F404296
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 190 | 270 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0000948|Ga0495610_0000948_11431_12060 |
| Length | 209 |
| Sequence | LAKSQRVQTRKNGENMAQTVNSIPCAALIIGGSAGSLDVLLEIFPNLKNDLGFPIVLVIHRKASNESLLTDLLQSRTTLKVGEAEEKELLTAGKVFIAPADYHTLIEDDCSISLDYSEKVNYSRPSIDVTFQSAAEVFKEKLVCILLSGSNADGVEGLKSVNNYGGKVVIQNPNTAIMPYMPQQAVLGVKPNVVLDSYDMADFINNLNN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 5 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 6 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 7 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 8 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 9 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 10 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 11 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 12 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 13 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 14 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 15 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 16 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 17 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 18 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 19 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 20 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 21 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 22 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 23 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 24 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 25 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 26 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 27 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 28 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 29 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 30 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 31 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 32 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 33 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 34 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 35 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 36 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 37 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 38 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 39 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 40 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 41 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 42 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 43 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 44 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 45 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 46 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 47 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 48 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 49 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 50 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 51 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 52 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 53 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 54 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 55 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 56 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 57 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 58 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 131 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 140 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 143 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 168 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 169 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 178 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 181 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 188 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 190 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.17 |
| Metatranscriptomes | 0 |
| Isolates | 14.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.63 |
| Bulb | 0 |
| Endosphere | 7.89 |
| Nodule | 0.32 |
| Rhizoplane | 1.58 |
| Rhizosphere | 73.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_25943 | 2124908027 | Bacteria | 903 |
| 2 | SwRhRL2b_contig_2907340 | 2162886007 | Bacteria | 1143 |
| 3 | SwRhRL2b_contig_3757853 | 2162886007 | Bacteria | 16541 |
| 4 | JGI25152J39213_1000044 | 3300002773 | Bacteria | 87213 |
| 5 | JGI25150J39212_1000006 | 3300002774 | Bacteria | 257228 |
| 6 | JGI25151J46595_10000024 | 3300003187 | Bacteria | 217596 |
| 7 | JGI25153J46596_10000026 | 3300003215 | Bacteria | 217245 |
| 8 | rootH1_10162859 | 3300003316 | Bacteria | 1076 |
| 9 | rootH1_10185594 | 3300003316 | Unclassified | 1604 |
| 10 | rootH2_10013952 | 3300003320 | Bacteria | 13891 |
| 11 | rootH2_10128619 | 3300003320 | Bacteria | 3949 |
| 12 | rootL2_10147909 | 3300003322 | Bacteria | 4155 |
| 13 | rootL2_10193287 | 3300003322 | Bacteria | 5664 |
| 14 | rootL2_10215065 | 3300003322 | Bacteria | 2864 |
| 15 | rootH1_10035709 | 3300003323 | Bacteria | 9467 |
| 16 | rootH1_10040534 | 3300003323 | Bacteria | 3370 |
| 17 | rootH1_10076906 | 3300003323 | Bacteria | 2763 |
| 18 | rootH1_10249895 | 3300003323 | Bacteria | 1837 |
| 19 | rootH1_10283318 | 3300003323 | Bacteria | 1686 |
| 20 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 21 | Ga0055536_1014731 | 3300003781 | Bacteria | 2720 |
| 22 | Ga0055530_10001523 | 3300003791 | Bacteria | 16728 |
| 23 | Ga0055531_10000359 | 3300003794 | Bacteria | 44255 |
| 24 | Ga0065165_1001346 | 3300005262 | Bacteria | 27184 |
| 25 | Ga0065714_10002231 | 3300005288 | Bacteria | 44866 |
| 26 | Ga0065714_10002312 | 3300005288 | Bacteria | 29719 |
| 27 | Ga0065714_10002866 | 3300005288 | Bacteria | 16064 |
| 28 | Ga0065714_10010513 | 3300005288 | Bacteria | 6632 |
| 29 | Ga0065714_10064773 | 3300005288 | Bacteria | 19332 |
| 30 | Ga0065714_10093434 | 3300005288 | Bacteria | 1789 |
| 31 | Ga0065704_10000218 | 3300005289 | Bacteria | 76484 |
| 32 | Ga0065704_10074453 | 3300005289 | Bacteria | 6261 |
| 33 | Ga0065704_10160950 | 3300005289 | Bacteria | 1355 |
| 34 | Ga0065704_10435805 | 3300005289 | Bacteria | 718 |
| 35 | Ga0065712_10217116 | 3300005290 | Bacteria | 1053 |
| 36 | Ga0070683_100004561 | 3300005329 | Bacteria | 11430 |
| 37 | Ga0070682_100000175 | 3300005337 | Bacteria | 47814 |
| 38 | Ga0070660_100402281 | 3300005339 | Bacteria | 1132 |
| 39 | Ga0070691_10287932 | 3300005341 | Bacteria | 893 |
| 40 | Ga0070669_100319441 | 3300005353 | Unclassified | 1253 |
| 41 | Ga0070675_100072129 | 3300005354 | Bacteria | 2866 |
| 42 | Ga0070667_100074544 | 3300005367 | Bacteria | 2895 |
| 43 | Ga0070663_100015130 | 3300005455 | Bacteria | 4969 |
| 44 | Ga0070684_100004053 | 3300005535 | Bacteria | 11090 |
| 45 | Ga0070684_100165933 | 3300005535 | Bacteria | 2004 |
| 46 | Ga0070684_100452060 | 3300005535 | Bacteria | 1187 |
| 47 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 48 | Ga0070665_100002962 | 3300005548 | Bacteria | 18340 |
| 49 | Ga0068855_100003016 | 3300005563 | Bacteria | 20598 |
| 50 | Ga0068855_101004829 | 3300005563 | Unclassified | 876 |
| 51 | Ga0068857_100011238 | 3300005577 | Bacteria | 7785 |
| 52 | Ga0068856_100004666 | 3300005614 | Bacteria | 13611 |
| 53 | Ga0068856_100005059 | 3300005614 | Bacteria | 13051 |
| 54 | Ga0068852_100143240 | 3300005616 | Unclassified | 2214 |
| 55 | Ga0068858_100829120 | 3300005842 | Unclassified | 903 |
| 56 | Ga0068860_100000006 | 3300005843 | Bacteria | 461966 |
| 57 | Ga0075429_100263885 | 3300006880 | Unclassified | 1508 |
| 58 | Ga0105244_10000124 | 3300009036 | Bacteria | 78977 |
| 59 | Ga0105244_10044946 | 3300009036 | Bacteria | 2273 |
| 60 | Ga0105240_10002560 | 3300009093 | Bacteria | 29146 |
| 61 | Ga0105240_10003256 | 3300009093 | Bacteria | 25386 |
| 62 | Ga0105240_10016374 | 3300009093 | Bacteria | 10038 |
| 63 | Ga0105240_10032047 | 3300009093 | Bacteria | 6807 |
| 64 | Ga0105240_10100019 | 3300009093 | Bacteria | 3529 |
| 65 | Ga0111539_10004608 | 3300009094 | Bacteria | 18007 |
| 66 | Ga0114129_10065245 | 3300009147 | Bacteria | 5081 |
| 67 | Ga0105243_10224651 | 3300009148 | Bacteria | 1662 |
| 68 | Ga0105241_10131975 | 3300009174 | Bacteria | 2023 |
| 69 | Ga0105237_10001298 | 3300009545 | Bacteria | 33267 |
| 70 | Ga0105237_10002439 | 3300009545 | Bacteria | 23081 |
| 71 | Ga0105237_10027429 | 3300009545 | Bacteria | 5814 |
| 72 | Ga0105238_10003364 | 3300009551 | Bacteria | 15956 |
| 73 | Ga0105238_10110410 | 3300009551 | Bacteria | 2730 |
| 74 | Ga0105239_10001497 | 3300010375 | Bacteria | 31050 |
| 75 | Ga0105239_10684349 | 3300010375 | Unclassified | 1172 |
| 76 | Ga0157373_10000009 | 3300013100 | Bacteria | 201551 |
| 77 | Ga0157373_10004348 | 3300013100 | Bacteria | 10669 |
| 78 | Ga0157373_10005321 | 3300013100 | Bacteria | 9667 |
| 79 | Ga0157373_10030334 | 3300013100 | Bacteria | 3890 |
| 80 | Ga0157373_10140003 | 3300013100 | Bacteria | 1701 |
| 81 | Ga0157371_10000049 | 3300013102 | Bacteria | 183917 |
| 82 | Ga0157371_10000286 | 3300013102 | Bacteria | 68502 |
| 83 | Ga0157371_10000904 | 3300013102 | Bacteria | 33397 |
| 84 | Ga0157371_10001517 | 3300013102 | Bacteria | 23991 |
| 85 | Ga0157371_10001633 | 3300013102 | Bacteria | 22940 |
| 86 | Ga0157371_10011192 | 3300013102 | Bacteria | 6937 |
| 87 | Ga0157371_10239685 | 3300013102 | Bacteria | 1304 |
| 88 | Ga0157370_10001688 | 3300013104 | Bacteria | 27185 |
| 89 | Ga0157370_10002269 | 3300013104 | Bacteria | 23337 |
| 90 | Ga0157370_10003465 | 3300013104 | Bacteria | 18507 |
| 91 | Ga0157370_10003758 | 3300013104 | Bacteria | 17723 |
| 92 | Ga0157370_10003961 | 3300013104 | Bacteria | 17235 |
| 93 | Ga0157370_10009497 | 3300013104 | Bacteria | 10380 |
| 94 | Ga0157370_10014212 | 3300013104 | Bacteria | 8158 |
| 95 | Ga0157370_10058875 | 3300013104 | Bacteria | 3651 |
| 96 | Ga0157370_10111868 | 3300013104 | Bacteria | 2553 |
| 97 | Ga0157370_10114422 | 3300013104 | Bacteria | 2520 |
| 98 | Ga0157370_10152393 | 3300013104 | Bacteria | 2151 |
| 99 | Ga0157370_10176205 | 3300013104 | Bacteria | 1988 |
| 100 | Ga0157370_10288806 | 3300013104 | Bacteria | 1515 |
| 101 | Ga0157370_10407984 | 3300013104 | Bacteria | 1250 |
| 102 | Ga0157369_10000050 | 3300013105 | Bacteria | 167294 |
| 103 | Ga0157369_10000731 | 3300013105 | Bacteria | 42343 |
| 104 | Ga0157369_10002318 | 3300013105 | Bacteria | 22909 |
| 105 | Ga0157369_10018286 | 3300013105 | Bacteria | 7861 |
| 106 | Ga0157369_10097183 | 3300013105 | Bacteria | 3142 |
| 107 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 108 | Ga0163162_10001993 | 3300013306 | Bacteria | 19205 |
| 109 | Ga0157372_10000034 | 3300013307 | Bacteria | 174784 |
| 110 | Ga0157372_10038734 | 3300013307 | Bacteria | 5260 |
| 111 | Ga0157372_10358965 | 3300013307 | Bacteria | 1698 |
| 112 | Ga0157372_10526006 | 3300013307 | Bacteria | 1379 |
| 113 | Ga0157375_10000204 | 3300013308 | Bacteria | 55063 |
| 114 | Ga0157375_11551600 | 3300013308 | Bacteria | 782 |
| 115 | Ga0157375_11672985 | 3300013308 | Bacteria | 753 |
| 116 | Ga0157375_12249035 | 3300013308 | Bacteria | 650 |
| 117 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 118 | Ga0182008_10000028 | 3300014497 | Bacteria | 176968 |
| 119 | Ga0182008_10000058 | 3300014497 | Bacteria | 100175 |
| 120 | Ga0182008_10000059 | 3300014497 | Bacteria | 100173 |
| 121 | Ga0182008_10003267 | 3300014497 | Bacteria | 9877 |
| 122 | Ga0182008_10059346 | 3300014497 | Bacteria | 1887 |
| 123 | Ga0182008_10115449 | 3300014497 | Bacteria | 1332 |
| 124 | Ga0182006_1000048 | 3300015261 | Bacteria | 184700 |
| 125 | Ga0182006_1000156 | 3300015261 | Bacteria | 72868 |
| 126 | Ga0182006_1000616 | 3300015261 | Bacteria | 25602 |
| 127 | Ga0182006_1001045 | 3300015261 | Bacteria | 17893 |
| 128 | Ga0182006_1002300 | 3300015261 | Bacteria | 10530 |
| 129 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 130 | Ga0182007_10001164 | 3300015262 | Bacteria | 14247 |
| 131 | Ga0182007_10012494 | 3300015262 | Bacteria | 3264 |
| 132 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 133 | Ga0163161_10000152 | 3300017792 | Bacteria | 63649 |
| 134 | Ga0163161_10000789 | 3300017792 | Bacteria | 24862 |
| 135 | Ga0163161_10000826 | 3300017792 | Bacteria | 24185 |
| 136 | Ga0163161_10002431 | 3300017792 | Bacteria | 13312 |
| 137 | Ga0163161_10031459 | 3300017792 | Bacteria | 3781 |
| 138 | Ga0209436_100817 | 3300025208 | Bacteria | 12663 |
| 139 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 140 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 141 | Ga0209130_1002697 | 3300025284 | Bacteria | 8454 |
| 142 | Ga0209675_1000263 | 3300025291 | Bacteria | 51088 |
| 143 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 144 | Ga0209676_1000812 | 3300025292 | Bacteria | 40825 |
| 145 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 146 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 147 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 148 | Ga0207426_1005846 | 3300025302 | Bacteria | 5495 |
| 149 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 150 | Ga0207655_1000539 | 3300025728 | Bacteria | 47934 |
| 151 | Ga0207655_1036719 | 3300025728 | Bacteria | 2169 |
| 152 | Ga0207647_10015405 | 3300025904 | Bacteria | 5242 |
| 153 | Ga0207654_10063828 | 3300025911 | Bacteria | 2163 |
| 154 | Ga0207695_10000245 | 3300025913 | Bacteria | 141090 |
| 155 | Ga0207695_10003799 | 3300025913 | Bacteria | 20942 |
| 156 | Ga0207695_10013804 | 3300025913 | Bacteria | 9610 |
| 157 | Ga0207695_10035317 | 3300025913 | Bacteria | 5423 |
| 158 | Ga0207695_10268822 | 3300025913 | Bacteria | 1601 |
| 159 | Ga0207671_10001163 | 3300025914 | Bacteria | 31375 |
| 160 | Ga0207671_10002265 | 3300025914 | Bacteria | 20812 |
| 161 | Ga0207671_10003666 | 3300025914 | Bacteria | 15150 |
| 162 | Ga0207671_10007335 | 3300025914 | Bacteria | 9574 |
| 163 | Ga0207657_10359128 | 3300025919 | Bacteria | 1148 |
| 164 | Ga0207694_10049835 | 3300025924 | Bacteria | 3242 |
| 165 | Ga0207659_10021520 | 3300025926 | Bacteria | 4281 |
| 166 | Ga0207661_10003171 | 3300025944 | Bacteria | 11406 |
| 167 | Ga0207667_10010480 | 3300025949 | Bacteria | 10834 |
| 168 | Ga0207658_10068857 | 3300025986 | Bacteria | 2672 |
| 169 | Ga0207702_10840533 | 3300026078 | Unclassified | 908 |
| 170 | Ga0207648_10311299 | 3300026089 | Bacteria | 1413 |
| 171 | Ga0207698_10112198 | 3300026142 | Unclassified | 2288 |
| 172 | Ga0268266_10006136 | 3300028379 | Bacteria | 11062 |
| 173 | Ga0268264_10000064 | 3300028381 | Bacteria | 301274 |
| 174 | Ga0268264_10003966 | 3300028381 | Bacteria | 12669 |
| 175 | Ga0307517_10001736 | 3300028786 | Bacteria | 35923 |
| 176 | Ga0307515_10034879 | 3300028794 | Bacteria | 8212 |
| 177 | Ga0307405_10000017 | 3300031731 | Bacteria | 195149 |
| 178 | Ga0307405_10096252 | 3300031731 | Bacteria | 1973 |
| 179 | Ga0307407_10000002 | 3300031903 | Bacteria | 323084 |
| 180 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 181 | Ga0307412_10000028 | 3300031911 | Bacteria | 213966 |
| 182 | Ga0307416_100000005 | 3300032002 | Bacteria | 477728 |
| 183 | Ga0307416_100000052 | 3300032002 | Bacteria | 114516 |
| 184 | Ga0307414_10000009 | 3300032004 | Bacteria | 359782 |
| 185 | Ga0307414_10001018 | 3300032004 | Bacteria | 14314 |
| 186 | Ga0307414_10001152 | 3300032004 | Bacteria | 13567 |
| 187 | Ga0307414_10004141 | 3300032004 | Bacteria | 7832 |
| 188 | Ga0307414_10006416 | 3300032004 | Bacteria | 6560 |
| 189 | Ga0307414_10033406 | 3300032004 | Bacteria | 3400 |
| 190 | Ga0307414_10107808 | 3300032004 | Bacteria | 2112 |
| 191 | Ga0307414_10336499 | 3300032004 | Bacteria | 1290 |
| 192 | Ga0307414_10416297 | 3300032004 | Bacteria | 1171 |
| 193 | Ga0307414_10605993 | 3300032004 | Bacteria | 983 |
| 194 | Ga0307414_11267024 | 3300032004 | Unclassified | 683 |
| 195 | Ga0307411_10026432 | 3300032005 | Bacteria | 3496 |
| 196 | Ga0307411_10261542 | 3300032005 | Bacteria | 1367 |
| 197 | Ga0395899_0000182 | 3300037312 | Bacteria | 92470 |
| 198 | Ga0439466_0020040 | 3300041411 | Bacteria | 2389 |
| 199 | Ga0451807_2041958 | 3300041486 | Bacteria | 1011 |
| 200 | Ga0466972_0096273 | 3300044658 | Bacteria | 1402 |
| 201 | Ga0466961_0020064 | 3300044693 | Bacteria | 4302 |
| 202 | Ga0466961_0523663 | 3300044693 | Unclassified | 715 |
| 203 | Ga0466968_0168319 | 3300044735 | Bacteria | 1014 |
| 204 | Ga0466957_0533711 | 3300044842 | Unclassified | 816 |
| 205 | Ga0466959_0008461 | 3300045049 | Bacteria | 7277 |
| 206 | Ga0495627_078007 | 3300046453 | Bacteria | 962 |
| 207 | Ga0495638_0033030 | 3300046460 | Bacteria | 3311 |
| 208 | Ga0495606_0030901 | 3300046507 | Bacteria | 3733 |
| 209 | Ga0495606_0148912 | 3300046507 | Bacteria | 1375 |
| 210 | Ga0495606_0152574 | 3300046507 | Bacteria | 1354 |
| 211 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 212 | Ga0495610_0000322 | 3300046512 | Bacteria | 50985 |
| 213 | Ga0495610_0000948 | 3300046512 | Bacteria | 26918 |
| 214 | Ga0495643_0238956 | 3300046522 | Bacteria | 853 |
| 215 | Ga0495648_0011510 | 3300046524 | Bacteria | 6655 |
| 216 | Ga0495663_0000039 | 3300046525 | Bacteria | 68141 |
| 217 | Ga0495663_0002377 | 3300046525 | Bacteria | 5665 |
| 218 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 219 | Ga0495609_0034290 | 3300046538 | Bacteria | 2301 |
| 220 | Ga0495668_0121605 | 3300046616 | Bacteria | 1428 |
| 221 | Ga0495611_0000106 | 3300046648 | Bacteria | 58129 |
| 222 | Ga0495683_0169648 | 3300047323 | Unclassified | 1004 |
| 223 | Ga0495687_000158 | 3300047443 | Bacteria | 103129 |
| 224 | Ga0495686_0000039 | 3300047472 | Bacteria | 304821 |
| 225 | Ga0496104_0374218 | 3300048907 | Bacteria | 1337 |
| 226 | Ga0496113_0642044 | 3300048916 | Bacteria | 849 |
| 227 | Ga0496114_0288526 | 3300048917 | Unclassified | 1448 |
| 228 | Ga0496115_0111858 | 3300048918 | Unclassified | 2244 |
| 229 | Ga0496116_0000053 | 3300048919 | Bacteria | 291837 |
| 230 | Ga0496117_0000050 | 3300048920 | Bacteria | 292727 |
| 231 | Ga0496117_0131763 | 3300048920 | Bacteria | 1514 |
| 232 | Ga0496118_0000044 | 3300048921 | Bacteria | 283524 |
| 233 | Ga0496118_0094922 | 3300048921 | Bacteria | 2038 |
| 234 | Ga0496119_0000002 | 3300048922 | Bacteria | 738385 |
| 235 | Ga0496120_0045980 | 3300048923 | Bacteria | 2525 |
| 236 | Ga0496122_0000191 | 3300048925 | Bacteria | 140173 |
| 237 | Ga0496122_0000290 | 3300048925 | Bacteria | 111581 |
| 238 | Ga0496122_0000668 | 3300048925 | Bacteria | 69054 |
| 239 | Ga0496122_0001730 | 3300048925 | Bacteria | 33861 |
| 240 | Ga0496122_0006241 | 3300048925 | Bacteria | 13790 |
| 241 | Ga0496123_0000579 | 3300048926 | Bacteria | 62330 |
| 242 | Ga0496123_0000586 | 3300048926 | Bacteria | 62082 |
| 243 | Ga0496123_0016210 | 3300048926 | Bacteria | 6067 |
| 244 | Ga0496123_0158740 | 3300048926 | Bacteria | 1209 |
| 245 | Ga0496124_0025182 | 3300048927 | Bacteria | 5393 |
| 246 | Ga0496125_0000181 | 3300048928 | Bacteria | 138133 |
| 247 | Ga0496125_0046552 | 3300048928 | Bacteria | 3638 |
| 248 | Ga0496125_0157020 | 3300048928 | Bacteria | 1552 |
| 249 | Ga0496126_0120934 | 3300048929 | Bacteria | 2271 |
| 250 | Ga0501038_0026751 | 3300049574 | Bacteria | 5136 |
| 251 | Ga0501043_0249888 | 3300049579 | Bacteria | 1366 |
| 252 | Ga0501043_0565563 | 3300049579 | Unclassified | 843 |
| 253 | Ga0501047_0021847 | 3300049581 | Bacteria | 6145 |
| 254 | Ga0501047_1168072 | 3300049581 | Unclassified | 583 |
| 255 | Ga0501202_005373 | 3300049652 | Bacteria | 2270 |
| 256 | Ga0501238_006384 | 3300049671 | Bacteria | 1517 |
| 257 | Ga0501249_014165 | 3300049679 | Bacteria | 1697 |
| 258 | Ga0501080_0266378 | 3300049742 | Bacteria | 1560 |
| 259 | Ga0501241_001959 | 3300049758 | Bacteria | 4040 |
| 260 | Ga0501264_000139 | 3300049761 | Bacteria | 11382 |
| 261 | Ga0501044_0024765 | 3300049823 | Bacteria | 6367 |
| 262 | Ga0501044_0083382 | 3300049823 | Bacteria | 3233 |
| 263 | nmdc:mga05p37_35979_c1 | 3300050507 | Bacteria | 6075 |
| 264 | nmdc:mga09592_17948_c1 | 3300050508 | Bacteria | 5798 |
| 265 | nmdc:mga06r32_9546_c1 | 3300050510 | Bacteria | 8762 |
| 266 | nmdc:mga08y16_32218_c1 | 3300050511 | Bacteria | 5511 |
| 267 | Ga0500651_0000622 | 3300053093 | Bacteria | 17662 |
| 268 | Ga0500559_0016024 | 3300053136 | Unclassified | 3166 |
| 269 | Ga0500568_0039903 | 3300053139 | Bacteria | 1893 |
| 270 | Ga0500622_0000657 | 3300053156 | Bacteria | 30758 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10002439 | Ga0105237_1000243918 | 154 |
| 2 | 3300049579 | Ga0501043_0565563 | Ga0501043_0565563_10_480 | 155 |
| 3 | 3300046522 | Ga0495643_0238956 | Ga0495643_0238956_16_513 | 165 |
| 4 | 3300049581 | Ga0501047_1168072 | Ga0501047_1168072_18_527 | 168 |
| 5 | 3300049742 | Ga0501080_0266378 | Ga0501080_0266378_264_785 | 168 |
| 6 | 3300049823 | Ga0501044_0083382 | Ga0501044_0083382_2032_2562 | 170 |
| 7 | 3300044693 | Ga0466961_0523663 | Ga0466961_0523663_10_534 | 172 |
| 8 | 3300009094 | Ga0111539_10004608 | Ga0111539_100046087 | 179 |
| 9 | iso_pu_bacteria | 2889290771 | 2889291736 | 179 |
| 10 | 3300032004 | Ga0307414_10605993 | Ga0307414_106059931 | 181 |
| 11 | 3300028786 | Ga0307517_10001736 | Ga0307517_100017364 | 183 |
| 12 | iso_pu_bacteria | 2738541284 | 2738761498 | 183 |
| 13 | iso_pu_bacteria | 2738543023 | 2739302991 | 183 |
| 14 | iso_pu_bacteria | 2902048731 | 2902050612 | 183 |
| 15 | iso_pu_bacteria | 2775506987 | 2776615869 | 184 |
| 16 | iso_pu_bacteria | 2929177148 | 2929178322 | 184 |
| 17 | iso_pu_bacteria | 2945977869 | 2945980688 | 184 |
| 18 | iso_pu_bacteria | 2946013367 | 2946013446 | 184 |
| 19 | 3300003794 | Ga0055531_10000359 | Ga0055531_1000035925 | 185 |
| 20 | 3300025304 | Ga0209257_1000005 | Ga0209257_10000051070 | 185 |
| 21 | iso_pu_bacteria | 2582581278 | 2585143391 | 185 |
| 22 | iso_pu_bacteria | 2585428182 | 2588209703 | 185 |
| 23 | iso_pu_bacteria | 2585428184 | 2588219755 | 185 |
| 24 | iso_pu_bacteria | 2751185877 | 2753672493 | 185 |
| 25 | iso_pu_bacteria | 2765235839 | 2765572482 | 185 |
| 26 | iso_pu_bacteria | 2816332188 | 2816873817 | 185 |
| 27 | iso_pu_bacteria | 2871720351 | 2871721724 | 185 |
| 28 | 3300005341 | Ga0070691_10287932 | Ga0070691_102879321 | 186 |
| 29 | 3300005535 | Ga0070684_100165933 | Ga0070684_1001659332 | 186 |
| 30 | 3300005563 | Ga0068855_100003016 | Ga0068855_1000030162 | 186 |
| 31 | 3300005616 | Ga0068852_100143240 | Ga0068852_1001432403 | 186 |
| 32 | 3300009093 | Ga0105240_10003256 | Ga0105240_100032564 | 186 |
| 33 | 3300013100 | Ga0157373_10030334 | Ga0157373_100303342 | 186 |
| 34 | 3300013102 | Ga0157371_10000049 | Ga0157371_10000049109 | 186 |
| 35 | 3300013104 | Ga0157370_10009497 | Ga0157370_100094973 | 186 |
| 36 | 3300013105 | Ga0157369_10097183 | Ga0157369_100971833 | 186 |
| 37 | 3300013307 | Ga0157372_10038734 | Ga0157372_100387343 | 186 |
| 38 | 3300025913 | Ga0207695_10000245 | Ga0207695_1000024537 | 186 |
| 39 | 3300025949 | Ga0207667_10010480 | Ga0207667_100104807 | 186 |
| 40 | 3300026142 | Ga0207698_10112198 | Ga0207698_101121982 | 186 |
| 41 | 3300046616 | Ga0495668_0121605 | Ga0495668_0121605_239_814 | 186 |
| 42 | iso_pu_bacteria | 2585428061 | 2587751750 | 186 |
| 43 | iso_pu_bacteria | 2588253712 | 2588445961 | 186 |
| 44 | iso_pu_bacteria | 2588254257 | 2590614140 | 186 |
| 45 | iso_pu_bacteria | 2842083920 | 2842086456 | 186 |
| 46 | iso_pu_bacteria | 2884791551 | 2884796166 | 186 |
| 47 | iso_pu_bacteria | 2905999023 | 2906002703 | 186 |
| 48 | iso_pu_bacteria | 2945924605 | 2945927555 | 186 |
| 49 | iso_pu_bacteria | 2946019816 | 2946020920 | 186 |
| 50 | 2162886007 | SwRhRL2b_contig_2907340 | SwRhRL2b_0863.00013880 | 187 |
| 51 | 3300003316 | rootH1_10185594 | rootH1_101855942 | 187 |
| 52 | 3300003320 | rootH2_10013952 | rootH2_100139523 | 187 |
| 53 | 3300003320 | rootH2_10128619 | rootH2_101286192 | 187 |
| 54 | 3300003322 | rootL2_10147909 | rootL2_101479092 | 187 |
| 55 | 3300003322 | rootL2_10193287 | rootL2_101932877 | 187 |
| 56 | 3300003322 | rootL2_10215065 | rootL2_102150654 | 187 |
| 57 | 3300003323 | rootH1_10035709 | rootH1_100357096 | 187 |
| 58 | 3300003323 | rootH1_10040534 | rootH1_100405343 | 187 |
| 59 | 3300003323 | rootH1_10076906 | rootH1_100769065 | 187 |
| 60 | 3300005288 | Ga0065714_10002231 | Ga0065714_1000223121 | 187 |
| 61 | 3300005288 | Ga0065714_10002312 | Ga0065714_1000231221 | 187 |
| 62 | 3300005289 | Ga0065704_10074453 | Ga0065704_100744535 | 187 |
| 63 | 3300005289 | Ga0065704_10160950 | Ga0065704_101609501 | 187 |
| 64 | 3300005290 | Ga0065712_10217116 | Ga0065712_102171162 | 187 |
| 65 | 3300005337 | Ga0070682_100000175 | Ga0070682_10000017541 | 187 |
| 66 | 3300005339 | Ga0070660_100402281 | Ga0070660_1004022812 | 187 |
| 67 | 3300005353 | Ga0070669_100319441 | Ga0070669_1003194412 | 187 |
| 68 | 3300005354 | Ga0070675_100072129 | Ga0070675_1000721293 | 187 |
| 69 | 3300005367 | Ga0070667_100074544 | Ga0070667_1000745441 | 187 |
| 70 | 3300005535 | Ga0070684_100452060 | Ga0070684_1004520601 | 187 |
| 71 | 3300005548 | Ga0070665_100000016 | Ga0070665_100000016126 | 187 |
| 72 | 3300005563 | Ga0068855_101004829 | Ga0068855_1010048292 | 187 |
| 73 | 3300005614 | Ga0068856_100005059 | Ga0068856_1000050594 | 187 |
| 74 | 3300005842 | Ga0068858_100829120 | Ga0068858_1008291201 | 187 |
| 75 | 3300005843 | Ga0068860_100000006 | Ga0068860_100000006106 | 187 |
| 76 | 3300006880 | Ga0075429_100263885 | Ga0075429_1002638852 | 187 |
| 77 | 3300009036 | Ga0105244_10000124 | Ga0105244_1000012415 | 187 |
| 78 | 3300009093 | Ga0105240_10002560 | Ga0105240_1000256011 | 187 |
| 79 | 3300009093 | Ga0105240_10016374 | Ga0105240_100163744 | 187 |
| 80 | 3300009093 | Ga0105240_10032047 | Ga0105240_100320473 | 187 |
| 81 | 3300009147 | Ga0114129_10065245 | Ga0114129_100652453 | 187 |
| 82 | 3300009148 | Ga0105243_10224651 | Ga0105243_102246512 | 187 |
| 83 | 3300009174 | Ga0105241_10131975 | Ga0105241_101319753 | 187 |
| 84 | 3300009545 | Ga0105237_10001298 | Ga0105237_1000129812 | 187 |
| 85 | 3300009551 | Ga0105238_10003364 | Ga0105238_1000336412 | 187 |
| 86 | 3300009551 | Ga0105238_10110410 | Ga0105238_101104102 | 187 |
| 87 | 3300010375 | Ga0105239_10001497 | Ga0105239_1000149714 | 187 |
| 88 | 3300013100 | Ga0157373_10000009 | Ga0157373_10000009131 | 187 |
| 89 | 3300013100 | Ga0157373_10004348 | Ga0157373_100043481 | 187 |
| 90 | 3300013102 | Ga0157371_10239685 | Ga0157371_102396852 | 187 |
| 91 | 3300013104 | Ga0157370_10003961 | Ga0157370_1000396110 | 187 |
| 92 | 3300013104 | Ga0157370_10058875 | Ga0157370_100588751 | 187 |
| 93 | 3300013104 | Ga0157370_10176205 | Ga0157370_101762052 | 187 |
| 94 | 3300013104 | Ga0157370_10288806 | Ga0157370_102888062 | 187 |
| 95 | 3300013306 | Ga0163162_10001993 | Ga0163162_100019937 | 187 |
| 96 | 3300013307 | Ga0157372_10526006 | Ga0157372_105260062 | 187 |
| 97 | 3300013308 | Ga0157375_10000204 | Ga0157375_1000020425 | 187 |
| 98 | 3300013308 | Ga0157375_11551600 | Ga0157375_115516001 | 187 |
| 99 | 3300013308 | Ga0157375_11672985 | Ga0157375_116729852 | 187 |
| 100 | 3300014497 | Ga0182008_10000028 | Ga0182008_1000002865 | 187 |
| 101 | 3300014497 | Ga0182008_10003267 | Ga0182008_100032675 | 187 |
| 102 | 3300014497 | Ga0182008_10059346 | Ga0182008_100593463 | 187 |
| 103 | 3300014497 | Ga0182008_10115449 | Ga0182008_101154493 | 187 |
| 104 | 3300015261 | Ga0182006_1000048 | Ga0182006_1000048165 | 187 |
| 105 | 3300015262 | Ga0182007_10001164 | Ga0182007_100011642 | 187 |
| 106 | 3300015262 | Ga0182007_10012494 | Ga0182007_100124943 | 187 |
| 107 | 3300017792 | Ga0163161_10000789 | Ga0163161_1000078916 | 187 |
| 108 | 3300025291 | Ga0209675_1000263 | Ga0209675_10002636 | 187 |
| 109 | 3300025728 | Ga0207655_1000539 | Ga0207655_100053931 | 187 |
| 110 | 3300025911 | Ga0207654_10063828 | Ga0207654_100638282 | 187 |
| 111 | 3300025913 | Ga0207695_10003799 | Ga0207695_100037993 | 187 |
| 112 | 3300025913 | Ga0207695_10035317 | Ga0207695_100353173 | 187 |
| 113 | 3300025913 | Ga0207695_10268822 | Ga0207695_102688222 | 187 |
| 114 | 3300025914 | Ga0207671_10001163 | Ga0207671_100011637 | 187 |
| 115 | 3300025914 | Ga0207671_10002265 | Ga0207671_100022652 | 187 |
| 116 | 3300025914 | Ga0207671_10003666 | Ga0207671_100036663 | 187 |
| 117 | 3300025914 | Ga0207671_10007335 | Ga0207671_100073352 | 187 |
| 118 | 3300025919 | Ga0207657_10359128 | Ga0207657_103591282 | 187 |
| 119 | 3300025924 | Ga0207694_10049835 | Ga0207694_100498353 | 187 |
| 120 | 3300025926 | Ga0207659_10021520 | Ga0207659_100215202 | 187 |
| 121 | 3300025986 | Ga0207658_10068857 | Ga0207658_100688571 | 187 |
| 122 | 3300026078 | Ga0207702_10840533 | Ga0207702_108405332 | 187 |
| 123 | 3300026089 | Ga0207648_10311299 | Ga0207648_103112992 | 187 |
| 124 | 3300028381 | Ga0268264_10000064 | Ga0268264_1000006488 | 187 |
| 125 | 3300028381 | Ga0268264_10003966 | Ga0268264_100039663 | 187 |
| 126 | 3300028794 | Ga0307515_10034879 | Ga0307515_100348794 | 187 |
| 127 | 3300031911 | Ga0307412_10000028 | Ga0307412_10000028132 | 187 |
| 128 | 3300032002 | Ga0307416_100000052 | Ga0307416_1000000527 | 187 |
| 129 | 3300032004 | Ga0307414_10001152 | Ga0307414_100011523 | 187 |
| 130 | 3300032004 | Ga0307414_10006416 | Ga0307414_100064164 | 187 |
| 131 | 3300032004 | Ga0307414_10336499 | Ga0307414_103364992 | 187 |
| 132 | 3300032004 | Ga0307414_11267024 | Ga0307414_112670241 | 187 |
| 133 | 3300032005 | Ga0307411_10026432 | Ga0307411_100264323 | 187 |
| 134 | 3300041411 | Ga0439466_0020040 | Ga0439466_0020040_222_797 | 187 |
| 135 | 3300046460 | Ga0495638_0033030 | Ga0495638_0033030_2354_2932 | 187 |
| 136 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_993659_994237 | 187 |
| 137 | 3300046524 | Ga0495648_0011510 | Ga0495648_0011510_4983_5561 | 187 |
| 138 | 3300046525 | Ga0495663_0000039 | Ga0495663_0000039_44503_45075 | 187 |
| 139 | 3300046538 | Ga0495609_0000025 | Ga0495609_0000025_131339_131911 | 187 |
| 140 | 3300046538 | Ga0495609_0034290 | Ga0495609_0034290_530_1093 | 187 |
| 141 | 3300046648 | Ga0495611_0000106 | Ga0495611_0000106_47496_48104 | 187 |
| 142 | 3300047323 | Ga0495683_0169648 | Ga0495683_0169648_352_930 | 187 |
| 143 | 3300047443 | Ga0495687_000158 | Ga0495687_000158_92212_92790 | 187 |
| 144 | 3300047472 | Ga0495686_0000039 | Ga0495686_0000039_299038_299622 | 187 |
| 145 | 3300048907 | Ga0496104_0374218 | Ga0496104_0374218_655_1224 | 187 |
| 146 | 3300048916 | Ga0496113_0642044 | Ga0496113_0642044_175_744 | 187 |
| 147 | 3300048917 | Ga0496114_0288526 | Ga0496114_0288526_317_889 | 187 |
| 148 | 3300048918 | Ga0496115_0111858 | Ga0496115_0111858_1269_1841 | 187 |
| 149 | 3300048919 | Ga0496116_0000053 | Ga0496116_0000053_214285_214854 | 187 |
| 150 | 3300048920 | Ga0496117_0000050 | Ga0496117_0000050_225876_226445 | 187 |
| 151 | 3300048920 | Ga0496117_0131763 | Ga0496117_0131763_66_638 | 187 |
| 152 | 3300048921 | Ga0496118_0000044 | Ga0496118_0000044_66310_66879 | 187 |
| 153 | 3300048921 | Ga0496118_0094922 | Ga0496118_0094922_1345_1917 | 187 |
| 154 | 3300048922 | Ga0496119_0000002 | Ga0496119_0000002_68488_69057 | 187 |
| 155 | 3300048923 | Ga0496120_0045980 | Ga0496120_0045980_1926_2495 | 187 |
| 156 | 3300048925 | Ga0496122_0000191 | Ga0496122_0000191_66616_67185 | 187 |
| 157 | 3300048925 | Ga0496122_0000290 | Ga0496122_0000290_83676_84245 | 187 |
| 158 | 3300048925 | Ga0496122_0001730 | Ga0496122_0001730_3843_4412 | 187 |
| 159 | 3300048925 | Ga0496122_0006241 | Ga0496122_0006241_12108_12680 | 187 |
| 160 | 3300048926 | Ga0496123_0000579 | Ga0496123_0000579_7773_8342 | 187 |
| 161 | 3300048926 | Ga0496123_0016210 | Ga0496123_0016210_3750_4319 | 187 |
| 162 | 3300048926 | Ga0496123_0158740 | Ga0496123_0158740_149_721 | 187 |
| 163 | 3300048927 | Ga0496124_0025182 | Ga0496124_0025182_640_1209 | 187 |
| 164 | 3300048928 | Ga0496125_0000181 | Ga0496125_0000181_3747_4316 | 187 |
| 165 | 3300048928 | Ga0496125_0046552 | Ga0496125_0046552_1058_1627 | 187 |
| 166 | 3300048929 | Ga0496126_0120934 | Ga0496126_0120934_1555_2124 | 187 |
| 167 | 3300049574 | Ga0501038_0026751 | Ga0501038_0026751_951_1532 | 187 |
| 168 | 3300049579 | Ga0501043_0249888 | Ga0501043_0249888_160_741 | 187 |
| 169 | 3300049581 | Ga0501047_0021847 | Ga0501047_0021847_901_1482 | 187 |
| 170 | 3300049823 | Ga0501044_0024765 | Ga0501044_0024765_5096_5677 | 187 |
| 171 | 3300050507 | nmdc:mga05p37_35979_c1 | nmdc:mga05p37_35979_c1_4104_4682 | 187 |
| 172 | 3300050508 | nmdc:mga09592_17948_c1 | nmdc:mga09592_17948_c1_2345_2923 | 187 |
| 173 | 3300050510 | nmdc:mga06r32_9546_c1 | nmdc:mga06r32_9546_c1_4284_4862 | 187 |
| 174 | 3300050511 | nmdc:mga08y16_32218_c1 | nmdc:mga08y16_32218_c1_2681_3259 | 187 |
| 175 | 3300053156 | Ga0500622_0000657 | Ga0500622_0000657_17962_18540 | 187 |
| 176 | iso_pu_bacteria | 2585428060 | 2587749817 | 187 |
| 177 | iso_pu_bacteria | 2585428095 | 2587865794 | 187 |
| 178 | iso_pu_bacteria | 2728369107 | 2729201832 | 187 |
| 179 | iso_pu_bacteria | 2984572630 | 2984574748 | 187 |
| 180 | iso_pu_bacteria | 2984606641 | 2984608200 | 187 |
| 181 | iso_pu_bacteria | 2993372514 | 2993373627 | 187 |
| 182 | iso_pu_bacteria | 2993480792 | 2993484304 | 187 |
| 183 | 2124908027 | MRS2a_Contig_25943 | MRS2a_00784260 | 188 |
| 184 | 2162886007 | SwRhRL2b_contig_3757853 | SwRhRL2b_0703.00005970 | 188 |
| 185 | 3300002773 | JGI25152J39213_1000044 | JGI25152J39213_100004460 | 188 |
| 186 | 3300002774 | JGI25150J39212_1000006 | JGI25150J39212_100000622 | 188 |
| 187 | 3300003187 | JGI25151J46595_10000024 | JGI25151J46595_10000024167 | 188 |
| 188 | 3300003215 | JGI25153J46596_10000026 | JGI25153J46596_1000002623 | 188 |
| 189 | 3300003316 | rootH1_10162859 | rootH1_101628592 | 188 |
| 190 | 3300003323 | rootH1_10249895 | rootH1_102498952 | 188 |
| 191 | 3300003323 | rootH1_10283318 | rootH1_102833183 | 188 |
| 192 | 3300003781 | Ga0055536_1000002 | Ga0055536_100000296 | 188 |
| 193 | 3300003781 | Ga0055536_1014731 | Ga0055536_10147314 | 188 |
| 194 | 3300003791 | Ga0055530_10001523 | Ga0055530_100015239 | 188 |
| 195 | 3300005262 | Ga0065165_1001346 | Ga0065165_10013462 | 188 |
| 196 | 3300005288 | Ga0065714_10002866 | Ga0065714_100028664 | 188 |
| 197 | 3300005288 | Ga0065714_10010513 | Ga0065714_100105133 | 188 |
| 198 | 3300005288 | Ga0065714_10064773 | Ga0065714_1006477311 | 188 |
| 199 | 3300005288 | Ga0065714_10093434 | Ga0065714_100934341 | 188 |
| 200 | 3300005289 | Ga0065704_10000218 | Ga0065704_100002182 | 188 |
| 201 | 3300005289 | Ga0065704_10435805 | Ga0065704_104358051 | 188 |
| 202 | 3300005329 | Ga0070683_100004561 | Ga0070683_1000045614 | 188 |
| 203 | 3300005455 | Ga0070663_100015130 | Ga0070663_1000151301 | 188 |
| 204 | 3300005535 | Ga0070684_100004053 | Ga0070684_1000040536 | 188 |
| 205 | 3300005548 | Ga0070665_100002962 | Ga0070665_10000296210 | 188 |
| 206 | 3300005577 | Ga0068857_100011238 | Ga0068857_1000112386 | 188 |
| 207 | 3300005614 | Ga0068856_100004666 | Ga0068856_1000046668 | 188 |
| 208 | 3300009036 | Ga0105244_10044946 | Ga0105244_100449463 | 188 |
| 209 | 3300009093 | Ga0105240_10100019 | Ga0105240_101000193 | 188 |
| 210 | 3300009545 | Ga0105237_10027429 | Ga0105237_100274294 | 188 |
| 211 | 3300010375 | Ga0105239_10684349 | Ga0105239_106843491 | 188 |
| 212 | 3300013100 | Ga0157373_10005321 | Ga0157373_100053212 | 188 |
| 213 | 3300013100 | Ga0157373_10140003 | Ga0157373_101400033 | 188 |
| 214 | 3300013102 | Ga0157371_10000286 | Ga0157371_1000028659 | 188 |
| 215 | 3300013102 | Ga0157371_10000904 | Ga0157371_100009044 | 188 |
| 216 | 3300013102 | Ga0157371_10001517 | Ga0157371_1000151715 | 188 |
| 217 | 3300013102 | Ga0157371_10001633 | Ga0157371_1000163314 | 188 |
| 218 | 3300013102 | Ga0157371_10011192 | Ga0157371_100111925 | 188 |
| 219 | 3300013104 | Ga0157370_10001688 | Ga0157370_1000168818 | 188 |
| 220 | 3300013104 | Ga0157370_10002269 | Ga0157370_100022694 | 188 |
| 221 | 3300013104 | Ga0157370_10003465 | Ga0157370_1000346510 | 188 |
| 222 | 3300013104 | Ga0157370_10003758 | Ga0157370_100037588 | 188 |
| 223 | 3300013104 | Ga0157370_10014212 | Ga0157370_100142123 | 188 |
| 224 | 3300013104 | Ga0157370_10111868 | Ga0157370_101118684 | 188 |
| 225 | 3300013104 | Ga0157370_10114422 | Ga0157370_101144223 | 188 |
| 226 | 3300013104 | Ga0157370_10152393 | Ga0157370_101523934 | 188 |
| 227 | 3300013104 | Ga0157370_10407984 | Ga0157370_104079842 | 188 |
| 228 | 3300013105 | Ga0157369_10000050 | Ga0157369_1000005013 | 188 |
| 229 | 3300013105 | Ga0157369_10000731 | Ga0157369_100007314 | 188 |
| 230 | 3300013105 | Ga0157369_10002318 | Ga0157369_1000231813 | 188 |
| 231 | 3300013105 | Ga0157369_10018286 | Ga0157369_100182864 | 188 |
| 232 | 3300013306 | Ga0163162_10000011 | Ga0163162_10000011187 | 188 |
| 233 | 3300013307 | Ga0157372_10000034 | Ga0157372_1000003490 | 188 |
| 234 | 3300013307 | Ga0157372_10358965 | Ga0157372_103589652 | 188 |
| 235 | 3300013308 | Ga0157375_12249035 | Ga0157375_122490351 | 188 |
| 236 | 3300014497 | Ga0182008_10000025 | Ga0182008_1000002589 | 188 |
| 237 | 3300014497 | Ga0182008_10000058 | Ga0182008_1000005841 | 188 |
| 238 | 3300014497 | Ga0182008_10000059 | Ga0182008_1000005936 | 188 |
| 239 | 3300015261 | Ga0182006_1000156 | Ga0182006_100015666 | 188 |
| 240 | 3300015261 | Ga0182006_1000616 | Ga0182006_100061615 | 188 |
| 241 | 3300015261 | Ga0182006_1001045 | Ga0182006_100104518 | 188 |
| 242 | 3300015261 | Ga0182006_1002300 | Ga0182006_10023003 | 188 |
| 243 | 3300015262 | Ga0182007_10000008 | Ga0182007_10000008185 | 188 |
| 244 | 3300015682 | Ga0183373_1002 | Ga0183373_1002458 | 188 |
| 245 | 3300017792 | Ga0163161_10000152 | Ga0163161_1000015249 | 188 |
| 246 | 3300017792 | Ga0163161_10000826 | Ga0163161_1000082614 | 188 |
| 247 | 3300017792 | Ga0163161_10002431 | Ga0163161_100024317 | 188 |
| 248 | 3300017792 | Ga0163161_10031459 | Ga0163161_100314595 | 188 |
| 249 | 3300025208 | Ga0209436_100817 | Ga0209436_1008172 | 188 |
| 250 | 3300025245 | Ga0207425_1000003 | Ga0207425_100000322 | 188 |
| 251 | 3300025258 | Ga0209129_1000022 | Ga0209129_100002222 | 188 |
| 252 | 3300025284 | Ga0209130_1002697 | Ga0209130_10026974 | 188 |
| 253 | 3300025292 | Ga0209676_1000022 | Ga0209676_1000022444 | 188 |
| 254 | 3300025292 | Ga0209676_1000812 | Ga0209676_100081224 | 188 |
| 255 | 3300025294 | Ga0209025_1000007 | Ga0209025_100000721 | 188 |
| 256 | 3300025297 | Ga0209758_1000012 | Ga0209758_100001222 | 188 |
| 257 | 3300025298 | Ga0209050_1000020 | Ga0209050_100002095 | 188 |
| 258 | 3300025302 | Ga0207426_1005846 | Ga0207426_10058466 | 188 |
| 259 | 3300025728 | Ga0207655_1036719 | Ga0207655_10367192 | 188 |
| 260 | 3300025904 | Ga0207647_10015405 | Ga0207647_100154054 | 188 |
| 261 | 3300025913 | Ga0207695_10013804 | Ga0207695_100138045 | 188 |
| 262 | 3300025944 | Ga0207661_10003171 | Ga0207661_100031714 | 188 |
| 263 | 3300028379 | Ga0268266_10006136 | Ga0268266_100061364 | 188 |
| 264 | 3300031731 | Ga0307405_10000017 | Ga0307405_1000001733 | 188 |
| 265 | 3300031731 | Ga0307405_10096252 | Ga0307405_100962523 | 188 |
| 266 | 3300031903 | Ga0307407_10000002 | Ga0307407_1000000275 | 188 |
| 267 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001481 | 188 |
| 268 | 3300032002 | Ga0307416_100000005 | Ga0307416_10000000575 | 188 |
| 269 | 3300032004 | Ga0307414_10000009 | Ga0307414_10000009334 | 188 |
| 270 | 3300032004 | Ga0307414_10001018 | Ga0307414_100010182 | 188 |
| 271 | 3300032004 | Ga0307414_10004141 | Ga0307414_100041413 | 188 |
| 272 | 3300032004 | Ga0307414_10033406 | Ga0307414_100334064 | 188 |
| 273 | 3300032004 | Ga0307414_10107808 | Ga0307414_101078082 | 188 |
| 274 | 3300032004 | Ga0307414_10416297 | Ga0307414_104162971 | 188 |
| 275 | 3300032005 | Ga0307411_10261542 | Ga0307411_102615422 | 188 |
| 276 | 3300037312 | Ga0395899_0000182 | Ga0395899_0000182_17414_18007 | 188 |
| 277 | 3300041486 | Ga0451807_2041958 | Ga0451807_2041958_247_831 | 188 |
| 278 | 3300044658 | Ga0466972_0096273 | Ga0466972_0096273_596_1168 | 188 |
| 279 | 3300044693 | Ga0466961_0020064 | Ga0466961_0020064_3015_3596 | 188 |
| 280 | 3300044735 | Ga0466968_0168319 | Ga0466968_0168319_385_957 | 188 |
| 281 | 3300044842 | Ga0466957_0533711 | Ga0466957_0533711_164_736 | 188 |
| 282 | 3300045049 | Ga0466959_0008461 | Ga0466959_0008461_3550_4122 | 188 |
| 283 | 3300046453 | Ga0495627_078007 | Ga0495627_078007_174_758 | 188 |
| 284 | 3300046507 | Ga0495606_0030901 | Ga0495606_0030901_2395_2997 | 188 |
| 285 | 3300046507 | Ga0495606_0148912 | Ga0495606_0148912_311_892 | 188 |
| 286 | 3300046507 | Ga0495606_0152574 | Ga0495606_0152574_20_604 | 188 |
| 287 | 3300046512 | Ga0495610_0000322 | Ga0495610_0000322_20247_20831 | 188 |
| 288 | 3300046512 | Ga0495610_0000948 | Ga0495610_0000948_11431_12060 | 188 |
| 289 | 3300046525 | Ga0495663_0002377 | Ga0495663_0002377_1614_2195 | 188 |
| 290 | 3300048925 | Ga0496122_0000668 | Ga0496122_0000668_13463_14065 | 188 |
| 291 | 3300048926 | Ga0496123_0000586 | Ga0496123_0000586_4351_4953 | 188 |
| 292 | 3300048928 | Ga0496125_0157020 | Ga0496125_0157020_663_1265 | 188 |
| 293 | 3300049652 | Ga0501202_005373 | Ga0501202_005373_511_1110 | 188 |
| 294 | 3300049671 | Ga0501238_006384 | Ga0501238_006384_310_909 | 188 |
| 295 | 3300049679 | Ga0501249_014165 | Ga0501249_014165_33_617 | 188 |
| 296 | 3300049758 | Ga0501241_001959 | Ga0501241_001959_1225_1791 | 188 |
| 297 | 3300049761 | Ga0501264_000139 | Ga0501264_000139_7942_8541 | 188 |
| 298 | 3300053093 | Ga0500651_0000622 | Ga0500651_0000622_11071_11637 | 188 |
| 299 | 3300053136 | Ga0500559_0016024 | Ga0500559_0016024_230_811 | 188 |
| 300 | 3300053139 | Ga0500568_0039903 | Ga0500568_0039903_1215_1781 | 188 |
| 301 | iso_pu_bacteria | 2585427687 | 2586206468 | 188 |
| 302 | iso_pu_bacteria | 2738541302 | 2738852829 | 188 |
| 303 | iso_pu_bacteria | 2739367651 | 2739586773 | 188 |
| 304 | iso_pu_bacteria | 2739367656 | 2739615086 | 188 |
| 305 | iso_pu_bacteria | 2739367663 | 2739645780 | 188 |
| 306 | iso_pu_bacteria | 2739367874 | 2740057227 | 188 |
| 307 | iso_pu_bacteria | 2818991437 | 2819547197 | 188 |
| 308 | iso_pu_bacteria | 2842722452 | 2842727037 | 188 |
| 309 | iso_pu_bacteria | 2842909656 | 2842910961 | 188 |
| 310 | iso_pu_bacteria | 2849281842 | 2849283822 | 188 |
| 311 | iso_pu_bacteria | 2852627209 | 2852628073 | 188 |
| 312 | iso_pu_bacteria | 2857627736 | 2857627968 | 188 |
| 313 | iso_pu_bacteria | 2904445276 | 2904447673 | 188 |
| 314 | iso_pu_bacteria | 2919186247 | 2919188435 | 188 |
| 315 | iso_pu_bacteria | 2939664404 | 2939667480 | 188 |
| 316 | iso_pu_bacteria | 2945997725 | 2945997927 | 188 |
| 317 | iso_pu_bacteria | 2954016120 | 2954020407 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sft-assembly1.cif.gz_A | crystal structure of thermotoga maritima cheb methylesterase catalytic domain | 0.9319 | 5 | 188 |
| 6ymz-assembly5.cif.gz_E | structure of the cheb methylsterase from p. atrosepticum scri1043 | 0.9317 | 6 | 184 |
| 6ymz-assembly3.cif.gz_C | structure of the cheb methylsterase from p. atrosepticum scri1043 | 0.9152 | 2 | 185 |
| 6ymz-assembly1.cif.gz_A | structure of the cheb methylsterase from p. atrosepticum scri1043 | 0.9094 | 2 | 185 |
| 3sft-assembly1.cif.gz_A | crystal structure of thermotoga maritima cheb methylesterase catalytic domain | 0.9081 | 5 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sftA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain | 0.9319 | 5 | 188 | 3.40.50.180 |
| af_P07330_147_349_3.40.50.180 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain | 0.9092 | 6 | 184 | 3.40.50.180 |
| 3sftA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain | 0.9081 | 5 | 188 | 3.40.50.180 |
| af_P07330_147_349_3.40.50.180 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain | 0.863 | 6 | 184 | 3.40.50.180 |
| af_Q7T3C7_167_349_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6509 | 123 | 176 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N0X030-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9673 | 3 | 188 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |
| AF-A0A4Q6BE72-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9635 | 4 | 187 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |
| AF-A0A5C1QD84-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9603 | 4 | 187 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |
| AF-A0A810M0B8-F1-model_v4 | deleted | 0.9594 | 11 | 185 |
|
| AF-A0A0D8I7M1-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9592 | 4 | 185 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar