F404278

General Info

Members Datasets Scaffolds Average Seq Length
317 168 302 476

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0009060|Ga0453683_0009060_687_2243
Length 518
Sequence MVGFSLKIPNKGCHQLFLHLHHQITLAMIQEIQIYNTLTRKKEVFEPLVPGKVGLYVCGPTVYGPPHLGHARSAISFDLVFRFLKQIGYKVRYVRNITDVGHLVADADEGEDKIVQQAKLDELEPMEVVQKYTNMYHQSMAQLNLELPSIEPRASGHIIEQIEEVKKILNSGYAYESNGSVYFDVEKFASENDYGKLSGRKIEDLISNTRTLEGQEEKRSGLDFAIWKKAQPEHIMRWPSPWGDGFPGWHMECTAMSCKYLGDTFDIHGGGMDLTFPHHEAEMAQSQAAHGKPAVRYWMHNNMITLNGQKMGKSLGNAISLEQFFNGDHPLLGKAYSPMTIRFFMLQAHYRSTLDFSNEALQASEKGLDRLMKAFAKIDSLPVSDFSSVDVAELSANCYSAMADDMNSPIAIAYLFEGVKIINSVADGKLFLTLADRDALKLLFQVFIFDIFGLKAENEEGTGTNEVLNEVVELLMKLRAEAKANKDWTTSDKIRNELAAIGFDIKDGKDGVSWELKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
9 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
10 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
11 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
12 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
13 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
14 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
15 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
16 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
128 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
168 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.25
Nodule 0
Rhizoplane 0.63
Rhizosphere 74.76
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1859937 2162886007 Bacteria 1917
2 JGI24737J22298_10005364 3300001990 Bacteria 4432
3 JGI25162J39368_1000008 3300002737 Bacteria 397212
4 JGI25162J39368_1000889 3300002737 Bacteria 19539
5 JGI25164J39214_1001054 3300002772 Bacteria 8249
6 JGI25152J39213_1000348 3300002773 Bacteria 28979
7 JGI25150J39212_1000011 3300002774 Bacteria 195312
8 JGI25151J46595_10000033 3300003187 Bacteria 195312
9 JGI25165J46597_1000475 3300003214 Bacteria 39442
10 JGI25153J46596_10000052 3300003215 Bacteria 139303
11 rootH1_10043893 3300003316 Bacteria 13144
12 rootH1_10077216 3300003316 Bacteria 14160
13 rootH1_10077216 3300003323 Bacteria 9016
14 rootH2_10003246 3300003320 Bacteria 168239
15 rootH2_10047242 3300003320 Bacteria 23681
16 rootH2_10154016 3300003320 Bacteria 3160
17 rootL2_10168422 3300003322 Bacteria 4789
18 rootL2_10172422 3300003322 Bacteria 3692
19 rootH1_10001247 3300003323 Bacteria 32385
20 rootH1_10003785 3300003323 Bacteria 131157
21 rootH1_10085563 3300003323 Bacteria 2447
22 rootH1_10085564 3300003323 Bacteria 2468
23 rootH1_10102763 3300003323 Bacteria 6832
24 rootH1_10128735 3300003323 Bacteria 16455
25 rootH1_10230598 3300003323 Bacteria 2208
26 Ga0055536_1000016 3300003781 Bacteria 222134
27 Ga0055536_1004423 3300003781 Bacteria 7194
28 Ga0055531_10000087 3300003794 Bacteria 101553
29 Ga0065165_1000861 3300005262 Bacteria 39684
30 Ga0065165_1004000 3300005262 Bacteria 9637
31 Ga0065714_10002205 3300005288 Bacteria 57702
32 Ga0065714_10002344 3300005288 Bacteria 34779
33 Ga0065714_10002459 3300005288 Bacteria 32086
34 Ga0065714_10002764 3300005288 Bacteria 25876
35 Ga0065714_10018873 3300005288 Bacteria 2886
36 Ga0065704_10000902 3300005289 Bacteria 14950
37 Ga0065704_10070225 3300005289 Bacteria 60561
38 Ga0065704_10105463 3300005289 Bacteria 2110
39 Ga0070658_10000069 3300005327 Bacteria 101140
40 Ga0070676_10000133 3300005328 Bacteria 28281
41 Ga0068868_100084640 3300005338 Bacteria 2547
42 Ga0070660_100098515 3300005339 Bacteria 2314
43 Ga0070671_100036453 3300005355 Bacteria 4079
44 Ga0070714_100059693 3300005435 Bacteria 3271
45 Ga0070713_100216475 3300005436 Bacteria 1736
46 Ga0070678_100002854 3300005456 Bacteria 9561
47 Ga0070662_100000003 3300005457 Bacteria 239813
48 Ga0068867_100095544 3300005459 Bacteria 2261
49 Ga0068853_100039869 3300005539 Bacteria 4006
50 Ga0068853_100078445 3300005539 Bacteria 2886
51 Ga0070665_100000212 3300005548 Bacteria 100019
52 Ga0068855_100000009 3300005563 Bacteria 246035
53 Ga0068855_100000340 3300005563 Bacteria 58104
54 Ga0068855_100057540 3300005563 Bacteria 4557
55 Ga0068855_100089770 3300005563 Bacteria 3547
56 Ga0068856_100000270 3300005614 Bacteria 56564
57 Ga0068856_100003814 3300005614 Bacteria 15111
58 Ga0068856_100031701 3300005614 Bacteria 5173
59 Ga0068851_10000208 3300005834 Bacteria 27891
60 Ga0070716_100042260 3300006173 Bacteria 2544
61 Ga0075366_10000019 3300006195 Bacteria 59333
62 Ga0097621_100000205 3300006237 Bacteria 38617
63 Ga0068871_100002674 3300006358 Bacteria 12163
64 Ga0105240_10001259 3300009093 Bacteria 43960
65 Ga0105240_10074256 3300009093 Bacteria 4198
66 Ga0105240_10369086 3300009093 Bacteria 1623
67 Ga0111539_10001678 3300009094 Bacteria 29521
68 Ga0111539_10005387 3300009094 Bacteria 16546
69 Ga0105243_10000003 3300009148 Bacteria 712931
70 Ga0105241_10000926 3300009174 Bacteria 22230
71 Ga0105241_10006368 3300009174 Bacteria 8695
72 Ga0105241_10020270 3300009174 Bacteria 4912
73 Ga0105237_10000402 3300009545 Bacteria 61603
74 Ga0105237_10001805 3300009545 Bacteria 27621
75 Ga0105237_10006439 3300009545 Bacteria 13015
76 Ga0105237_10040580 3300009545 Bacteria 4693
77 Ga0105237_10042666 3300009545 Bacteria 4573
78 Ga0105237_10210354 3300009545 Bacteria 1945
79 Ga0105238_10000836 3300009551 Bacteria 31890
80 Ga0105239_10000012 3300010375 Bacteria 332279
81 Ga0105239_10000016 3300010375 Bacteria 293142
82 Ga0105239_10000285 3300010375 Bacteria 74551
83 Ga0105239_10000955 3300010375 Bacteria 40720
84 Ga0105239_10051341 3300010375 Bacteria 4521
85 Ga0157373_10000134 3300013100 Bacteria 58266
86 Ga0157373_10000325 3300013100 Bacteria 38624
87 Ga0157373_10007845 3300013100 Bacteria 7938
88 Ga0157373_10014171 3300013100 Bacteria 5847
89 Ga0157373_10026467 3300013100 Bacteria 4190
90 Ga0157371_10000482 3300013102 Bacteria 48630
91 Ga0157371_10002211 3300013102 Bacteria 18838
92 Ga0157371_10002733 3300013102 Bacteria 16615
93 Ga0157371_10006953 3300013102 Bacteria 9217
94 Ga0157371_10007594 3300013102 Bacteria 8750
95 Ga0157370_10000084 3300013104 Bacteria 104159
96 Ga0157370_10002074 3300013104 Bacteria 24535
97 Ga0157370_10006142 3300013104 Bacteria 13329
98 Ga0157370_10014942 3300013104 Bacteria 7919
99 Ga0157370_10061288 3300013104 Bacteria 3571
100 Ga0157370_10080422 3300013104 Bacteria 3068
101 Ga0157369_10000285 3300013105 Bacteria 67687
102 Ga0157369_10000301 3300013105 Bacteria 66010
103 Ga0157369_10116739 3300013105 Bacteria 2833
104 Ga0157374_10003812 3300013296 Bacteria 12663
105 Ga0157374_10005638 3300013296 Bacteria 10554
106 Ga0157378_10016561 3300013297 Bacteria 6457
107 Ga0163162_10000041 3300013306 Bacteria 132375
108 Ga0163162_10000073 3300013306 Bacteria 91871
109 Ga0157372_10000037 3300013307 Bacteria 172444
110 Ga0157372_10000683 3300013307 Bacteria 37283
111 Ga0157372_10001739 3300013307 Bacteria 23620
112 Ga0157375_10029631 3300013308 Bacteria 5151
113 Ga0157375_10031758 3300013308 Bacteria 4999
114 Ga0157375_10048279 3300013308 Bacteria 4163
115 Ga0157380_10004725 3300014326 Bacteria 9480
116 Ga0182008_10000002 3300014497 Bacteria 480216
117 Ga0182008_10000112 3300014497 Bacteria 62174
118 Ga0182008_10018201 3300014497 Bacteria 3639
119 Ga0157377_10002419 3300014745 Bacteria 8240
120 Ga0182006_1000209 3300015261 Bacteria 58193
121 Ga0182006_1000234 3300015261 Bacteria 52437
122 Ga0182006_1000386 3300015261 Bacteria 36392
123 Ga0182006_1001686 3300015261 Bacteria 12930
124 Ga0182007_10000016 3300015262 Bacteria 202375
125 Ga0183373_1011 3300015682 Bacteria 138873
126 Ga0163161_10000844 3300017792 Bacteria 23904
127 Ga0163161_10002175 3300017792 Bacteria 14134
128 Ga0163161_10002717 3300017792 Bacteria 12571
129 Ga0163161_10006690 3300017792 Bacteria 7977
130 Ga0207427_100076 3300025231 Bacteria 149885
131 Ga0209437_100008 3300025233 Bacteria 921142
132 Ga0209437_100030 3300025233 Bacteria 532466
133 Ga0207425_1000003 3300025245 Bacteria 1145342
134 Ga0209026_1000243 3300025250 Bacteria 69921
135 Ga0209026_1001779 3300025250 Bacteria 8908
136 Ga0209129_1000076 3300025258 Bacteria 195353
137 Ga0209233_1000510 3300025261 Bacteria 23011
138 Ga0209233_1000657 3300025261 Bacteria 16808
139 Ga0209676_1000106 3300025292 Bacteria 222576
140 Ga0209676_1000363 3300025292 Bacteria 85613
141 Ga0209025_1000007 3300025294 Bacteria 1145109
142 Ga0209758_1000114 3300025297 Bacteria 199324
143 Ga0209050_1000174 3300025298 Bacteria 148871
144 Ga0209050_1013796 3300025298 Bacteria 3551
145 Ga0209050_1025896 3300025298 Bacteria 1979
146 Ga0209257_1000006 3300025304 Bacteria 1570111
147 Ga0207656_10000475 3300025321 Bacteria 13390
148 Ga0207647_10000080 3300025904 Bacteria 71854
149 Ga0207645_10000014 3300025907 Bacteria 117512
150 Ga0207705_10000293 3300025909 Bacteria 46583
151 Ga0207654_10002186 3300025911 Bacteria 10002
152 Ga0207654_10008945 3300025911 Bacteria 5079
153 Ga0207695_10000183 3300025913 Bacteria 181350
154 Ga0207695_10012055 3300025913 Bacteria 10394
155 Ga0207695_10036209 3300025913 Bacteria 5338
156 Ga0207695_10098002 3300025913 Bacteria 2931
157 Ga0207671_10000477 3300025914 Bacteria 54330
158 Ga0207671_10009490 3300025914 Bacteria 8128
159 Ga0207671_10010685 3300025914 Bacteria 7551
160 Ga0207671_10011958 3300025914 Bacteria 7016
161 Ga0207671_10013789 3300025914 Bacteria 6418
162 Ga0207671_10065068 3300025914 Bacteria 2711
163 Ga0207700_10063492 3300025928 Bacteria 2809
164 Ga0207644_10069522 3300025931 Bacteria 2571
165 Ga0207690_10004771 3300025932 Bacteria 7996
166 Ga0207706_10000009 3300025933 Bacteria 200607
167 Ga0207709_10000008 3300025935 Bacteria 713099
168 Ga0207667_10000045 3300025949 Bacteria 246053
169 Ga0207667_10002439 3300025949 Bacteria 23287
170 Ga0207640_10015678 3300025981 Bacteria 4391
171 Ga0207639_10013793 3300026041 Bacteria 5666
172 Ga0207702_10000389 3300026078 Bacteria 50060
173 Ga0207702_10016579 3300026078 Bacteria 6097
174 Ga0207702_10021570 3300026078 Bacteria 5334
175 Ga0207648_10000963 3300026089 Bacteria 32564
176 Ga0207683_10003023 3300026121 Bacteria 14688
177 Ga0207698_10009599 3300026142 Bacteria 6178
178 Ga0207428_10042649 3300027907 Bacteria 3668
179 Ga0268266_10000177 3300028379 Bacteria 114318
180 Ga0307517_10005979 3300028786 Bacteria 18152
181 Ga0307515_10000681 3300028794 Bacteria 78150
182 Ga0307515_10020260 3300028794 Bacteria 11878
183 Ga0307515_10192854 3300028794 Bacteria 1941
184 Ga0265327_10005188 3300031251 Bacteria 11015
185 Ga0265327_10007181 3300031251 Bacteria 8671
186 Ga0307509_10091972 3300031507 Bacteria 3103
187 Ga0307408_100000308 3300031548 Bacteria 46821
188 Ga0307408_100000527 3300031548 Bacteria 33024
189 Ga0307408_100011316 3300031548 Bacteria 5896
190 Ga0307514_10034397 3300031649 Bacteria 4039
191 Ga0307405_10000023 3300031731 Bacteria 141450
192 Ga0307406_10000031 3300031901 Bacteria 87391
193 Ga0307407_10000016 3300031903 Bacteria 141499
194 Ga0307412_10000038 3300031911 Bacteria 187857
195 Ga0307412_10139226 3300031911 Bacteria 1775
196 Ga0307416_100000036 3300032002 Bacteria 141505
197 Ga0307416_100058292 3300032002 Bacteria 3130
198 Ga0307414_10001004 3300032004 Bacteria 14421
199 Ga0307414_10001297 3300032004 Bacteria 12915
200 Ga0307414_10014662 3300032004 Bacteria 4708
201 Ga0307414_10044424 3300032004 Bacteria 3034
202 Ga0307414_10046588 3300032004 Bacteria 2977
203 Ga0307414_10057880 3300032004 Bacteria 2727
204 Ga0307414_10142438 3300032004 Bacteria 1879
205 Ga0307510_10000172 3300033180 Bacteria 54812
206 Ga0373927_0019932 3300035695 Bacteria 4398
207 Ga0395899_0000017 3300037312 Bacteria 440179
208 Ga0395899_0000280 3300037312 Bacteria 66580
209 Ga0395899_0000681 3300037312 Bacteria 34363
210 Ga0395899_0012280 3300037312 Bacteria 6561
211 Ga0395900_0000658 3300037418 Bacteria 46240
212 Ga0395900_0006070 3300037418 Bacteria 12600
213 Ga0395898_0004739 3300037466 Bacteria 14802
214 Ga0395905_0004172 3300037471 Bacteria 15110
215 Ga0395901_0001153 3300038443 Bacteria 28037
216 Ga0395901_0069918 3300038443 Bacteria 3657
217 Ga0395901_0144805 3300038443 Bacteria 2498
218 Ga0400489_09436 3300039093 Bacteria 2154
219 Ga0451795_0130692 3300041456 Bacteria 4110
220 Ga0451577_0000027 3300042876 Bacteria 397014
221 Ga0451577_0000030 3300042876 Bacteria 391423
222 Ga0451577_0005167 3300042876 Bacteria 13423
223 Ga0451577_0018424 3300042876 Bacteria 6432
224 Ga0451577_0051166 3300042876 Bacteria 3688
225 Ga0451577_0058526 3300042876 Bacteria 3435
226 Ga0451577_0173639 3300042876 Bacteria 1942
227 Ga0453683_0000771 3300044673 Bacteria 31804
228 Ga0453683_0001512 3300044673 Bacteria 19846
229 Ga0453683_0001678 3300044673 Bacteria 18516
230 Ga0453683_0008220 3300044673 Bacteria 7017
231 Ga0453683_0009060 3300044673 Bacteria 6646
232 Ga0453683_0011004 3300044673 Bacteria 5982
233 Ga0453683_0021091 3300044673 Bacteria 4161
234 Ga0466961_0043539 3300044693 Bacteria 2875
235 Ga0453684_0000154 3300044712 Bacteria 305062
236 Ga0453684_0000260 3300044712 Bacteria 227076
237 Ga0453684_0001331 3300044712 Bacteria 72658
238 Ga0453684_0001578 3300044712 Bacteria 63028
239 Ga0453684_0005272 3300044712 Bacteria 25841
240 Ga0453684_0005375 3300044712 Bacteria 25455
241 Ga0453684_0014997 3300044712 Bacteria 12306
242 Ga0453684_0028652 3300044712 Bacteria 7937
243 Ga0453684_0033062 3300044712 Bacteria 7217
244 Ga0453684_0060267 3300044712 Bacteria 4884
245 Ga0453684_0084458 3300044712 Bacteria 3948
246 Ga0453684_0094602 3300044712 Bacteria 3675
247 Ga0453684_0210232 3300044712 Bacteria 2262
248 Ga0451576_0000032 3300045051 Bacteria 397014
249 Ga0451576_0000103 3300045051 Bacteria 217967
250 Ga0451576_0000638 3300045051 Bacteria 72729
251 Ga0451576_0005599 3300045051 Bacteria 15698
252 Ga0451576_0006463 3300045051 Bacteria 14370
253 Ga0451576_0013412 3300045051 Bacteria 9168
254 Ga0451576_0028080 3300045051 Bacteria 6032
255 Ga0451576_0098732 3300045051 Bacteria 3037
256 Ga0466958_0075439 3300045836 Bacteria 2068
257 Ga0466967_0025600 3300045976 Bacteria 4869
258 Ga0495638_0000156 3300046460 Bacteria 107923
259 Ga0495650_0000050 3300046471 Bacteria 318894
260 Ga0495585_0000560 3300046492 Bacteria 35150
261 Ga0495596_0039814 3300046500 Bacteria 1856
262 Ga0495606_0000581 3300046507 Bacteria 58129
263 Ga0495606_0003028 3300046507 Bacteria 18381
264 Ga0495610_0000119 3300046512 Bacteria 89692
265 Ga0495610_0000614 3300046512 Bacteria 35222
266 Ga0495610_0000790 3300046512 Bacteria 29672
267 Ga0495616_0000296 3300046513 Bacteria 40157
268 Ga0495637_0012016 3300046520 Bacteria 4152
269 Ga0495609_0029108 3300046538 Bacteria 2517
270 Ga0495633_0004180 3300046558 Bacteria 9270
271 Ga0495625_0000077 3300046660 Bacteria 163166
272 Ga0495625_0093428 3300046660 Bacteria 2077
273 Ga0495661_0006157 3300046665 Bacteria 8442
274 Ga0495649_0000011 3300046694 Bacteria 416695
275 Ga0495687_000409 3300047443 Bacteria 53157
276 Ga0495687_000921 3300047443 Bacteria 30536
277 Ga0495686_0006002 3300047472 Bacteria 9443
278 Ga0495686_0074365 3300047472 Bacteria 2085
279 Ga0496116_0002886 3300048919 Bacteria 17589
280 Ga0496117_0001624 3300048920 Bacteria 31775
281 Ga0496122_0005748 3300048925 Bacteria 14614
282 Ga0496122_0027611 3300048925 Bacteria 4845
283 Ga0496123_0002926 3300048926 Bacteria 19984
284 Ga0496123_0015356 3300048926 Bacteria 6285
285 Ga0496125_0141164 3300048928 Bacteria 1675
286 Ga0501300_000687 3300049523 Bacteria 5069
287 Ga0501238_003630 3300049671 Bacteria 1904
288 nmdc:mga0k408_65_c1 3300050493 Bacteria 52329
289 nmdc:mga08y16_5136_c1 3300050511 Bacteria 13684
290 nmdc:mga08y16_8292_c1 3300050511 Bacteria 10872
291 Ga0500635_0000649 3300053080 Bacteria 8870
292 Ga0500635_0006071 3300053080 Bacteria 3209
293 Ga0500651_0000589 3300053093 Bacteria 18247
294 Ga0500562_000231 3300053108 Bacteria 14654
295 Ga0500608_000857 3300053122 Bacteria 10992
296 Ga0500604_0001636 3300053151 Bacteria 6296
297 Ga0500616_0000082 3300053153 Bacteria 198665
298 Ga0500616_0066473 3300053153 Bacteria 1851
299 Ga0500622_0000003 3300053156 Bacteria 613483
300 Ga0500622_0000008 3300053156 Bacteria 423636
301 Ga0500622_0003652 3300053156 Bacteria 10113
302 Ga0500634_0079136 3300053161 Bacteria 1699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10230598 rootH1_102305982 398
2 3300053093 Ga0500651_0000589 Ga0500651_0000589_12997_14232 405
3 3300039093 Ga0400489_09436 Ga0400489_09436_55_1350 420
4 3300005262 Ga0065165_1004000 Ga0065165_10040005 433
5 3300042876 Ga0451577_0018424 Ga0451577_0018424_4217_5719 433
6 3300044712 Ga0453684_0014997 Ga0453684_0014997_4470_5972 433
7 3300042876 Ga0451577_0051166 Ga0451577_0051166_1844_3349 434
8 3300044673 Ga0453683_0021091 Ga0453683_0021091_1561_3066 434
9 3300044712 Ga0453684_0084458 Ga0453684_0084458_2351_3856 434
10 3300045051 Ga0451576_0006463 Ga0451576_0006463_8664_10169 434
11 3300045976 Ga0466967_0025600 Ga0466967_0025600_499_1917 434
12 3300053108 Ga0500562_000231 Ga0500562_000231_2954_4363 436
13 3300003316 rootH1_10077216 rootH1_100772165 438
14 3300003323 rootH1_10003785 rootH1_10003785115 438
15 3300003323 rootH1_10085563 rootH1_100855632 438
16 3300003323 rootH1_10085564 rootH1_100855642 438
17 3300026078 Ga0207702_10021570 Ga0207702_100215704 438
18 3300046500 Ga0495596_0039814 Ga0495596_0039814_28_1410 438
19 3300003320 rootH2_10003246 rootH2_100032463 440
20 3300003323 rootH1_10001247 rootH1_1000124728 440
21 3300031901 Ga0307406_10000031 Ga0307406_1000003183 440
22 3300013296 Ga0157374_10005638 Ga0157374_1000563810 441
23 3300005563 Ga0068855_100089770 Ga0068855_1000897701 443
24 3300009093 Ga0105240_10074256 Ga0105240_100742563 443
25 3300025913 Ga0207695_10098002 Ga0207695_100980021 443
26 3300033180 Ga0307510_10000172 Ga0307510_1000017232 443
27 3300005327 Ga0070658_10000069 Ga0070658_1000006913 444
28 3300025909 Ga0207705_10000293 Ga0207705_1000029313 444
29 3300041456 Ga0451795_0130692 Ga0451795_0130692_1667_3130 446
30 3300009094 Ga0111539_10001678 Ga0111539_100016787 450
31 3300014326 Ga0157380_10004725 Ga0157380_100047255 450
32 3300050511 nmdc:mga08y16_5136_c1 nmdc:mga08y16_5136_c1_6082_7587 450
33 3300025298 Ga0209050_1025896 Ga0209050_10258962 451
34 3300046460 Ga0495638_0000156 Ga0495638_0000156_105316_106821 451
35 3300053153 Ga0500616_0000082 Ga0500616_0000082_96286_97791 451
36 3300053080 Ga0500635_0000649 Ga0500635_0000649_6152_7615 456
37 3300032004 Ga0307414_10014662 Ga0307414_100146624 461
38 3300042876 Ga0451577_0000030 Ga0451577_0000030_204016_205491 463
39 3300044673 Ga0453683_0001512 Ga0453683_0001512_9407_10882 463
40 3300044712 Ga0453684_0000260 Ga0453684_0000260_204473_205948 463
41 3300045051 Ga0451576_0000103 Ga0451576_0000103_192975_194450 463
42 3300045051 Ga0451576_0013412 Ga0451576_0013412_316_1791 463
43 3300002737 JGI25162J39368_1000889 JGI25162J39368_100088918 464
44 3300002772 JGI25164J39214_1001054 JGI25164J39214_10010544 464
45 3300003214 JGI25165J46597_1000475 JGI25165J46597_100047510 464
46 3300003316 rootH1_10043893 rootH1_100438938 464
47 3300005457 Ga0070662_100000003 Ga0070662_100000003111 464
48 3300005563 Ga0068855_100000340 Ga0068855_10000034010 464
49 3300005614 Ga0068856_100003814 Ga0068856_1000038143 464
50 3300006195 Ga0075366_10000019 Ga0075366_100000194 464
51 3300009174 Ga0105241_10000926 Ga0105241_1000092611 464
52 3300009545 Ga0105237_10210354 Ga0105237_102103542 464
53 3300013100 Ga0157373_10014171 Ga0157373_100141712 464
54 3300013308 Ga0157375_10048279 Ga0157375_100482793 464
55 3300014745 Ga0157377_10002419 Ga0157377_100024193 464
56 3300025231 Ga0207427_100076 Ga0207427_100076133 464
57 3300025233 Ga0209437_100008 Ga0209437_10000814 464
58 3300025261 Ga0209233_1000510 Ga0209233_100051014 464
59 3300025911 Ga0207654_10002186 Ga0207654_100021862 464
60 3300025913 Ga0207695_10036209 Ga0207695_100362093 464
61 3300025933 Ga0207706_10000009 Ga0207706_10000009120 464
62 3300025949 Ga0207667_10002439 Ga0207667_100024398 464
63 3300037312 Ga0395899_0012280 Ga0395899_0012280_1204_2667 464
64 3300037418 Ga0395900_0006070 Ga0395900_0006070_918_2381 464
65 3300038443 Ga0395901_0144805 Ga0395901_0144805_204_1667 464
66 3300046471 Ga0495650_0000050 Ga0495650_0000050_213719_215185 464
67 3300046492 Ga0495585_0000560 Ga0495585_0000560_22527_23993 464
68 3300046507 Ga0495606_0000581 Ga0495606_0000581_38229_39695 464
69 3300046512 Ga0495610_0000614 Ga0495610_0000614_1873_3339 464
70 3300046513 Ga0495616_0000296 Ga0495616_0000296_3853_5319 464
71 3300046538 Ga0495609_0029108 Ga0495609_0029108_665_2131 464
72 3300046558 Ga0495633_0004180 Ga0495633_0004180_4194_5660 464
73 3300046660 Ga0495625_0000077 Ga0495625_0000077_51985_53451 464
74 3300046665 Ga0495661_0006157 Ga0495661_0006157_1431_2897 464
75 3300046694 Ga0495649_0000011 Ga0495649_0000011_145013_146479 464
76 3300047443 Ga0495687_000921 Ga0495687_000921_22078_23544 464
77 3300050493 nmdc:mga0k408_65_c1 nmdc:mga0k408_65_c1_46239_47702 464
78 3300053080 Ga0500635_0006071 Ga0500635_0006071_975_2438 464
79 3300003320 rootH2_10047242 rootH2_100472421 465
80 3300003794 Ga0055531_10000087 Ga0055531_1000008772 465
81 3300005328 Ga0070676_10000133 Ga0070676_100001335 465
82 3300005355 Ga0070671_100036453 Ga0070671_1000364533 465
83 3300005456 Ga0070678_100002854 Ga0070678_1000028547 465
84 3300005459 Ga0068867_100095544 Ga0068867_1000955442 465
85 3300005539 Ga0068853_100039869 Ga0068853_1000398693 465
86 3300005539 Ga0068853_100078445 Ga0068853_1000784452 465
87 3300005548 Ga0070665_100000212 Ga0070665_10000021258 465
88 3300005563 Ga0068855_100057540 Ga0068855_1000575402 465
89 3300006237 Ga0097621_100000205 Ga0097621_10000020524 465
90 3300006358 Ga0068871_100002674 Ga0068871_1000026743 465
91 3300009174 Ga0105241_10020270 Ga0105241_100202703 465
92 3300009545 Ga0105237_10006439 Ga0105237_100064393 465
93 3300009551 Ga0105238_10000836 Ga0105238_1000083613 465
94 3300010375 Ga0105239_10000012 Ga0105239_10000012102 465
95 3300010375 Ga0105239_10051341 Ga0105239_100513414 465
96 3300013296 Ga0157374_10003812 Ga0157374_100038127 465
97 3300013297 Ga0157378_10016561 Ga0157378_100165616 465
98 3300013306 Ga0163162_10000041 Ga0163162_100000414 465
99 3300013308 Ga0157375_10029631 Ga0157375_100296315 465
100 3300013308 Ga0157375_10031758 Ga0157375_100317584 465
101 3300025304 Ga0209257_1000006 Ga0209257_1000006397 465
102 3300025907 Ga0207645_10000014 Ga0207645_1000001438 465
103 3300025913 Ga0207695_10012055 Ga0207695_100120555 465
104 3300025914 Ga0207671_10009490 Ga0207671_100094902 465
105 3300025914 Ga0207671_10011958 Ga0207671_100119584 465
106 3300025931 Ga0207644_10069522 Ga0207644_100695223 465
107 3300026041 Ga0207639_10013793 Ga0207639_100137933 465
108 3300026089 Ga0207648_10000963 Ga0207648_100009637 465
109 3300026121 Ga0207683_10003023 Ga0207683_100030237 465
110 3300026142 Ga0207698_10009599 Ga0207698_100095995 465
111 3300028379 Ga0268266_10000177 Ga0268266_1000017762 465
112 3300028786 Ga0307517_10005979 Ga0307517_1000597912 465
113 3300031911 Ga0307412_10139226 Ga0307412_101392261 465
114 3300037312 Ga0395899_0000681 Ga0395899_0000681_5879_7342 465
115 3300037418 Ga0395900_0000658 Ga0395900_0000658_17880_19343 465
116 3300037466 Ga0395898_0004739 Ga0395898_0004739_1361_2824 465
117 3300037471 Ga0395905_0004172 Ga0395905_0004172_795_2258 465
118 3300038443 Ga0395901_0001153 Ga0395901_0001153_5453_6916 465
119 3300047443 Ga0495687_000409 Ga0495687_000409_14033_15496 465
120 3300053122 Ga0500608_000857 Ga0500608_000857_7984_9447 465
121 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008141 466
122 3300005614 Ga0068856_100000270 Ga0068856_1000002709 466
123 3300009545 Ga0105237_10040580 Ga0105237_100405803 466
124 3300009545 Ga0105237_10042666 Ga0105237_100426663 466
125 3300010375 Ga0105239_10000016 Ga0105239_10000016107 466
126 3300010375 Ga0105239_10000285 Ga0105239_100002855 466
127 3300017792 Ga0163161_10002175 Ga0163161_100021757 466
128 3300025233 Ga0209437_100030 Ga0209437_100030247 466
129 3300025250 Ga0209026_1001779 Ga0209026_10017796 466
130 3300025914 Ga0207671_10010685 Ga0207671_100106856 466
131 3300025914 Ga0207671_10013789 Ga0207671_100137893 466
132 3300025981 Ga0207640_10015678 Ga0207640_100156784 466
133 3300026078 Ga0207702_10000389 Ga0207702_1000038933 466
134 3300047472 Ga0495686_0006002 Ga0495686_0006002_1993_3456 466
135 3300003322 rootL2_10172422 rootL2_101724222 469
136 3300003781 Ga0055536_1004423 Ga0055536_10044238 470
137 3300005262 Ga0065165_1000861 Ga0065165_100086115 470
138 3300013100 Ga0157373_10000134 Ga0157373_100001347 470
139 3300025292 Ga0209676_1000363 Ga0209676_100036315 470
140 3300025298 Ga0209050_1013796 Ga0209050_10137963 470
141 3300032004 Ga0307414_10057880 Ga0307414_100578803 470
142 iso_pu_bacteria 2911138879 2911139480 471
143 3300002773 JGI25152J39213_1000348 JGI25152J39213_100034812 473
144 3300002774 JGI25150J39212_1000011 JGI25150J39212_100001112 473
145 3300003187 JGI25151J46595_10000033 JGI25151J46595_1000003312 473
146 3300003215 JGI25153J46596_10000052 JGI25153J46596_10000052112 473
147 3300015682 Ga0183373_1011 Ga0183373_101131 473
148 3300025245 Ga0207425_1000003 Ga0207425_1000003844 473
149 3300025258 Ga0209129_1000076 Ga0209129_100007612 473
150 3300025294 Ga0209025_1000007 Ga0209025_1000007843 473
151 3300025297 Ga0209758_1000114 Ga0209758_1000114155 473
152 3300044673 Ga0453683_0008220 Ga0453683_0008220_1697_3172 473
153 3300045051 Ga0451576_0098732 Ga0451576_0098732_1014_2489 473
154 3300028794 Ga0307515_10000681 Ga0307515_1000068133 476
155 3300028794 Ga0307515_10192854 Ga0307515_101928542 476
156 3300031649 Ga0307514_10034397 Ga0307514_100343973 476
157 iso_pu_bacteria 2522125168 2522553635 476
158 iso_pu_bacteria 2585427687 2586209881 476
159 iso_pu_bacteria 2599185184 2599480712 476
160 iso_pu_bacteria 2721755487 2722730673 476
161 iso_pu_bacteria 2738541283 2738758903 476
162 iso_pu_bacteria 2738543023 2739302019 476
163 iso_pu_bacteria 2896344016 2896346025 476
164 iso_pu_bacteria 2904780799 2904785054 476
165 iso_pu_bacteria 2919177583 2919181624 476
166 iso_pu_bacteria 2919437846 2919439878 476
167 iso_pu_bacteria 2928078545 2928081605 476
168 iso_pu_bacteria 2928147474 2928150366 476
169 iso_pu_bacteria 2932082852 2932085191 476
170 iso_pu_bacteria 2977232053 2977234461 476
171 iso_pu_bacteria 8055588893 8055590836 476
172 3300053151 Ga0500604_0001636 Ga0500604_0001636_2842_4341 477
173 3300053156 Ga0500622_0000003 Ga0500622_0000003_236351_237850 477
174 3300053156 Ga0500622_0000008 Ga0500622_0000008_30618_32117 477
175 3300005288 Ga0065714_10018873 Ga0065714_100188732 478
176 3300005435 Ga0070714_100059693 Ga0070714_1000596932 478
177 3300005436 Ga0070713_100216475 Ga0070713_1002164752 478
178 3300005614 Ga0068856_100031701 Ga0068856_1000317015 478
179 3300005834 Ga0068851_10000208 Ga0068851_1000020817 478
180 3300025321 Ga0207656_10000475 Ga0207656_100004753 478
181 3300025928 Ga0207700_10063492 Ga0207700_100634922 478
182 3300026078 Ga0207702_10016579 Ga0207702_100165792 478
183 3300031251 Ga0265327_10005188 Ga0265327_100051884 478
184 3300042876 Ga0451577_0000027 Ga0451577_0000027_229729_231198 478
185 3300044673 Ga0453683_0001678 Ga0453683_0001678_4818_6287 478
186 3300044712 Ga0453684_0000154 Ga0453684_0000154_137777_139246 478
187 3300045051 Ga0451576_0000032 Ga0451576_0000032_165817_167286 478
188 3300003322 rootL2_10168422 rootL2_101684223 479
189 3300003781 Ga0055536_1000016 Ga0055536_100001681 479
190 3300005288 Ga0065714_10002205 Ga0065714_1000220528 479
191 3300005288 Ga0065714_10002344 Ga0065714_1000234416 479
192 3300005288 Ga0065714_10002459 Ga0065714_1000245925 479
193 3300005288 Ga0065714_10002764 Ga0065714_1000276423 479
194 3300005289 Ga0065704_10070225 Ga0065704_1007022523 479
195 3300009094 Ga0111539_10005387 Ga0111539_100053873 479
196 3300009545 Ga0105237_10000402 Ga0105237_1000040235 479
197 3300013100 Ga0157373_10000325 Ga0157373_1000032514 479
198 3300013100 Ga0157373_10026467 Ga0157373_100264674 479
199 3300013102 Ga0157371_10000482 Ga0157371_1000048227 479
200 3300013102 Ga0157371_10002733 Ga0157371_100027336 479
201 3300013102 Ga0157371_10007594 Ga0157371_100075944 479
202 3300013104 Ga0157370_10000084 Ga0157370_1000008483 479
203 3300013104 Ga0157370_10014942 Ga0157370_100149423 479
204 3300013104 Ga0157370_10061288 Ga0157370_100612882 479
205 3300013104 Ga0157370_10080422 Ga0157370_100804221 479
206 3300013105 Ga0157369_10000285 Ga0157369_1000028531 479
207 3300013105 Ga0157369_10116739 Ga0157369_101167392 479
208 3300013306 Ga0163162_10000073 Ga0163162_1000007313 479
209 3300014497 Ga0182008_10000002 Ga0182008_10000002342 479
210 3300014497 Ga0182008_10000112 Ga0182008_1000011250 479
211 3300014497 Ga0182008_10018201 Ga0182008_100182013 479
212 3300015261 Ga0182006_1000209 Ga0182006_10002095 479
213 3300015261 Ga0182006_1000234 Ga0182006_100023441 479
214 3300015261 Ga0182006_1000386 Ga0182006_100038621 479
215 3300015261 Ga0182006_1001686 Ga0182006_10016864 479
216 3300015262 Ga0182007_10000016 Ga0182007_1000001661 479
217 3300017792 Ga0163161_10000844 Ga0163161_1000084426 479
218 3300017792 Ga0163161_10002717 Ga0163161_1000271712 479
219 3300017792 Ga0163161_10006690 Ga0163161_100066903 479
220 3300025292 Ga0209676_1000106 Ga0209676_1000106123 479
221 3300025298 Ga0209050_1000174 Ga0209050_100017435 479
222 3300025914 Ga0207671_10065068 Ga0207671_100650682 479
223 3300027907 Ga0207428_10042649 Ga0207428_100426492 479
224 3300028794 Ga0307515_10020260 Ga0307515_100202607 479
225 3300031548 Ga0307408_100000527 Ga0307408_1000005275 479
226 3300031548 Ga0307408_100011316 Ga0307408_1000113165 479
227 3300031731 Ga0307405_10000023 Ga0307405_10000023126 479
228 3300031903 Ga0307407_10000016 Ga0307407_1000001689 479
229 3300031911 Ga0307412_10000038 Ga0307412_100000389 479
230 3300032002 Ga0307416_100000036 Ga0307416_10000003689 479
231 3300032004 Ga0307414_10001004 Ga0307414_100010044 479
232 3300032004 Ga0307414_10001297 Ga0307414_100012974 479
233 3300032004 Ga0307414_10046588 Ga0307414_100465883 479
234 3300044712 Ga0453684_0005375 Ga0453684_0005375_8902_10368 479
235 3300046512 Ga0495610_0000119 Ga0495610_0000119_59165_60625 479
236 3300046512 Ga0495610_0000790 Ga0495610_0000790_1928_3388 479
237 3300046520 Ga0495637_0012016 Ga0495637_0012016_1263_2723 479
238 3300048925 Ga0496122_0005748 Ga0496122_0005748_11183_12643 479
239 3300048926 Ga0496123_0002926 Ga0496123_0002926_9941_11401 479
240 3300049523 Ga0501300_000687 Ga0501300_000687_2856_4361 479
241 3300049671 Ga0501238_003630 Ga0501238_003630_55_1560 479
242 3300050511 nmdc:mga08y16_8292_c1 nmdc:mga08y16_8292_c1_27_1532 479
243 3300053161 Ga0500634_0079136 Ga0500634_0079136_147_1667 479
244 2162886007 SwRhRL2b_contig_1859937 SwRhRL2b_0928.00004060 480
245 3300001990 JGI24737J22298_10005364 JGI24737J22298_100053642 480
246 3300003320 rootH2_10154016 rootH2_101540163 480
247 3300003323 rootH1_10102763 rootH1_101027633 480
248 3300003323 rootH1_10128735 rootH1_1012873517 480
249 3300005289 Ga0065704_10000902 Ga0065704_100009029 480
250 3300005289 Ga0065704_10105463 Ga0065704_101054632 480
251 3300005338 Ga0068868_100084640 Ga0068868_1000846402 480
252 3300005339 Ga0070660_100098515 Ga0070660_1000985152 480
253 3300005563 Ga0068855_100000009 Ga0068855_100000009141 480
254 3300006173 Ga0070716_100042260 Ga0070716_1000422602 480
255 3300009093 Ga0105240_10001259 Ga0105240_1000125923 480
256 3300009093 Ga0105240_10369086 Ga0105240_103690861 480
257 3300009148 Ga0105243_10000003 Ga0105243_10000003431 480
258 3300009174 Ga0105241_10006368 Ga0105241_100063687 480
259 3300009545 Ga0105237_10001805 Ga0105237_100018054 480
260 3300010375 Ga0105239_10000955 Ga0105239_1000095541 480
261 3300013100 Ga0157373_10007845 Ga0157373_100078452 480
262 3300013102 Ga0157371_10002211 Ga0157371_1000221111 480
263 3300013102 Ga0157371_10006953 Ga0157371_100069534 480
264 3300013104 Ga0157370_10002074 Ga0157370_100020745 480
265 3300013104 Ga0157370_10006142 Ga0157370_100061424 480
266 3300013105 Ga0157369_10000301 Ga0157369_100003018 480
267 3300013307 Ga0157372_10000037 Ga0157372_10000037141 480
268 3300013307 Ga0157372_10000683 Ga0157372_1000068320 480
269 3300013307 Ga0157372_10001739 Ga0157372_1000173910 480
270 3300025250 Ga0209026_1000243 Ga0209026_100024316 480
271 3300025261 Ga0209233_1000657 Ga0209233_10006579 480
272 3300025904 Ga0207647_10000080 Ga0207647_1000008052 480
273 3300025911 Ga0207654_10008945 Ga0207654_100089452 480
274 3300025913 Ga0207695_10000183 Ga0207695_10000183146 480
275 3300025914 Ga0207671_10000477 Ga0207671_1000047724 480
276 3300025932 Ga0207690_10004771 Ga0207690_100047714 480
277 3300025935 Ga0207709_10000008 Ga0207709_10000008142 480
278 3300025949 Ga0207667_10000045 Ga0207667_1000004594 480
279 3300031251 Ga0265327_10007181 Ga0265327_100071815 480
280 3300031507 Ga0307509_10091972 Ga0307509_100919722 480
281 3300031548 Ga0307408_100000308 Ga0307408_10000030830 480
282 3300032002 Ga0307416_100058292 Ga0307416_1000582922 480
283 3300032004 Ga0307414_10044424 Ga0307414_100444243 480
284 3300032004 Ga0307414_10142438 Ga0307414_101424381 480
285 3300035695 Ga0373927_0019932 Ga0373927_0019932_1003_2511 480
286 3300037312 Ga0395899_0000017 Ga0395899_0000017_33953_35413 480
287 3300037312 Ga0395899_0000280 Ga0395899_0000280_56597_58057 480
288 3300038443 Ga0395901_0069918 Ga0395901_0069918_1228_2688 480
289 3300042876 Ga0451577_0005167 Ga0451577_0005167_6341_7816 480
290 3300042876 Ga0451577_0058526 Ga0451577_0058526_880_2355 480
291 3300042876 Ga0451577_0173639 Ga0451577_0173639_216_1691 480
292 3300044673 Ga0453683_0000771 Ga0453683_0000771_8157_9632 480
293 3300044673 Ga0453683_0009060 Ga0453683_0009060_687_2243 480
294 3300044673 Ga0453683_0011004 Ga0453683_0011004_1373_2929 480
295 3300044693 Ga0466961_0043539 Ga0466961_0043539_511_1971 480
296 3300044712 Ga0453684_0001331 Ga0453684_0001331_32467_33942 480
297 3300044712 Ga0453684_0001578 Ga0453684_0001578_21097_22572 480
298 3300044712 Ga0453684_0005272 Ga0453684_0005272_8760_10316 480
299 3300044712 Ga0453684_0028652 Ga0453684_0028652_3157_4626 480
300 3300044712 Ga0453684_0033062 Ga0453684_0033062_1970_3514 480
301 3300044712 Ga0453684_0060267 Ga0453684_0060267_810_2285 480
302 3300044712 Ga0453684_0094602 Ga0453684_0094602_2136_3611 480
303 3300044712 Ga0453684_0210232 Ga0453684_0210232_157_1635 480
304 3300045051 Ga0451576_0000638 Ga0451576_0000638_38788_40263 480
305 3300045051 Ga0451576_0005599 Ga0451576_0005599_9437_10912 480
306 3300045051 Ga0451576_0028080 Ga0451576_0028080_3105_4661 480
307 3300045836 Ga0466958_0075439 Ga0466958_0075439_395_1855 480
308 3300046507 Ga0495606_0003028 Ga0495606_0003028_2936_4396 480
309 3300046660 Ga0495625_0093428 Ga0495625_0093428_234_1745 480
310 3300047472 Ga0495686_0074365 Ga0495686_0074365_540_2000 480
311 3300048919 Ga0496116_0002886 Ga0496116_0002886_6931_8397 480
312 3300048920 Ga0496117_0001624 Ga0496117_0001624_6799_8265 480
313 3300048925 Ga0496122_0027611 Ga0496122_0027611_2014_3480 480
314 3300048926 Ga0496123_0015356 Ga0496123_0015356_1973_3439 480
315 3300048928 Ga0496125_0141164 Ga0496125_0141164_114_1580 480
316 3300053153 Ga0500616_0066473 Ga0500616_0066473_208_1716 480
317 3300053156 Ga0500622_0003652 Ga0500622_0003652_3485_4993 480

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01406

tRNA-synt_1e

tRNA synthetases class I (C) catalytic domain

44

366

0.93

PF23493

466

514

0.92

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

56

194

0.8

PF09190

DALR_2

DALR domain

397

454

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ujd-assembly1.cif.gz_A-2 crystal structure of cysteine-trna ligase from elizabethkingia sp. 0.9678 4 424
6ujd-assembly1.cif.gz_A-2 crystal structure of cysteine-trna ligase from elizabethkingia sp. 0.9608 4 424
1li5-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase 0.9115 5 425
1li7-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9115 5 425
3c8z-assembly1.cif.gz_A the 1.6 a crystal structure of mshc: the rate limiting enzyme in the mycothiol biosynthetic pathway 0.9001 4 423
ID Description Score Start End Superfamily
3sp1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9563 5 324 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9544 5 324 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9483 5 324 3.40.50.620
af_A0A1D6M5V5_161_335_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9478 138 324 3.40.50.620
3sp1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9459 5 324 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3D1E653-F1-model_v4 Cysteine--tRNA ligase 0.9847 97 323 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A3D1E653-F1-model_v4 Cysteine--tRNA ligase 0.9804 97 323 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A3D5V831-F1-model_v4 Cysteine--tRNA ligase 0.9721 98 331 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A2T4LMD7-F1-model_v4 Cysteine--tRNA ligase 0.972 183 343 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A6P1AW19-F1-model_v4 deleted 0.9625 195 347

Feature Viewer

pLDDT pTM Quality
90.13 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map