F404296

General Info

Members Datasets Scaffolds Average Seq Length
317 190 270 191

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0000948|Ga0495610_0000948_11431_12060
Length 209
Sequence LAKSQRVQTRKNGENMAQTVNSIPCAALIIGGSAGSLDVLLEIFPNLKNDLGFPIVLVIHRKASNESLLTDLLQSRTTLKVGEAEEKELLTAGKVFIAPADYHTLIEDDCSISLDYSEKVNYSRPSIDVTFQSAAEVFKEKLVCILLSGSNADGVEGLKSVNNYGGKVVIQNPNTAIMPYMPQQAVLGVKPNVVLDSYDMADFINNLNN

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
7 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
8 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
11 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
12 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
13 2738541284 Pedobacter sp. YR016 Isolate Unclassified
14 2738541302 Pedobacter sp. CF074 Isolate Unclassified
15 2738543023 Pedobacter sp. OK628 Isolate Unclassified
16 2739367651 Pedobacter sp. OK291 Isolate Unclassified
17 2739367656 Pedobacter sp. CF523 Isolate Unclassified
18 2739367663 Pedobacter sp. YR510 Isolate Unclassified
19 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
20 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
21 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
22 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
23 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
24 2818991437 Pedobacter terrae 518 Isolate Unclassified
25 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
26 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
27 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
28 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
29 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
30 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
31 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
32 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
33 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
34 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
35 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
36 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
37 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
38 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
39 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
40 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
41 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
42 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
43 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
44 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
45 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
46 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
47 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
48 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
49 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
181 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.17
Metatranscriptomes 0
Isolates 14.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 7.89
Nodule 0.32
Rhizoplane 1.58
Rhizosphere 73.19
Stem 0
Stem Tuber 0
Unclassified 16.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_25943 2124908027 Bacteria 903
2 SwRhRL2b_contig_2907340 2162886007 Bacteria 1143
3 SwRhRL2b_contig_3757853 2162886007 Bacteria 16541
4 JGI25152J39213_1000044 3300002773 Bacteria 87213
5 JGI25150J39212_1000006 3300002774 Bacteria 257228
6 JGI25151J46595_10000024 3300003187 Bacteria 217596
7 JGI25153J46596_10000026 3300003215 Bacteria 217245
8 rootH1_10162859 3300003316 Bacteria 1076
9 rootH1_10185594 3300003316 Unclassified 1604
10 rootH2_10013952 3300003320 Bacteria 13891
11 rootH2_10128619 3300003320 Bacteria 3949
12 rootL2_10147909 3300003322 Bacteria 4155
13 rootL2_10193287 3300003322 Bacteria 5664
14 rootL2_10215065 3300003322 Bacteria 2864
15 rootH1_10035709 3300003323 Bacteria 9467
16 rootH1_10040534 3300003323 Bacteria 3370
17 rootH1_10076906 3300003323 Bacteria 2763
18 rootH1_10249895 3300003323 Bacteria 1837
19 rootH1_10283318 3300003323 Bacteria 1686
20 Ga0055536_1000002 3300003781 Bacteria 605605
21 Ga0055536_1014731 3300003781 Bacteria 2720
22 Ga0055530_10001523 3300003791 Bacteria 16728
23 Ga0055531_10000359 3300003794 Bacteria 44255
24 Ga0065165_1001346 3300005262 Bacteria 27184
25 Ga0065714_10002231 3300005288 Bacteria 44866
26 Ga0065714_10002312 3300005288 Bacteria 29719
27 Ga0065714_10002866 3300005288 Bacteria 16064
28 Ga0065714_10010513 3300005288 Bacteria 6632
29 Ga0065714_10064773 3300005288 Bacteria 19332
30 Ga0065714_10093434 3300005288 Bacteria 1789
31 Ga0065704_10000218 3300005289 Bacteria 76484
32 Ga0065704_10074453 3300005289 Bacteria 6261
33 Ga0065704_10160950 3300005289 Bacteria 1355
34 Ga0065704_10435805 3300005289 Bacteria 718
35 Ga0065712_10217116 3300005290 Bacteria 1053
36 Ga0070683_100004561 3300005329 Bacteria 11430
37 Ga0070682_100000175 3300005337 Bacteria 47814
38 Ga0070660_100402281 3300005339 Bacteria 1132
39 Ga0070691_10287932 3300005341 Bacteria 893
40 Ga0070669_100319441 3300005353 Unclassified 1253
41 Ga0070675_100072129 3300005354 Bacteria 2866
42 Ga0070667_100074544 3300005367 Bacteria 2895
43 Ga0070663_100015130 3300005455 Bacteria 4969
44 Ga0070684_100004053 3300005535 Bacteria 11090
45 Ga0070684_100165933 3300005535 Bacteria 2004
46 Ga0070684_100452060 3300005535 Bacteria 1187
47 Ga0070665_100000016 3300005548 Bacteria 451538
48 Ga0070665_100002962 3300005548 Bacteria 18340
49 Ga0068855_100003016 3300005563 Bacteria 20598
50 Ga0068855_101004829 3300005563 Unclassified 876
51 Ga0068857_100011238 3300005577 Bacteria 7785
52 Ga0068856_100004666 3300005614 Bacteria 13611
53 Ga0068856_100005059 3300005614 Bacteria 13051
54 Ga0068852_100143240 3300005616 Unclassified 2214
55 Ga0068858_100829120 3300005842 Unclassified 903
56 Ga0068860_100000006 3300005843 Bacteria 461966
57 Ga0075429_100263885 3300006880 Unclassified 1508
58 Ga0105244_10000124 3300009036 Bacteria 78977
59 Ga0105244_10044946 3300009036 Bacteria 2273
60 Ga0105240_10002560 3300009093 Bacteria 29146
61 Ga0105240_10003256 3300009093 Bacteria 25386
62 Ga0105240_10016374 3300009093 Bacteria 10038
63 Ga0105240_10032047 3300009093 Bacteria 6807
64 Ga0105240_10100019 3300009093 Bacteria 3529
65 Ga0111539_10004608 3300009094 Bacteria 18007
66 Ga0114129_10065245 3300009147 Bacteria 5081
67 Ga0105243_10224651 3300009148 Bacteria 1662
68 Ga0105241_10131975 3300009174 Bacteria 2023
69 Ga0105237_10001298 3300009545 Bacteria 33267
70 Ga0105237_10002439 3300009545 Bacteria 23081
71 Ga0105237_10027429 3300009545 Bacteria 5814
72 Ga0105238_10003364 3300009551 Bacteria 15956
73 Ga0105238_10110410 3300009551 Bacteria 2730
74 Ga0105239_10001497 3300010375 Bacteria 31050
75 Ga0105239_10684349 3300010375 Unclassified 1172
76 Ga0157373_10000009 3300013100 Bacteria 201551
77 Ga0157373_10004348 3300013100 Bacteria 10669
78 Ga0157373_10005321 3300013100 Bacteria 9667
79 Ga0157373_10030334 3300013100 Bacteria 3890
80 Ga0157373_10140003 3300013100 Bacteria 1701
81 Ga0157371_10000049 3300013102 Bacteria 183917
82 Ga0157371_10000286 3300013102 Bacteria 68502
83 Ga0157371_10000904 3300013102 Bacteria 33397
84 Ga0157371_10001517 3300013102 Bacteria 23991
85 Ga0157371_10001633 3300013102 Bacteria 22940
86 Ga0157371_10011192 3300013102 Bacteria 6937
87 Ga0157371_10239685 3300013102 Bacteria 1304
88 Ga0157370_10001688 3300013104 Bacteria 27185
89 Ga0157370_10002269 3300013104 Bacteria 23337
90 Ga0157370_10003465 3300013104 Bacteria 18507
91 Ga0157370_10003758 3300013104 Bacteria 17723
92 Ga0157370_10003961 3300013104 Bacteria 17235
93 Ga0157370_10009497 3300013104 Bacteria 10380
94 Ga0157370_10014212 3300013104 Bacteria 8158
95 Ga0157370_10058875 3300013104 Bacteria 3651
96 Ga0157370_10111868 3300013104 Bacteria 2553
97 Ga0157370_10114422 3300013104 Bacteria 2520
98 Ga0157370_10152393 3300013104 Bacteria 2151
99 Ga0157370_10176205 3300013104 Bacteria 1988
100 Ga0157370_10288806 3300013104 Bacteria 1515
101 Ga0157370_10407984 3300013104 Bacteria 1250
102 Ga0157369_10000050 3300013105 Bacteria 167294
103 Ga0157369_10000731 3300013105 Bacteria 42343
104 Ga0157369_10002318 3300013105 Bacteria 22909
105 Ga0157369_10018286 3300013105 Bacteria 7861
106 Ga0157369_10097183 3300013105 Bacteria 3142
107 Ga0163162_10000011 3300013306 Bacteria 299877
108 Ga0163162_10001993 3300013306 Bacteria 19205
109 Ga0157372_10000034 3300013307 Bacteria 174784
110 Ga0157372_10038734 3300013307 Bacteria 5260
111 Ga0157372_10358965 3300013307 Bacteria 1698
112 Ga0157372_10526006 3300013307 Bacteria 1379
113 Ga0157375_10000204 3300013308 Bacteria 55063
114 Ga0157375_11551600 3300013308 Bacteria 782
115 Ga0157375_11672985 3300013308 Bacteria 753
116 Ga0157375_12249035 3300013308 Bacteria 650
117 Ga0182008_10000025 3300014497 Bacteria 191222
118 Ga0182008_10000028 3300014497 Bacteria 176968
119 Ga0182008_10000058 3300014497 Bacteria 100175
120 Ga0182008_10000059 3300014497 Bacteria 100173
121 Ga0182008_10003267 3300014497 Bacteria 9877
122 Ga0182008_10059346 3300014497 Bacteria 1887
123 Ga0182008_10115449 3300014497 Bacteria 1332
124 Ga0182006_1000048 3300015261 Bacteria 184700
125 Ga0182006_1000156 3300015261 Bacteria 72868
126 Ga0182006_1000616 3300015261 Bacteria 25602
127 Ga0182006_1001045 3300015261 Bacteria 17893
128 Ga0182006_1002300 3300015261 Bacteria 10530
129 Ga0182007_10000008 3300015262 Bacteria 332953
130 Ga0182007_10001164 3300015262 Bacteria 14247
131 Ga0182007_10012494 3300015262 Bacteria 3264
132 Ga0183373_1002 3300015682 Bacteria 990153
133 Ga0163161_10000152 3300017792 Bacteria 63649
134 Ga0163161_10000789 3300017792 Bacteria 24862
135 Ga0163161_10000826 3300017792 Bacteria 24185
136 Ga0163161_10002431 3300017792 Bacteria 13312
137 Ga0163161_10031459 3300017792 Bacteria 3781
138 Ga0209436_100817 3300025208 Bacteria 12663
139 Ga0207425_1000003 3300025245 Bacteria 1145342
140 Ga0209129_1000022 3300025258 Bacteria 440876
141 Ga0209130_1002697 3300025284 Bacteria 8454
142 Ga0209675_1000263 3300025291 Bacteria 51088
143 Ga0209676_1000022 3300025292 Bacteria 605659
144 Ga0209676_1000812 3300025292 Bacteria 40825
145 Ga0209025_1000007 3300025294 Bacteria 1145109
146 Ga0209758_1000012 3300025297 Bacteria 949866
147 Ga0209050_1000020 3300025298 Bacteria 605671
148 Ga0207426_1005846 3300025302 Bacteria 5495
149 Ga0209257_1000005 3300025304 Bacteria 1592528
150 Ga0207655_1000539 3300025728 Bacteria 47934
151 Ga0207655_1036719 3300025728 Bacteria 2169
152 Ga0207647_10015405 3300025904 Bacteria 5242
153 Ga0207654_10063828 3300025911 Bacteria 2163
154 Ga0207695_10000245 3300025913 Bacteria 141090
155 Ga0207695_10003799 3300025913 Bacteria 20942
156 Ga0207695_10013804 3300025913 Bacteria 9610
157 Ga0207695_10035317 3300025913 Bacteria 5423
158 Ga0207695_10268822 3300025913 Bacteria 1601
159 Ga0207671_10001163 3300025914 Bacteria 31375
160 Ga0207671_10002265 3300025914 Bacteria 20812
161 Ga0207671_10003666 3300025914 Bacteria 15150
162 Ga0207671_10007335 3300025914 Bacteria 9574
163 Ga0207657_10359128 3300025919 Bacteria 1148
164 Ga0207694_10049835 3300025924 Bacteria 3242
165 Ga0207659_10021520 3300025926 Bacteria 4281
166 Ga0207661_10003171 3300025944 Bacteria 11406
167 Ga0207667_10010480 3300025949 Bacteria 10834
168 Ga0207658_10068857 3300025986 Bacteria 2672
169 Ga0207702_10840533 3300026078 Unclassified 908
170 Ga0207648_10311299 3300026089 Bacteria 1413
171 Ga0207698_10112198 3300026142 Unclassified 2288
172 Ga0268266_10006136 3300028379 Bacteria 11062
173 Ga0268264_10000064 3300028381 Bacteria 301274
174 Ga0268264_10003966 3300028381 Bacteria 12669
175 Ga0307517_10001736 3300028786 Bacteria 35923
176 Ga0307515_10034879 3300028794 Bacteria 8212
177 Ga0307405_10000017 3300031731 Bacteria 195149
178 Ga0307405_10096252 3300031731 Bacteria 1973
179 Ga0307407_10000002 3300031903 Bacteria 323084
180 Ga0307412_10000001 3300031911 Bacteria 822691
181 Ga0307412_10000028 3300031911 Bacteria 213966
182 Ga0307416_100000005 3300032002 Bacteria 477728
183 Ga0307416_100000052 3300032002 Bacteria 114516
184 Ga0307414_10000009 3300032004 Bacteria 359782
185 Ga0307414_10001018 3300032004 Bacteria 14314
186 Ga0307414_10001152 3300032004 Bacteria 13567
187 Ga0307414_10004141 3300032004 Bacteria 7832
188 Ga0307414_10006416 3300032004 Bacteria 6560
189 Ga0307414_10033406 3300032004 Bacteria 3400
190 Ga0307414_10107808 3300032004 Bacteria 2112
191 Ga0307414_10336499 3300032004 Bacteria 1290
192 Ga0307414_10416297 3300032004 Bacteria 1171
193 Ga0307414_10605993 3300032004 Bacteria 983
194 Ga0307414_11267024 3300032004 Unclassified 683
195 Ga0307411_10026432 3300032005 Bacteria 3496
196 Ga0307411_10261542 3300032005 Bacteria 1367
197 Ga0395899_0000182 3300037312 Bacteria 92470
198 Ga0439466_0020040 3300041411 Bacteria 2389
199 Ga0451807_2041958 3300041486 Bacteria 1011
200 Ga0466972_0096273 3300044658 Bacteria 1402
201 Ga0466961_0020064 3300044693 Bacteria 4302
202 Ga0466961_0523663 3300044693 Unclassified 715
203 Ga0466968_0168319 3300044735 Bacteria 1014
204 Ga0466957_0533711 3300044842 Unclassified 816
205 Ga0466959_0008461 3300045049 Bacteria 7277
206 Ga0495627_078007 3300046453 Bacteria 962
207 Ga0495638_0033030 3300046460 Bacteria 3311
208 Ga0495606_0030901 3300046507 Bacteria 3733
209 Ga0495606_0148912 3300046507 Bacteria 1375
210 Ga0495606_0152574 3300046507 Bacteria 1354
211 Ga0495610_0000001 3300046512 Bacteria 1620061
212 Ga0495610_0000322 3300046512 Bacteria 50985
213 Ga0495610_0000948 3300046512 Bacteria 26918
214 Ga0495643_0238956 3300046522 Bacteria 853
215 Ga0495648_0011510 3300046524 Bacteria 6655
216 Ga0495663_0000039 3300046525 Bacteria 68141
217 Ga0495663_0002377 3300046525 Bacteria 5665
218 Ga0495609_0000025 3300046538 Bacteria 256898
219 Ga0495609_0034290 3300046538 Bacteria 2301
220 Ga0495668_0121605 3300046616 Bacteria 1428
221 Ga0495611_0000106 3300046648 Bacteria 58129
222 Ga0495683_0169648 3300047323 Unclassified 1004
223 Ga0495687_000158 3300047443 Bacteria 103129
224 Ga0495686_0000039 3300047472 Bacteria 304821
225 Ga0496104_0374218 3300048907 Bacteria 1337
226 Ga0496113_0642044 3300048916 Bacteria 849
227 Ga0496114_0288526 3300048917 Unclassified 1448
228 Ga0496115_0111858 3300048918 Unclassified 2244
229 Ga0496116_0000053 3300048919 Bacteria 291837
230 Ga0496117_0000050 3300048920 Bacteria 292727
231 Ga0496117_0131763 3300048920 Bacteria 1514
232 Ga0496118_0000044 3300048921 Bacteria 283524
233 Ga0496118_0094922 3300048921 Bacteria 2038
234 Ga0496119_0000002 3300048922 Bacteria 738385
235 Ga0496120_0045980 3300048923 Bacteria 2525
236 Ga0496122_0000191 3300048925 Bacteria 140173
237 Ga0496122_0000290 3300048925 Bacteria 111581
238 Ga0496122_0000668 3300048925 Bacteria 69054
239 Ga0496122_0001730 3300048925 Bacteria 33861
240 Ga0496122_0006241 3300048925 Bacteria 13790
241 Ga0496123_0000579 3300048926 Bacteria 62330
242 Ga0496123_0000586 3300048926 Bacteria 62082
243 Ga0496123_0016210 3300048926 Bacteria 6067
244 Ga0496123_0158740 3300048926 Bacteria 1209
245 Ga0496124_0025182 3300048927 Bacteria 5393
246 Ga0496125_0000181 3300048928 Bacteria 138133
247 Ga0496125_0046552 3300048928 Bacteria 3638
248 Ga0496125_0157020 3300048928 Bacteria 1552
249 Ga0496126_0120934 3300048929 Bacteria 2271
250 Ga0501038_0026751 3300049574 Bacteria 5136
251 Ga0501043_0249888 3300049579 Bacteria 1366
252 Ga0501043_0565563 3300049579 Unclassified 843
253 Ga0501047_0021847 3300049581 Bacteria 6145
254 Ga0501047_1168072 3300049581 Unclassified 583
255 Ga0501202_005373 3300049652 Bacteria 2270
256 Ga0501238_006384 3300049671 Bacteria 1517
257 Ga0501249_014165 3300049679 Bacteria 1697
258 Ga0501080_0266378 3300049742 Bacteria 1560
259 Ga0501241_001959 3300049758 Bacteria 4040
260 Ga0501264_000139 3300049761 Bacteria 11382
261 Ga0501044_0024765 3300049823 Bacteria 6367
262 Ga0501044_0083382 3300049823 Bacteria 3233
263 nmdc:mga05p37_35979_c1 3300050507 Bacteria 6075
264 nmdc:mga09592_17948_c1 3300050508 Bacteria 5798
265 nmdc:mga06r32_9546_c1 3300050510 Bacteria 8762
266 nmdc:mga08y16_32218_c1 3300050511 Bacteria 5511
267 Ga0500651_0000622 3300053093 Bacteria 17662
268 Ga0500559_0016024 3300053136 Unclassified 3166
269 Ga0500568_0039903 3300053139 Bacteria 1893
270 Ga0500622_0000657 3300053156 Bacteria 30758

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10002439 Ga0105237_1000243918 154
2 3300049579 Ga0501043_0565563 Ga0501043_0565563_10_480 155
3 3300046522 Ga0495643_0238956 Ga0495643_0238956_16_513 165
4 3300049581 Ga0501047_1168072 Ga0501047_1168072_18_527 168
5 3300049742 Ga0501080_0266378 Ga0501080_0266378_264_785 168
6 3300049823 Ga0501044_0083382 Ga0501044_0083382_2032_2562 170
7 3300044693 Ga0466961_0523663 Ga0466961_0523663_10_534 172
8 3300009094 Ga0111539_10004608 Ga0111539_100046087 179
9 iso_pu_bacteria 2889290771 2889291736 179
10 3300032004 Ga0307414_10605993 Ga0307414_106059931 181
11 3300028786 Ga0307517_10001736 Ga0307517_100017364 183
12 iso_pu_bacteria 2738541284 2738761498 183
13 iso_pu_bacteria 2738543023 2739302991 183
14 iso_pu_bacteria 2902048731 2902050612 183
15 iso_pu_bacteria 2775506987 2776615869 184
16 iso_pu_bacteria 2929177148 2929178322 184
17 iso_pu_bacteria 2945977869 2945980688 184
18 iso_pu_bacteria 2946013367 2946013446 184
19 3300003794 Ga0055531_10000359 Ga0055531_1000035925 185
20 3300025304 Ga0209257_1000005 Ga0209257_10000051070 185
21 iso_pu_bacteria 2582581278 2585143391 185
22 iso_pu_bacteria 2585428182 2588209703 185
23 iso_pu_bacteria 2585428184 2588219755 185
24 iso_pu_bacteria 2751185877 2753672493 185
25 iso_pu_bacteria 2765235839 2765572482 185
26 iso_pu_bacteria 2816332188 2816873817 185
27 iso_pu_bacteria 2871720351 2871721724 185
28 3300005341 Ga0070691_10287932 Ga0070691_102879321 186
29 3300005535 Ga0070684_100165933 Ga0070684_1001659332 186
30 3300005563 Ga0068855_100003016 Ga0068855_1000030162 186
31 3300005616 Ga0068852_100143240 Ga0068852_1001432403 186
32 3300009093 Ga0105240_10003256 Ga0105240_100032564 186
33 3300013100 Ga0157373_10030334 Ga0157373_100303342 186
34 3300013102 Ga0157371_10000049 Ga0157371_10000049109 186
35 3300013104 Ga0157370_10009497 Ga0157370_100094973 186
36 3300013105 Ga0157369_10097183 Ga0157369_100971833 186
37 3300013307 Ga0157372_10038734 Ga0157372_100387343 186
38 3300025913 Ga0207695_10000245 Ga0207695_1000024537 186
39 3300025949 Ga0207667_10010480 Ga0207667_100104807 186
40 3300026142 Ga0207698_10112198 Ga0207698_101121982 186
41 3300046616 Ga0495668_0121605 Ga0495668_0121605_239_814 186
42 iso_pu_bacteria 2585428061 2587751750 186
43 iso_pu_bacteria 2588253712 2588445961 186
44 iso_pu_bacteria 2588254257 2590614140 186
45 iso_pu_bacteria 2842083920 2842086456 186
46 iso_pu_bacteria 2884791551 2884796166 186
47 iso_pu_bacteria 2905999023 2906002703 186
48 iso_pu_bacteria 2945924605 2945927555 186
49 iso_pu_bacteria 2946019816 2946020920 186
50 2162886007 SwRhRL2b_contig_2907340 SwRhRL2b_0863.00013880 187
51 3300003316 rootH1_10185594 rootH1_101855942 187
52 3300003320 rootH2_10013952 rootH2_100139523 187
53 3300003320 rootH2_10128619 rootH2_101286192 187
54 3300003322 rootL2_10147909 rootL2_101479092 187
55 3300003322 rootL2_10193287 rootL2_101932877 187
56 3300003322 rootL2_10215065 rootL2_102150654 187
57 3300003323 rootH1_10035709 rootH1_100357096 187
58 3300003323 rootH1_10040534 rootH1_100405343 187
59 3300003323 rootH1_10076906 rootH1_100769065 187
60 3300005288 Ga0065714_10002231 Ga0065714_1000223121 187
61 3300005288 Ga0065714_10002312 Ga0065714_1000231221 187
62 3300005289 Ga0065704_10074453 Ga0065704_100744535 187
63 3300005289 Ga0065704_10160950 Ga0065704_101609501 187
64 3300005290 Ga0065712_10217116 Ga0065712_102171162 187
65 3300005337 Ga0070682_100000175 Ga0070682_10000017541 187
66 3300005339 Ga0070660_100402281 Ga0070660_1004022812 187
67 3300005353 Ga0070669_100319441 Ga0070669_1003194412 187
68 3300005354 Ga0070675_100072129 Ga0070675_1000721293 187
69 3300005367 Ga0070667_100074544 Ga0070667_1000745441 187
70 3300005535 Ga0070684_100452060 Ga0070684_1004520601 187
71 3300005548 Ga0070665_100000016 Ga0070665_100000016126 187
72 3300005563 Ga0068855_101004829 Ga0068855_1010048292 187
73 3300005614 Ga0068856_100005059 Ga0068856_1000050594 187
74 3300005842 Ga0068858_100829120 Ga0068858_1008291201 187
75 3300005843 Ga0068860_100000006 Ga0068860_100000006106 187
76 3300006880 Ga0075429_100263885 Ga0075429_1002638852 187
77 3300009036 Ga0105244_10000124 Ga0105244_1000012415 187
78 3300009093 Ga0105240_10002560 Ga0105240_1000256011 187
79 3300009093 Ga0105240_10016374 Ga0105240_100163744 187
80 3300009093 Ga0105240_10032047 Ga0105240_100320473 187
81 3300009147 Ga0114129_10065245 Ga0114129_100652453 187
82 3300009148 Ga0105243_10224651 Ga0105243_102246512 187
83 3300009174 Ga0105241_10131975 Ga0105241_101319753 187
84 3300009545 Ga0105237_10001298 Ga0105237_1000129812 187
85 3300009551 Ga0105238_10003364 Ga0105238_1000336412 187
86 3300009551 Ga0105238_10110410 Ga0105238_101104102 187
87 3300010375 Ga0105239_10001497 Ga0105239_1000149714 187
88 3300013100 Ga0157373_10000009 Ga0157373_10000009131 187
89 3300013100 Ga0157373_10004348 Ga0157373_100043481 187
90 3300013102 Ga0157371_10239685 Ga0157371_102396852 187
91 3300013104 Ga0157370_10003961 Ga0157370_1000396110 187
92 3300013104 Ga0157370_10058875 Ga0157370_100588751 187
93 3300013104 Ga0157370_10176205 Ga0157370_101762052 187
94 3300013104 Ga0157370_10288806 Ga0157370_102888062 187
95 3300013306 Ga0163162_10001993 Ga0163162_100019937 187
96 3300013307 Ga0157372_10526006 Ga0157372_105260062 187
97 3300013308 Ga0157375_10000204 Ga0157375_1000020425 187
98 3300013308 Ga0157375_11551600 Ga0157375_115516001 187
99 3300013308 Ga0157375_11672985 Ga0157375_116729852 187
100 3300014497 Ga0182008_10000028 Ga0182008_1000002865 187
101 3300014497 Ga0182008_10003267 Ga0182008_100032675 187
102 3300014497 Ga0182008_10059346 Ga0182008_100593463 187
103 3300014497 Ga0182008_10115449 Ga0182008_101154493 187
104 3300015261 Ga0182006_1000048 Ga0182006_1000048165 187
105 3300015262 Ga0182007_10001164 Ga0182007_100011642 187
106 3300015262 Ga0182007_10012494 Ga0182007_100124943 187
107 3300017792 Ga0163161_10000789 Ga0163161_1000078916 187
108 3300025291 Ga0209675_1000263 Ga0209675_10002636 187
109 3300025728 Ga0207655_1000539 Ga0207655_100053931 187
110 3300025911 Ga0207654_10063828 Ga0207654_100638282 187
111 3300025913 Ga0207695_10003799 Ga0207695_100037993 187
112 3300025913 Ga0207695_10035317 Ga0207695_100353173 187
113 3300025913 Ga0207695_10268822 Ga0207695_102688222 187
114 3300025914 Ga0207671_10001163 Ga0207671_100011637 187
115 3300025914 Ga0207671_10002265 Ga0207671_100022652 187
116 3300025914 Ga0207671_10003666 Ga0207671_100036663 187
117 3300025914 Ga0207671_10007335 Ga0207671_100073352 187
118 3300025919 Ga0207657_10359128 Ga0207657_103591282 187
119 3300025924 Ga0207694_10049835 Ga0207694_100498353 187
120 3300025926 Ga0207659_10021520 Ga0207659_100215202 187
121 3300025986 Ga0207658_10068857 Ga0207658_100688571 187
122 3300026078 Ga0207702_10840533 Ga0207702_108405332 187
123 3300026089 Ga0207648_10311299 Ga0207648_103112992 187
124 3300028381 Ga0268264_10000064 Ga0268264_1000006488 187
125 3300028381 Ga0268264_10003966 Ga0268264_100039663 187
126 3300028794 Ga0307515_10034879 Ga0307515_100348794 187
127 3300031911 Ga0307412_10000028 Ga0307412_10000028132 187
128 3300032002 Ga0307416_100000052 Ga0307416_1000000527 187
129 3300032004 Ga0307414_10001152 Ga0307414_100011523 187
130 3300032004 Ga0307414_10006416 Ga0307414_100064164 187
131 3300032004 Ga0307414_10336499 Ga0307414_103364992 187
132 3300032004 Ga0307414_11267024 Ga0307414_112670241 187
133 3300032005 Ga0307411_10026432 Ga0307411_100264323 187
134 3300041411 Ga0439466_0020040 Ga0439466_0020040_222_797 187
135 3300046460 Ga0495638_0033030 Ga0495638_0033030_2354_2932 187
136 3300046512 Ga0495610_0000001 Ga0495610_0000001_993659_994237 187
137 3300046524 Ga0495648_0011510 Ga0495648_0011510_4983_5561 187
138 3300046525 Ga0495663_0000039 Ga0495663_0000039_44503_45075 187
139 3300046538 Ga0495609_0000025 Ga0495609_0000025_131339_131911 187
140 3300046538 Ga0495609_0034290 Ga0495609_0034290_530_1093 187
141 3300046648 Ga0495611_0000106 Ga0495611_0000106_47496_48104 187
142 3300047323 Ga0495683_0169648 Ga0495683_0169648_352_930 187
143 3300047443 Ga0495687_000158 Ga0495687_000158_92212_92790 187
144 3300047472 Ga0495686_0000039 Ga0495686_0000039_299038_299622 187
145 3300048907 Ga0496104_0374218 Ga0496104_0374218_655_1224 187
146 3300048916 Ga0496113_0642044 Ga0496113_0642044_175_744 187
147 3300048917 Ga0496114_0288526 Ga0496114_0288526_317_889 187
148 3300048918 Ga0496115_0111858 Ga0496115_0111858_1269_1841 187
149 3300048919 Ga0496116_0000053 Ga0496116_0000053_214285_214854 187
150 3300048920 Ga0496117_0000050 Ga0496117_0000050_225876_226445 187
151 3300048920 Ga0496117_0131763 Ga0496117_0131763_66_638 187
152 3300048921 Ga0496118_0000044 Ga0496118_0000044_66310_66879 187
153 3300048921 Ga0496118_0094922 Ga0496118_0094922_1345_1917 187
154 3300048922 Ga0496119_0000002 Ga0496119_0000002_68488_69057 187
155 3300048923 Ga0496120_0045980 Ga0496120_0045980_1926_2495 187
156 3300048925 Ga0496122_0000191 Ga0496122_0000191_66616_67185 187
157 3300048925 Ga0496122_0000290 Ga0496122_0000290_83676_84245 187
158 3300048925 Ga0496122_0001730 Ga0496122_0001730_3843_4412 187
159 3300048925 Ga0496122_0006241 Ga0496122_0006241_12108_12680 187
160 3300048926 Ga0496123_0000579 Ga0496123_0000579_7773_8342 187
161 3300048926 Ga0496123_0016210 Ga0496123_0016210_3750_4319 187
162 3300048926 Ga0496123_0158740 Ga0496123_0158740_149_721 187
163 3300048927 Ga0496124_0025182 Ga0496124_0025182_640_1209 187
164 3300048928 Ga0496125_0000181 Ga0496125_0000181_3747_4316 187
165 3300048928 Ga0496125_0046552 Ga0496125_0046552_1058_1627 187
166 3300048929 Ga0496126_0120934 Ga0496126_0120934_1555_2124 187
167 3300049574 Ga0501038_0026751 Ga0501038_0026751_951_1532 187
168 3300049579 Ga0501043_0249888 Ga0501043_0249888_160_741 187
169 3300049581 Ga0501047_0021847 Ga0501047_0021847_901_1482 187
170 3300049823 Ga0501044_0024765 Ga0501044_0024765_5096_5677 187
171 3300050507 nmdc:mga05p37_35979_c1 nmdc:mga05p37_35979_c1_4104_4682 187
172 3300050508 nmdc:mga09592_17948_c1 nmdc:mga09592_17948_c1_2345_2923 187
173 3300050510 nmdc:mga06r32_9546_c1 nmdc:mga06r32_9546_c1_4284_4862 187
174 3300050511 nmdc:mga08y16_32218_c1 nmdc:mga08y16_32218_c1_2681_3259 187
175 3300053156 Ga0500622_0000657 Ga0500622_0000657_17962_18540 187
176 iso_pu_bacteria 2585428060 2587749817 187
177 iso_pu_bacteria 2585428095 2587865794 187
178 iso_pu_bacteria 2728369107 2729201832 187
179 iso_pu_bacteria 2984572630 2984574748 187
180 iso_pu_bacteria 2984606641 2984608200 187
181 iso_pu_bacteria 2993372514 2993373627 187
182 iso_pu_bacteria 2993480792 2993484304 187
183 2124908027 MRS2a_Contig_25943 MRS2a_00784260 188
184 2162886007 SwRhRL2b_contig_3757853 SwRhRL2b_0703.00005970 188
185 3300002773 JGI25152J39213_1000044 JGI25152J39213_100004460 188
186 3300002774 JGI25150J39212_1000006 JGI25150J39212_100000622 188
187 3300003187 JGI25151J46595_10000024 JGI25151J46595_10000024167 188
188 3300003215 JGI25153J46596_10000026 JGI25153J46596_1000002623 188
189 3300003316 rootH1_10162859 rootH1_101628592 188
190 3300003323 rootH1_10249895 rootH1_102498952 188
191 3300003323 rootH1_10283318 rootH1_102833183 188
192 3300003781 Ga0055536_1000002 Ga0055536_100000296 188
193 3300003781 Ga0055536_1014731 Ga0055536_10147314 188
194 3300003791 Ga0055530_10001523 Ga0055530_100015239 188
195 3300005262 Ga0065165_1001346 Ga0065165_10013462 188
196 3300005288 Ga0065714_10002866 Ga0065714_100028664 188
197 3300005288 Ga0065714_10010513 Ga0065714_100105133 188
198 3300005288 Ga0065714_10064773 Ga0065714_1006477311 188
199 3300005288 Ga0065714_10093434 Ga0065714_100934341 188
200 3300005289 Ga0065704_10000218 Ga0065704_100002182 188
201 3300005289 Ga0065704_10435805 Ga0065704_104358051 188
202 3300005329 Ga0070683_100004561 Ga0070683_1000045614 188
203 3300005455 Ga0070663_100015130 Ga0070663_1000151301 188
204 3300005535 Ga0070684_100004053 Ga0070684_1000040536 188
205 3300005548 Ga0070665_100002962 Ga0070665_10000296210 188
206 3300005577 Ga0068857_100011238 Ga0068857_1000112386 188
207 3300005614 Ga0068856_100004666 Ga0068856_1000046668 188
208 3300009036 Ga0105244_10044946 Ga0105244_100449463 188
209 3300009093 Ga0105240_10100019 Ga0105240_101000193 188
210 3300009545 Ga0105237_10027429 Ga0105237_100274294 188
211 3300010375 Ga0105239_10684349 Ga0105239_106843491 188
212 3300013100 Ga0157373_10005321 Ga0157373_100053212 188
213 3300013100 Ga0157373_10140003 Ga0157373_101400033 188
214 3300013102 Ga0157371_10000286 Ga0157371_1000028659 188
215 3300013102 Ga0157371_10000904 Ga0157371_100009044 188
216 3300013102 Ga0157371_10001517 Ga0157371_1000151715 188
217 3300013102 Ga0157371_10001633 Ga0157371_1000163314 188
218 3300013102 Ga0157371_10011192 Ga0157371_100111925 188
219 3300013104 Ga0157370_10001688 Ga0157370_1000168818 188
220 3300013104 Ga0157370_10002269 Ga0157370_100022694 188
221 3300013104 Ga0157370_10003465 Ga0157370_1000346510 188
222 3300013104 Ga0157370_10003758 Ga0157370_100037588 188
223 3300013104 Ga0157370_10014212 Ga0157370_100142123 188
224 3300013104 Ga0157370_10111868 Ga0157370_101118684 188
225 3300013104 Ga0157370_10114422 Ga0157370_101144223 188
226 3300013104 Ga0157370_10152393 Ga0157370_101523934 188
227 3300013104 Ga0157370_10407984 Ga0157370_104079842 188
228 3300013105 Ga0157369_10000050 Ga0157369_1000005013 188
229 3300013105 Ga0157369_10000731 Ga0157369_100007314 188
230 3300013105 Ga0157369_10002318 Ga0157369_1000231813 188
231 3300013105 Ga0157369_10018286 Ga0157369_100182864 188
232 3300013306 Ga0163162_10000011 Ga0163162_10000011187 188
233 3300013307 Ga0157372_10000034 Ga0157372_1000003490 188
234 3300013307 Ga0157372_10358965 Ga0157372_103589652 188
235 3300013308 Ga0157375_12249035 Ga0157375_122490351 188
236 3300014497 Ga0182008_10000025 Ga0182008_1000002589 188
237 3300014497 Ga0182008_10000058 Ga0182008_1000005841 188
238 3300014497 Ga0182008_10000059 Ga0182008_1000005936 188
239 3300015261 Ga0182006_1000156 Ga0182006_100015666 188
240 3300015261 Ga0182006_1000616 Ga0182006_100061615 188
241 3300015261 Ga0182006_1001045 Ga0182006_100104518 188
242 3300015261 Ga0182006_1002300 Ga0182006_10023003 188
243 3300015262 Ga0182007_10000008 Ga0182007_10000008185 188
244 3300015682 Ga0183373_1002 Ga0183373_1002458 188
245 3300017792 Ga0163161_10000152 Ga0163161_1000015249 188
246 3300017792 Ga0163161_10000826 Ga0163161_1000082614 188
247 3300017792 Ga0163161_10002431 Ga0163161_100024317 188
248 3300017792 Ga0163161_10031459 Ga0163161_100314595 188
249 3300025208 Ga0209436_100817 Ga0209436_1008172 188
250 3300025245 Ga0207425_1000003 Ga0207425_100000322 188
251 3300025258 Ga0209129_1000022 Ga0209129_100002222 188
252 3300025284 Ga0209130_1002697 Ga0209130_10026974 188
253 3300025292 Ga0209676_1000022 Ga0209676_1000022444 188
254 3300025292 Ga0209676_1000812 Ga0209676_100081224 188
255 3300025294 Ga0209025_1000007 Ga0209025_100000721 188
256 3300025297 Ga0209758_1000012 Ga0209758_100001222 188
257 3300025298 Ga0209050_1000020 Ga0209050_100002095 188
258 3300025302 Ga0207426_1005846 Ga0207426_10058466 188
259 3300025728 Ga0207655_1036719 Ga0207655_10367192 188
260 3300025904 Ga0207647_10015405 Ga0207647_100154054 188
261 3300025913 Ga0207695_10013804 Ga0207695_100138045 188
262 3300025944 Ga0207661_10003171 Ga0207661_100031714 188
263 3300028379 Ga0268266_10006136 Ga0268266_100061364 188
264 3300031731 Ga0307405_10000017 Ga0307405_1000001733 188
265 3300031731 Ga0307405_10096252 Ga0307405_100962523 188
266 3300031903 Ga0307407_10000002 Ga0307407_1000000275 188
267 3300031911 Ga0307412_10000001 Ga0307412_10000001481 188
268 3300032002 Ga0307416_100000005 Ga0307416_10000000575 188
269 3300032004 Ga0307414_10000009 Ga0307414_10000009334 188
270 3300032004 Ga0307414_10001018 Ga0307414_100010182 188
271 3300032004 Ga0307414_10004141 Ga0307414_100041413 188
272 3300032004 Ga0307414_10033406 Ga0307414_100334064 188
273 3300032004 Ga0307414_10107808 Ga0307414_101078082 188
274 3300032004 Ga0307414_10416297 Ga0307414_104162971 188
275 3300032005 Ga0307411_10261542 Ga0307411_102615422 188
276 3300037312 Ga0395899_0000182 Ga0395899_0000182_17414_18007 188
277 3300041486 Ga0451807_2041958 Ga0451807_2041958_247_831 188
278 3300044658 Ga0466972_0096273 Ga0466972_0096273_596_1168 188
279 3300044693 Ga0466961_0020064 Ga0466961_0020064_3015_3596 188
280 3300044735 Ga0466968_0168319 Ga0466968_0168319_385_957 188
281 3300044842 Ga0466957_0533711 Ga0466957_0533711_164_736 188
282 3300045049 Ga0466959_0008461 Ga0466959_0008461_3550_4122 188
283 3300046453 Ga0495627_078007 Ga0495627_078007_174_758 188
284 3300046507 Ga0495606_0030901 Ga0495606_0030901_2395_2997 188
285 3300046507 Ga0495606_0148912 Ga0495606_0148912_311_892 188
286 3300046507 Ga0495606_0152574 Ga0495606_0152574_20_604 188
287 3300046512 Ga0495610_0000322 Ga0495610_0000322_20247_20831 188
288 3300046512 Ga0495610_0000948 Ga0495610_0000948_11431_12060 188
289 3300046525 Ga0495663_0002377 Ga0495663_0002377_1614_2195 188
290 3300048925 Ga0496122_0000668 Ga0496122_0000668_13463_14065 188
291 3300048926 Ga0496123_0000586 Ga0496123_0000586_4351_4953 188
292 3300048928 Ga0496125_0157020 Ga0496125_0157020_663_1265 188
293 3300049652 Ga0501202_005373 Ga0501202_005373_511_1110 188
294 3300049671 Ga0501238_006384 Ga0501238_006384_310_909 188
295 3300049679 Ga0501249_014165 Ga0501249_014165_33_617 188
296 3300049758 Ga0501241_001959 Ga0501241_001959_1225_1791 188
297 3300049761 Ga0501264_000139 Ga0501264_000139_7942_8541 188
298 3300053093 Ga0500651_0000622 Ga0500651_0000622_11071_11637 188
299 3300053136 Ga0500559_0016024 Ga0500559_0016024_230_811 188
300 3300053139 Ga0500568_0039903 Ga0500568_0039903_1215_1781 188
301 iso_pu_bacteria 2585427687 2586206468 188
302 iso_pu_bacteria 2738541302 2738852829 188
303 iso_pu_bacteria 2739367651 2739586773 188
304 iso_pu_bacteria 2739367656 2739615086 188
305 iso_pu_bacteria 2739367663 2739645780 188
306 iso_pu_bacteria 2739367874 2740057227 188
307 iso_pu_bacteria 2818991437 2819547197 188
308 iso_pu_bacteria 2842722452 2842727037 188
309 iso_pu_bacteria 2842909656 2842910961 188
310 iso_pu_bacteria 2849281842 2849283822 188
311 iso_pu_bacteria 2852627209 2852628073 188
312 iso_pu_bacteria 2857627736 2857627968 188
313 iso_pu_bacteria 2904445276 2904447673 188
314 iso_pu_bacteria 2919186247 2919188435 188
315 iso_pu_bacteria 2939664404 2939667480 188
316 iso_pu_bacteria 2945997725 2945997927 188
317 iso_pu_bacteria 2954016120 2954020407 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

28

204

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9319 5 188
6ymz-assembly5.cif.gz_E structure of the cheb methylsterase from p. atrosepticum scri1043 0.9317 6 184
6ymz-assembly3.cif.gz_C structure of the cheb methylsterase from p. atrosepticum scri1043 0.9152 2 185
6ymz-assembly1.cif.gz_A structure of the cheb methylsterase from p. atrosepticum scri1043 0.9094 2 185
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9081 5 188
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9319 5 188 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9092 6 184 3.40.50.180
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9081 5 188 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.863 6 184 3.40.50.180
af_Q7T3C7_167_349_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6509 123 176 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N0X030-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9673 3 188 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A4Q6BE72-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9635 4 187 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A5C1QD84-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9603 4 187 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A810M0B8-F1-model_v4 deleted 0.9594 11 185
AF-A0A0D8I7M1-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9592 4 185 GO:0000156
GO:0005737
GO:0006935
GO:0008984

Feature Viewer

pLDDT pTM Quality
93.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map