0495619_0153527 3300053085 Bacteria 1588
314 Ga0501082_0121968 3300060353 Bacteria 2260
315 Ga0466962_0000486 3300061719 Bacteria 17214
316 Ga0466962_0039463 3300061719 Unclassified 2261
317 Ga0530510_0275958 3300061734 Bacteria 1255
318 Ga0496112_0039927
319 Ga0070658_10050110
320 Ga0070680_100013057
321 Ga0070680_100085644
322 Ga0070680_100193227
323 Ga0070680_100367416
324 Ga0070682_100228581
325 Ga0070660_100003610
326 Ga0070660_100127533
327 Ga0070691_10043039
328 Ga0070671_100005697
329 Ga0070714_100183417
330 Ga0070713_100026442
331 Ga0070713_100504407
332 Ga0070700_100124535
333 Ga0070708_100037220
334 Ga0070708_100356217
335 Ga0070662_100149312
336 Ga0070681_10021771
337 Ga0068867_100522640
338 Ga0070707_100023557
339 Ga0070707_100183694
340 Ga0070707_100238348
341 Ga0070698_100047104
342 Ga0070698_100062771
343 Ga0070699_100056246
344 Ga0070679_100007403
345 Ga0070679_100034245
346 Ga0070679_100533413
347 Ga0070684_100120015
348 Ga0070704_100133327
349 Ga0070704_100149379
350 Ga0068855_100302656
351 Ga0068855_100654542
352 Ga0068857_100004208
353 Ga0068857_100676742
354 Ga0070702_100223653
355 Ga0070702_100247927
356 Ga0068852_100306381
357 Ga0068864_100386399
358 Ga0068861_100043721
359 Ga0068861_100678968
360 Ga0068863_100246721
361 Ga0068858_100530902
362 Ga0068862_100401187
363 Ga0081455_10011558
364 Ga0081455_10025889
365 Ga0081455_10051045
366 Ga0081455_10114119
367 Ga0070717_10004804
368 Ga0070717_10009913
369 Ga0070717_10074124
370 Ga0070712_100103858
371 Ga0070712_100105452
372 Ga0075428_100040412
373 Ga0075433_10088581
374 Ga0075433_10286794
375 Ga0075434_100058612
376 Ga0075434_100076677
377 Ga0075434_100611081
378 Ga0075435_100000425
379 Ga0105240_10065570
380 Ga0111539_10011439
381 Ga0105245_10016596
382 Ga0105245_10077882
383 Ga0105245_10086830
384 Ga0105243_10034160
385 Ga0105243_10111986
386 Ga0105243_10193419
387 Ga0105243_10321026
388 Ga0105242_10071310
389 Ga0105249_10018144
390 Ga0105249_10249376
391 Ga0105249_10326963
392 Ga0105239_10097690
393 Ga0105239_10694819
394 Ga0105246_10033421
395 Ga0157369_10041482
396 Ga0157374_10155849
397 Ga0157378_10128822
398 Ga0163162_10030881
399 Ga0157372_10153021
400 Ga0157372_10328344
401 Ga0157372_10449157
402 Ga0157380_10022219
403 Ga0157377_10012892
404 Ga0157377_10300199
405 Ga0157376_10128180
406 Ga0206356_11550448
407 Ga0206354_10836211
408 Ga0206353_10055291
409 Ga0206353_11280148
410 Ga0206353_11397641
411 Ga0206353_12063208
412 Ga0207642_10003064
413 Ga0207688_10022313
414 Ga0207705_10015347
415 Ga0207705_10057883
416 Ga0207684_10044441
417 Ga0207654_10051284
418 Ga0207707_10120443
419 Ga0207693_10001250
420 Ga0207693_10002660
421 Ga0207693_10003465
422 Ga0207693_10280283
423 Ga0207663_10066552
424 Ga0207660_10049573
425 Ga0207660_10070789
426 Ga0207660_10072061
427 Ga0207662_10005385
428 Ga0207657_10002431
429 Ga0207657_10012680
430 Ga0207657_10109327
431 Ga0207657_10110452
432 Ga0207652_10095434
433 Ga0207652_10127250
434 Ga0207646_10080232
435 Ga0207694_10162646
436 Ga0207687_10051408
437 Ga0207687_10060728
438 Ga0207700_10027281
439 Ga0207700_10102877
440 Ga0207664_10022510
441 Ga0207664_10146952
442 Ga0207644_10067610
443 Ga0207686_10025679
444 Ga0207669_10096298
445 Ga0207704_10477458
446 Ga0207665_10000620
447 Ga0207665_10114527
448 Ga0207661_10015609
449 Ga0207661_10021897
450 Ga0207661_10027417
451 Ga0207667_10088703
452 Ga0207667_10115846
453 Ga0207667_10615031
454 Ga0207651_10163911
455 Ga0207712_10138729
456 Ga0207712_10248767
457 Ga0207668_10028132
458 Ga0207677_10122348
459 Ga0207708_10014102
460 Ga0207702_10646298
461 Ga0207648_10002092
462 Ga0207676_10255091
463 Ga0207674_10004772
464 Ga0207675_100061808
465 Ga0207675_100604998
466 Ga0207683_10003272
467 Ga0207698_10240876
468 Ga0209998_10007522
469 Ga0207428_10065051
470 Ga0207428_10444556
471 Ga0268265_10105387
472 Ga0268265_10589156
473 Ga0265319_1015457
474 Ga0265318_10001232
475 Ga0265322_10003108
476 Ga0265322_10006101
477 Ga0265322_10070499
478 Ga0265338_10002043
479 Ga0265338_10009388
480 Ga0265338_10012558
481 Ga0265338_10037666
482 Ga0265324_10015591
483 Ga0265330_10000741
484 Ga0265332_10003115
485 Ga0265325_10002787
486 Ga0265329_10003397
487 Ga0265329_10010356
488 Ga0265340_10006981
489 Ga0265339_10025811
490 Ga0265331_10025493
491 Ga0265327_10042028
492 Ga0265316_10005340
493 Ga0265316_10216165
494 Ga0265313_10009549
495 Ga0265313_10016149
496 Ga0265313_10023412
497 Ga0265314_10016400
498 Ga0265342_10007955
499 Ga0373961_0071168
500 Ga0373935_0030796
501 Ga0373933_0126377
502 Ga0373937_0036551
503 Ga0395899_0059200
504 Ga0395899_0098414
505 Ga0395900_0072461
506 Ga0395900_0091944
507 Ga0395900_0132143
508 Ga0395900_0169308
509 Ga0395898_0105973
510 Ga0395898_0395722
511 Ga0395905_0063764
512 Ga0395905_0070273
513 Ga0395905_0224141
514 Ga0395905_0312552
515 Ga0395905_0375899
516 Ga0395901_0003265
517 Ga0395901_0032943
518 Ga0395901_0099842
519 Ga0395901_0278195
520 Ga0395901_0531549
521 Ga0436365_0799603
522 Ga0436363_1393263
523 Ga0466963_0006197
524 Ga0466970_0028857
525 Ga0466957_0001589
526 Ga0466957_0066583
527 Ga0466957_0077647
528 Ga0466959_0100234
529 Ga0466959_0202555
530 Ga0451576_0141735
531 Ga0466958_0001586
532 Ga0466958_0109162
533 Ga0466958_0126284
534 Ga0466967_0023400
535 Ga0466967_0030672
536 Ga0466967_0038353
537 Ga0466967_0232375
538 Ga0466967_0272171
539 Ga0466967_0528620
540 Ga0495592_0153250
541 Ga0495629_0037049
542 Ga0495629_0220172
543 Ga0495605_0042908
544 Ga0495585_0048319
545 Ga0495596_0024909
546 Ga0495630_0077012
547 Ga0495652_0062981
548 Ga0495652_0114568
549 Ga0495665_0001846
550 Ga0495587_0101692
551 Ga0495609_0085764
552 Ga0495609_0100741
553 Ga0495645_0065779
554 Ga0495645_0134865
555 Ga0495667_0069588
556 Ga0495634_0044825
557 Ga0495634_0053503
558 Ga0495635_0030378
559 Ga0495635_0105096
560 Ga0495659_0015342
561 Ga0495661_0092107
562 Ga0495657_0075803
563 Ga0495657_0092338
564 Ga0495646_0054007
565 Ga0495658_0000138
566 Ga0495624_0047695
567 Ga0495624_0063460
568 Ga0495624_0282918
569 Ga0495589_0107608
570 Ga0495674_0047298
571 Ga0495680_0013016
572 Ga0495680_0041159
573 Ga0495677_0010536
574 Ga0495684_0048141
575 Ga0495602_0095615
576 Ga0495602_0211518
577 Ga0496100_0107053
578 Ga0496100_0112902
579 Ga0496101_0021464
580 Ga0496102_0022042
581 Ga0496102_0048793
582 Ga0496102_0066225
583 Ga0496103_0004788
584 Ga0496105_0024178
585 Ga0496105_0026948
586 Ga0496105_0127423
587 Ga0496105_0330849
588 Ga0496107_0013867
589 Ga0496109_0048778
590 Ga0496109_0070498
591 Ga0496110_0017936
592 Ga0496110_0111412
593 Ga0496110_0397065
594 Ga0496111_0020214
595 Ga0496111_0113124
596 Ga0496112_0015452
597 Ga0496112_0155387
598 Ga0496113_0037273
599 Ga0496113_0161787
600 Ga0496114_0010801
601 Ga0496114_0052500
602 Ga0496114_0871503
603 Ga0496115_0103754
604 Ga0496115_0135769
605 Ga0501067_0024340
606 Ga0501067_0029851
607 Ga0501067_0076523
608 Ga0501068_0032549
609 Ga0501068_0035757
610 Ga0501069_0037815
611 Ga0501069_0114769
612 Ga0501070_0002784
613 Ga0501072_0169259
614 Ga0501073_0108338
615 Ga0501074_0107551
616 Ga0501080_0256339
617 nmdc:mga05p37_445923_c1
618 nmdc:mga05p37_8321_c1
619 nmdc:mga06r32_40717_c1
620 nmdc:mga08y16_37178_c1
621 nmdc:mga08y16_82126_c1
622 nmdc:mga0n895_64684_c1
623 nmdc:mga0rr50_3922_c1
624 nmdc:mga08x19_392265_c1
625 nmdc:mga0a205_131972_c1
626 Ga0495601_0046354
627 Ga0495601_0204696
628 Ga0495595_0047635
629 Ga0495619_0027183
630 Ga0495619_0153527
631 Ga0501082_0121968
632 Ga0466962_0000486
633 Ga0466962_0039463
634 Ga0530510_0275958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

21

273

0.99

PF05116

S6PP

Sucrose-6F-phosphate phosphohydrolase

18

96

0.83

PF05116

S6PP

Sucrose-6F-phosphate phosphohydrolase

175

277

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zhh-assembly2.cif.gz_B ca2+-atpase from listeria monocytogenes with g4 insertion. 0.9596 174 209
8owl-assembly1.cif.gz_A sr ca(2+)-atpase in the e2 state complexed with the photoswitch-thapsigargin derivative aztg-6 0.9463 174 209
7efl-assembly1.cif.gz_A crystal structure of the gastric proton pump k791s in (byk)e2bef state 0.9421 174 209
8d3u-assembly1.cif.gz_A human alpha3 na+/k+-atpase in its na+-occluded state 0.9399 174 209
1rkq-assembly2.cif.gz_B crystal structure of had-like phosphatase yida from e. coli 0.9352 2 224
ID Description Score Start End Superfamily
af_Q9T0E0_478_535_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.9596 173 209 1.20.1110.10
af_Q86KT5_213_287_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9528 156 227 3.40.50.1000
af_A0A1D6GSK2_41_144_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9525 173 209 3.40.50.1000
1nf2C02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2; 0.9466 48 150 3.30.1240.10
af_P06685_706_1023_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.9408 173 209 1.20.1110.10
ID Description Score Start End GO Terms
AF-R6P463-F1-model_v4 deleted 0.9699 2 222
AF-A0A538MQT7-F1-model_v4 HAD family phosphatase 0.9694 154 225 GO:0000287
GO:0005829
GO:0016791
AF-A0A524AMK9-F1-model_v4 HAD family phosphatase 0.9654 4 224 GO:0000287
GO:0005829
GO:0016791
AF-A0A7C6JRQ5-F1-model_v4 HAD family phosphatase 0.9652 2 224 GO:0000287
GO:0005829
GO:0016791
AF-A0A353M274-F1-model_v4 Cof-type HAD-IIB family hydrolase 0.9647 56 222 GO:0000287
GO:0005829
GO:0016791

Map