F404277

General Info

Members Datasets Scaffolds Average Seq Length
317 173 634 130

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0141482|Ga0466972_0141482_67_459
Length 130
Sequence VRRPHENVATVLVDPRVLGDLELALMAHDLRVWPVQTAPICADGPRTAFQIRRRFLLSHRDDVLAADWTPVWVSFGASWRVGDEPLPWAAHQTLWQALDEYAAHVRFQRRLGGVAPLPVPAGPDDRVDQG

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
170 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.6
Nodule 0
Rhizoplane 5.05
Rhizosphere 62.78
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0141482 3300044658 Bacteria 1132
2 LJQas_1018691 3300000549 Bacteria 806
3 Ga0006562J51391_1135315 3300003578 Bacteria 2480
4 Ga0006562J51391_1135318 3300003578 Bacteria 960
5 Ga0070683_101409454 3300005329 Archaea 670
6 Ga0070670_100239137 3300005331 Bacteria 1581
7 Ga0070682_100175501 3300005337 Bacteria 1492
8 Ga0068868_100896696 3300005338 Bacteria 806
9 Ga0070689_101079998 3300005340 Bacteria 717
10 Ga0070692_10064269 3300005345 Bacteria 1941
11 Ga0070675_100142485 3300005354 Bacteria 2049
12 Ga0070675_100981780 3300005354 Bacteria 775
13 Ga0070688_101595336 3300005365 Bacteria 533
14 Ga0070659_100114803 3300005366 Bacteria 2176
15 Ga0070667_100021126 3300005367 Bacteria 5408
16 Ga0070701_10017511 3300005438 Bacteria 3350
17 Ga0070700_100001444 3300005441 Bacteria 11818
18 Ga0070700_100611707 3300005441 Bacteria 855
19 Ga0070678_102055205 3300005456 Bacteria 541
20 Ga0070662_101263131 3300005457 Unclassified 635
21 Ga0068867_100025935 3300005459 Bacteria 4204
22 Ga0070684_100123726 3300005535 Bacteria 2328
23 Ga0070684_100269724 3300005535 Bacteria 1558
24 Ga0070672_100252801 3300005543 Bacteria 1484
25 Ga0070686_100914440 3300005544 Bacteria 715
26 Ga0068855_101420204 3300005563 Bacteria 715
27 Ga0070664_101271513 3300005564 Bacteria 695
28 Ga0068857_101550535 3300005577 Bacteria 646
29 Ga0068854_100298289 3300005578 Bacteria 1303
30 Ga0070702_100022468 3300005615 Bacteria 3336
31 Ga0068852_100234660 3300005616 Bacteria 1750
32 Ga0068859_101109218 3300005617 Bacteria 870
33 Ga0068864_101268643 3300005618 Bacteria 737
34 Ga0068866_10125230 3300005718 Bacteria 1453
35 Ga0068861_100061439 3300005719 Bacteria 2884
36 Ga0068870_10106665 3300005840 Bacteria 1593
37 Ga0068858_100516649 3300005842 Bacteria 1155
38 Ga0068860_100001297 3300005843 Bacteria 27144
39 Ga0068860_100656407 3300005843 Bacteria 1057
40 Ga0075365_10032887 3300006038 Bacteria 3337
41 Ga0075365_10050406 3300006038 Bacteria 2746
42 Ga0075365_10057201 3300006038 Bacteria 2594
43 Ga0075365_10103332 3300006038 Bacteria 1953
44 Ga0075365_10133995 3300006038 Bacteria 1716
45 Ga0075365_10142422 3300006038 Bacteria 1664
46 Ga0075365_10229202 3300006038 Bacteria 1304
47 Ga0075365_10354245 3300006038 Bacteria 1035
48 Ga0075365_10403720 3300006038 Bacteria 964
49 Ga0075368_10000424 3300006042 Bacteria 12443
50 Ga0075368_10010498 3300006042 Bacteria 3348
51 Ga0075368_10040363 3300006042 Bacteria 1832
52 Ga0075368_10092269 3300006042 Bacteria 1239
53 Ga0075368_10155500 3300006042 Bacteria 956
54 Ga0075363_100007472 3300006048 Bacteria 5027
55 Ga0075363_100014936 3300006048 Bacteria 3807
56 Ga0075363_100016544 3300006048 Bacteria 3644
57 Ga0075363_100019113 3300006048 Bacteria 3422
58 Ga0075363_100038459 3300006048 Bacteria 2516
59 Ga0075364_10002422 3300006051 Bacteria 10448
60 Ga0075364_10013591 3300006051 Bacteria 5010
61 Ga0075364_10016663 3300006051 Bacteria 4574
62 Ga0075364_10024939 3300006051 Bacteria 3802
63 Ga0075364_10049953 3300006051 Bacteria 2729
64 Ga0075364_10063701 3300006051 Bacteria 2421
65 Ga0075364_10128292 3300006051 Bacteria 1701
66 Ga0075364_10203052 3300006051 Bacteria 1344
67 Ga0075364_10233937 3300006051 Bacteria 1248
68 Ga0075364_10326709 3300006051 Bacteria 1045
69 Ga0075432_10233466 3300006058 Bacteria 740
70 Ga0075362_10069351 3300006177 Bacteria 1607
71 Ga0075362_10559050 3300006177 Bacteria 589
72 Ga0075367_10035820 3300006178 Bacteria 2875
73 Ga0075367_10056196 3300006178 Bacteria 2338
74 Ga0075367_10070920 3300006178 Bacteria 2095
75 Ga0075367_10157610 3300006178 Bacteria 1411
76 Ga0075367_10217554 3300006178 Bacteria 1195
77 Ga0075367_10223702 3300006178 Bacteria 1178
78 Ga0075370_10015153 3300006353 Bacteria 4121
79 Ga0075370_10021516 3300006353 Bacteria 3533
80 Ga0075370_10033807 3300006353 Bacteria 2864
81 Ga0075370_10038754 3300006353 Bacteria 2683
82 Ga0075370_10050662 3300006353 Bacteria 2355
83 Ga0075428_100000727 3300006844 Bacteria 34188
84 Ga0075430_100013537 3300006846 Bacteria 6955
85 Ga0075431_100003683 3300006847 Bacteria 14886
86 Ga0075431_100071372 3300006847 Bacteria 3583
87 Ga0075433_10388741 3300006852 Bacteria 1231
88 Ga0075429_100000574 3300006880 Bacteria 28250
89 Ga0068865_100028530 3300006881 Bacteria 3696
90 Ga0097620_101109072 3300006931 Bacteria 870
91 Ga0111539_11231366 3300009094 Bacteria 869
92 Ga0105245_10182647 3300009098 Bacteria 2005
93 Ga0105247_10288383 3300009101 Bacteria 1135
94 Ga0114129_10154796 3300009147 Bacteria 3135
95 Ga0105243_10177463 3300009148 Bacteria 1850
96 Ga0105243_10409930 3300009148 Bacteria 1261
97 Ga0105241_11303037 3300009174 Bacteria 692
98 Ga0105248_10170746 3300009177 Bacteria 2451
99 Ga0105238_10053868 3300009551 Bacteria 4042
100 Ga0105249_10069899 3300009553 Bacteria 3241
101 Ga0105239_10436951 3300010375 Bacteria 1484
102 Ga0105246_10614034 3300011119 Bacteria 941
103 Ga0157370_10282606 3300013104 Bacteria 1533
104 Ga0157374_12307948 3300013296 Bacteria 565
105 Ga0157372_10399196 3300013307 Bacteria 1602
106 Ga0157375_10274297 3300013308 Bacteria 1849
107 Ga0157375_12405309 3300013308 Bacteria 629
108 Ga0163163_10183878 3300014325 Bacteria 2138
109 Ga0163163_12508378 3300014325 Bacteria 573
110 Ga0157377_10393071 3300014745 Unclassified 942
111 Ga0157377_10604775 3300014745 Bacteria 783
112 Ga0163161_11721276 3300017792 Bacteria 556
113 Ga0206353_11051584 3300020082 Bacteria 596
114 Ga0207642_10247293 3300025899 Bacteria 1010
115 Ga0207688_10093261 3300025901 Bacteria 1731
116 Ga0207643_10016430 3300025908 Bacteria 4038
117 Ga0207649_11076327 3300025920 Bacteria 634
118 Ga0207649_11351218 3300025920 Bacteria 564
119 Ga0207694_10525889 3300025924 Bacteria 991
120 Ga0207659_11372516 3300025926 Bacteria 606
121 Ga0207687_10898488 3300025927 Bacteria 758
122 Ga0207690_10229247 3300025932 Bacteria 1425
123 Ga0207670_10272610 3300025936 Bacteria 1316
124 Ga0207691_10231936 3300025940 Bacteria 1598
125 Ga0207691_10803559 3300025940 Bacteria 790
126 Ga0207689_10740309 3300025942 Bacteria 829
127 Ga0207661_11484090 3300025944 Bacteria 621
128 Ga0207679_10289882 3300025945 Bacteria 1407
129 Ga0207712_11782719 3300025961 Bacteria 552
130 Ga0207658_10027063 3300025986 Bacteria 4027
131 Ga0207677_10034603 3300026023 Bacteria 3273
132 Ga0207703_11092245 3300026035 Bacteria 766
133 Ga0207708_10000294 3300026075 Bacteria 39256
134 Ga0207648_10002661 3300026089 Bacteria 19058
135 Ga0207675_100002062 3300026118 Bacteria 20031
136 Ga0207698_10647713 3300026142 Bacteria 1046
137 Ga0209813_10007254 3300027866 Bacteria 2757
138 Ga0209813_10094723 3300027866 Bacteria 1007
139 Ga0207428_10016662 3300027907 Bacteria 6320
140 Ga0207428_10603551 3300027907 Bacteria 791
141 Ga0268264_10002709 3300028381 Bacteria 15461
142 Ga0307415_100434130 3300032126 Bacteria 1131
143 Ga0373952_0071864 3300035092 Bacteria 867
144 Ga0395900_0327652 3300037418 Bacteria 1510
145 Ga0395898_0241889 3300037466 Bacteria 1721
146 Ga0395905_1067781 3300037471 Bacteria 711
147 Ga0451791_1507503 3300041451 Bacteria 506
148 Ga0451795_0299629 3300041456 Bacteria 515
149 Ga0451837_0015536 3300041494 Bacteria 768
150 Ga0451843_0955468 3300041509 Bacteria 847
151 Ga0450907_010818 3300042146 Bacteria 1515
152 Ga0466972_0447392 3300044658 Bacteria 607
153 Ga0466965_0038440 3300044683 Bacteria 2351
154 Ga0466965_0198188 3300044683 Bacteria 1064
155 Ga0466965_0251885 3300044683 Bacteria 947
156 Ga0466965_0683311 3300044683 Bacteria 588
157 Ga0466961_0339575 3300044693 Bacteria 915
158 Ga0466961_0793433 3300044693 Bacteria 565
159 Ga0466963_0072756 3300044694 Bacteria 2316
160 Ga0466964_0031813 3300044706 Bacteria 2094
161 Ga0466964_0066511 3300044706 Bacteria 1512
162 Ga0466971_0013447 3300044719 Bacteria 3596
163 Ga0466971_0330672 3300044719 Bacteria 735
164 Ga0466970_0036748 3300044765 Bacteria 2595
165 Ga0466970_0169413 3300044765 Bacteria 1210
166 Ga0466970_0233570 3300044765 Bacteria 1028
167 Ga0466970_0670929 3300044765 Bacteria 603
168 Ga0466957_0056647 3300044842 Bacteria 2397
169 Ga0466957_0359313 3300044842 Bacteria 989
170 Ga0466960_0001682 3300044901 Bacteria 8105
171 Ga0466960_0055105 3300044901 Bacteria 1933
172 Ga0466960_0069714 3300044901 Bacteria 1747
173 Ga0466960_0117379 3300044901 Bacteria 1390
174 Ga0466960_0409990 3300044901 Bacteria 782
175 Ga0466959_0268628 3300045049 Bacteria 1173
176 Ga0466959_0977581 3300045049 Bacteria 564
177 Ga0466958_0133930 3300045836 Bacteria 1557
178 Ga0466958_0218581 3300045836 Bacteria 1215
179 Ga0466967_0147080 3300045976 Bacteria 2198
180 Ga0466967_0148001 3300045976 Bacteria 2192
181 Ga0466967_0205831 3300045976 Bacteria 1865
182 Ga0466967_0797691 3300045976 Bacteria 937
183 Ga0495651_0861805 3300046462 Bacteria 556
184 Ga0496100_0109849 3300048903 Bacteria 1914
185 Ga0496101_0274319 3300048904 Bacteria 1317
186 Ga0496101_0610936 3300048904 Bacteria 862
187 Ga0496102_1298625 3300048905 Bacteria 647
188 Ga0496102_1433161 3300048905 Bacteria 610
189 Ga0496104_1529418 3300048907 Bacteria 570
190 Ga0496108_0295262 3300048911 Bacteria 1411
191 Ga0496109_0198966 3300048912 Bacteria 1884
192 Ga0496109_0450948 3300048912 Bacteria 1215
193 Ga0496110_0784208 3300048913 Bacteria 857
194 Ga0496110_1747453 3300048913 Bacteria 532
195 Ga0496111_1141310 3300048914 Bacteria 554
196 Ga0496114_0122544 3300048917 Bacteria 2237
197 Ga0496114_0710223 3300048917 Bacteria 881
198 Ga0496124_0036370 3300048927 Bacteria 4296
199 Ga0501031_0009792 3300049568 Bacteria 6239
200 Ga0501033_0125007 3300049570 Bacteria 1865
201 Ga0501034_0759876 3300049571 Bacteria 864
202 Ga0501036_0949459 3300049572 Bacteria 705
203 Ga0501037_0319063 3300049573 Bacteria 1076
204 Ga0501038_1331297 3300049574 Unclassified 518
205 Ga0501039_0018827 3300049575 Bacteria 5300
206 Ga0501039_0126474 3300049575 Bacteria 2005
207 Ga0501040_0015029 3300049576 Bacteria 5115
208 Ga0501041_0143604 3300049577 Bacteria 1489
209 Ga0501041_0685341 3300049577 Bacteria 656
210 Ga0501042_0313096 3300049578 Bacteria 1134
211 Ga0501043_0520277 3300049579 Bacteria 887
212 Ga0501048_0039973 3300049582 Bacteria 3362
213 Ga0501048_0241075 3300049582 Bacteria 1283
214 Ga0501048_0270717 3300049582 Bacteria 1207
215 Ga0501067_0114713 3300049583 Bacteria 1498
216 Ga0501067_0314859 3300049583 Bacteria 872
217 Ga0501067_0315040 3300049583 Bacteria 871
218 Ga0501068_0490061 3300049584 Bacteria 797
219 Ga0501068_1057094 3300049584 Bacteria 536
220 Ga0501069_0022550 3300049585 Bacteria 3427
221 Ga0501069_0131569 3300049585 Bacteria 1433
222 Ga0501069_0138636 3300049585 Bacteria 1395
223 Ga0501069_0301154 3300049585 Bacteria 940
224 Ga0501069_0717687 3300049585 Bacteria 603
225 Ga0501070_0027725 3300049586 Bacteria 4752
226 Ga0501070_0172506 3300049586 Bacteria 1781
227 Ga0501070_0590159 3300049586 Bacteria 886
228 Ga0501070_0885364 3300049586 Bacteria 697
229 Ga0501070_1507492 3300049586 Bacteria 509
230 Ga0501071_0021655 3300049587 Bacteria 4479
231 Ga0501071_0633523 3300049587 Bacteria 822
232 Ga0501071_0687461 3300049587 Bacteria 788
233 Ga0501072_0107965 3300049588 Bacteria 2214
234 Ga0501072_0212412 3300049588 Bacteria 1542
235 Ga0501073_0692150 3300049589 Bacteria 703
236 Ga0501074_0012900 3300049590 Bacteria 6075
237 Ga0501074_0067896 3300049590 Bacteria 2563
238 Ga0501074_0184313 3300049590 Bacteria 1489
239 Ga0501076_0004142 3300049592 Bacteria 10257
240 Ga0501076_0219268 3300049592 Bacteria 1555
241 Ga0501077_0208416 3300049593 Bacteria 1242
242 Ga0501079_0221544 3300049741 Bacteria 1478
243 Ga0501080_0224772 3300049742 Bacteria 1717
244 Ga0501080_1025753 3300049742 Bacteria 715
245 Ga0501081_0026701 3300049743 Bacteria 3896
246 Ga0501081_0059760 3300049743 Bacteria 2640
247 Ga0501083_0066117 3300049744 Bacteria 2408
248 Ga0501045_0043844 3300049824 Bacteria 3258
249 nmdc:mga03683_29907_c1 3300050489 Bacteria 2176
250 nmdc:mga03683_407572_c1 3300050489 Bacteria 650
251 nmdc:mga03n38_110873_c1 3300050490 Bacteria 1336
252 nmdc:mga03n38_135218_c1 3300050490 Bacteria 1226
253 nmdc:mga03n38_37985_c1 3300050490 Bacteria 2080
254 nmdc:mga03n38_746803_c1 3300050490 Bacteria 567
255 nmdc:mga03n38_84637_c1 3300050490 Bacteria 1498
256 nmdc:mga00v17_123229_c1 3300050491 Bacteria 1652
257 nmdc:mga00v17_126898_c1 3300050491 Bacteria 1628
258 nmdc:mga00v17_15387_c1 3300050491 Bacteria 4293
259 nmdc:mga00v17_17050_c1 3300050491 Bacteria 4102
260 nmdc:mga00v17_172638_c1 3300050491 Bacteria 1394
261 nmdc:mga00v17_17563_c1 3300050491 Bacteria 4052
262 nmdc:mga00v17_214716_c1 3300050491 Bacteria 1245
263 nmdc:mga00v17_25389_c1 3300050491 Bacteria 3444
264 nmdc:mga00v17_337322_c1 3300050491 Bacteria 980
265 nmdc:mga00v17_402104_c1 3300050491 Bacteria 890
266 nmdc:mga00v17_433426_c1 3300050491 Bacteria 854
267 nmdc:mga00v17_554562_c1 3300050491 Bacteria 743
268 nmdc:mga00v17_837722_c1 3300050491 Bacteria 585
269 nmdc:mga00v17_9316_c1 3300050491 Bacteria 5311
270 nmdc:mga0yw44_137457_c1 3300050492 Bacteria 1586
271 nmdc:mga0yw44_1526_c1 3300050492 Bacteria 9254
272 nmdc:mga0yw44_170193_c1 3300050492 Bacteria 1430
273 nmdc:mga0yw44_233346_c1 3300050492 Bacteria 1222
274 nmdc:mga0yw44_268962_c1 3300050492 Bacteria 1137
275 nmdc:mga0yw44_291983_c1 3300050492 Bacteria 1091
276 nmdc:mga0yw44_303685_c1 3300050492 Bacteria 1070
277 nmdc:mga0yw44_42507_c2 3300050492 Bacteria 2219
278 nmdc:mga0yw44_64114_c1 3300050492 Bacteria 2261
279 nmdc:mga0yw44_658434_c1 3300050492 Bacteria 712
280 nmdc:mga0yw44_85654_c1 3300050492 Bacteria 1983
281 nmdc:mga06z11_118803_c1 3300050494 Bacteria 1473
282 nmdc:mga06z11_172457_c1 3300050494 Bacteria 1243
283 nmdc:mga06z11_22139_c1 3300050494 Bacteria 2964
284 nmdc:mga06z11_22512_c1 3300050494 Bacteria 2945
285 nmdc:mga06z11_270443_c1 3300050494 Bacteria 1005
286 nmdc:mga06z11_282591_c1 3300050494 Bacteria 983
287 nmdc:mga04h51_111786_c1 3300050495 Bacteria 1008
288 nmdc:mga04h51_11908_c1 3300050495 Bacteria 2428
289 nmdc:mga04h51_145567_c1 3300050495 Bacteria 902
290 nmdc:mga07m45_11062_c1 3300050496 Bacteria 2427
291 nmdc:mga07m45_156330_c1 3300050496 Bacteria 1323
292 nmdc:mga07m45_17399_c1 3300050496 Bacteria 3860
293 nmdc:mga07m45_203549_c1 3300050496 Bacteria 1152
294 nmdc:mga07m45_295326_c1 3300050496 Bacteria 942
295 nmdc:mga07m45_308296_c1 3300050496 Bacteria 920
296 nmdc:mga07m45_376211_c1 3300050496 Bacteria 825
297 nmdc:mga07m45_595179_c1 3300050496 Bacteria 639
298 nmdc:mga07m45_628409_c1 3300050496 Bacteria 619
299 nmdc:mga05p37_253_c1 3300050507 Bacteria 55097
300 nmdc:mga09592_502_c1 3300050508 Bacteria 29539
301 nmdc:mga0qj67_14356_c1 3300050509 Bacteria 5988
302 nmdc:mga06r32_742_c1 3300050510 Bacteria 28590
303 nmdc:mga08y16_3946_c1 3300050511 Bacteria 15445
304 nmdc:mga08y16_692377_c1 3300050511 Bacteria 1020
305 nmdc:mga08y16_857900_c1 3300050511 Bacteria 897
306 nmdc:mga0n895_604109_c1 3300050512 Bacteria 1099
307 nmdc:mga0a205_44749_c2 3300050515 Bacteria 3055
308 nmdc:mga0sz30_312370_c1 3300050516 Bacteria 701
309 Ga0495655_0044035 3300053083 Bacteria 1153
310 Ga0495655_0293283 3300053083 Bacteria 557
311 Ga0495595_0361286 3300053084 Bacteria 734
312 Ga0500644_0000203 3300053088 Bacteria 35985
313 Ga0500573_0113329 3300053140 Bacteria 1515
314 Ga0501082_0573667 3300060353 Bacteria 987
315 Ga0466962_0064121 3300061719 Bacteria 1754
316 Ga0466962_0247526 3300061719 Bacteria 875
317 Ga0530510_0594980 3300061734 Bacteria 841
318 Ga0466972_0141482
319 LJQas_1018691
320 Ga0006562J51391_1135315
321 Ga0006562J51391_1135318
322 Ga0070683_101409454
323 Ga0070670_100239137
324 Ga0070682_100175501
325 Ga0068868_100896696
326 Ga0070689_101079998
327 Ga0070692_10064269
328 Ga0070675_100142485
329 Ga0070675_100981780
330 Ga0070688_101595336
331 Ga0070659_100114803
332 Ga0070667_100021126
333 Ga0070701_10017511
334 Ga0070700_100001444
335 Ga0070700_100611707
336 Ga0070678_102055205
337 Ga0070662_101263131
338 Ga0068867_100025935
339 Ga0070684_100123726
340 Ga0070684_100269724
341 Ga0070672_100252801
342 Ga0070686_100914440
343 Ga0068855_101420204
344 Ga0070664_101271513
345 Ga0068857_101550535
346 Ga0068854_100298289
347 Ga0070702_100022468
348 Ga0068852_100234660
349 Ga0068859_101109218
350 Ga0068864_101268643
351 Ga0068866_10125230
352 Ga0068861_100061439
353 Ga0068870_10106665
354 Ga0068858_100516649
355 Ga0068860_100001297
356 Ga0068860_100656407
357 Ga0075365_10032887
358 Ga0075365_10050406
359 Ga0075365_10057201
360 Ga0075365_10103332
361 Ga0075365_10133995
362 Ga0075365_10142422
363 Ga0075365_10229202
364 Ga0075365_10354245
365 Ga0075365_10403720
366 Ga0075368_10000424
367 Ga0075368_10010498
368 Ga0075368_10040363
369 Ga0075368_10092269
370 Ga0075368_10155500
371 Ga0075363_100007472
372 Ga0075363_100014936
373 Ga0075363_100016544
374 Ga0075363_100019113
375 Ga0075363_100038459
376 Ga0075364_10002422
377 Ga0075364_10013591
378 Ga0075364_10016663
379 Ga0075364_10024939
380 Ga0075364_10049953
381 Ga0075364_10063701
382 Ga0075364_10128292
383 Ga0075364_10203052
384 Ga0075364_10233937
385 Ga0075364_10326709
386 Ga0075432_10233466
387 Ga0075362_10069351
388 Ga0075362_10559050
389 Ga0075367_10035820
390 Ga0075367_10056196
391 Ga0075367_10070920
392 Ga0075367_10157610
393 Ga0075367_10217554
394 Ga0075367_10223702
395 Ga0075370_10015153
396 Ga0075370_10021516
397 Ga0075370_10033807
398 Ga0075370_10038754
399 Ga0075370_10050662
400 Ga0075428_100000727
401 Ga0075430_100013537
402 Ga0075431_100003683
403 Ga0075431_100071372
404 Ga0075433_10388741
405 Ga0075429_100000574
406 Ga0068865_100028530
407 Ga0097620_101109072
408 Ga0111539_11231366
409 Ga0105245_10182647
410 Ga0105247_10288383
411 Ga0114129_10154796
412 Ga0105243_10177463
413 Ga0105243_10409930
414 Ga0105241_11303037
415 Ga0105248_10170746
416 Ga0105238_10053868
417 Ga0105249_10069899
418 Ga0105239_10436951
419 Ga0105246_10614034
420 Ga0157370_10282606
421 Ga0157374_12307948
422 Ga0157372_10399196
423 Ga0157375_10274297
424 Ga0157375_12405309
425 Ga0163163_10183878
426 Ga0163163_12508378
427 Ga0157377_10393071
428 Ga0157377_10604775
429 Ga0163161_11721276
430 Ga0206353_11051584
431 Ga0207642_10247293
432 Ga0207688_10093261
433 Ga0207643_10016430
434 Ga0207649_11076327
435 Ga0207649_11351218
436 Ga0207694_10525889
437 Ga0207659_11372516
438 Ga0207687_10898488
439 Ga0207690_10229247
440 Ga0207670_10272610
441 Ga0207691_10231936
442 Ga0207691_10803559
443 Ga0207689_10740309
444 Ga0207661_11484090
445 Ga0207679_10289882
446 Ga0207712_11782719
447 Ga0207658_10027063
448 Ga0207677_10034603
449 Ga0207703_11092245
450 Ga0207708_10000294
451 Ga0207648_10002661
452 Ga0207675_100002062
453 Ga0207698_10647713
454 Ga0209813_10007254
455 Ga0209813_10094723
456 Ga0207428_10016662
457 Ga0207428_10603551
458 Ga0268264_10002709
459 Ga0307415_100434130
460 Ga0373952_0071864
461 Ga0395900_0327652
462 Ga0395898_0241889
463 Ga0395905_1067781
464 Ga0451791_1507503
465 Ga0451795_0299629
466 Ga0451837_0015536
467 Ga0451843_0955468
468 Ga0450907_010818
469 Ga0466972_0447392
470 Ga0466965_0038440
471 Ga0466965_0198188
472 Ga0466965_0251885
473 Ga0466965_0683311
474 Ga0466961_0339575
475 Ga0466961_0793433
476 Ga0466963_0072756
477 Ga0466964_0031813
478 Ga0466964_0066511
479 Ga0466971_0013447
480 Ga0466971_0330672
481 Ga0466970_0036748
482 Ga0466970_0169413
483 Ga0466970_0233570
484 Ga0466970_0670929
485 Ga0466957_0056647
486 Ga0466957_0359313
487 Ga0466960_0001682
488 Ga0466960_0055105
489 Ga0466960_0069714
490 Ga0466960_0117379
491 Ga0466960_0409990
492 Ga0466959_0268628
493 Ga0466959_0977581
494 Ga0466958_0133930
495 Ga0466958_0218581
496 Ga0466967_0147080
497 Ga0466967_0148001
498 Ga0466967_0205831
499 Ga0466967_0797691
500 Ga0495651_0861805
501 Ga0496100_0109849
502 Ga0496101_0274319
503 Ga0496101_0610936
504 Ga0496102_1298625
505 Ga0496102_1433161
506 Ga0496104_1529418
507 Ga0496108_0295262
508 Ga0496109_0198966
509 Ga0496109_0450948
510 Ga0496110_0784208
511 Ga0496110_1747453
512 Ga0496111_1141310
513 Ga0496114_0122544
514 Ga0496114_0710223
515 Ga0496124_0036370
516 Ga0501031_0009792
517 Ga0501033_0125007
518 Ga0501034_0759876
519 Ga0501036_0949459
520 Ga0501037_0319063
521 Ga0501038_1331297
522 Ga0501039_0018827
523 Ga0501039_0126474
524 Ga0501040_0015029
525 Ga0501041_0143604
526 Ga0501041_0685341
527 Ga0501042_0313096
528 Ga0501043_0520277
529 Ga0501048_0039973
530 Ga0501048_0241075
531 Ga0501048_0270717
532 Ga0501067_0114713
533 Ga0501067_0314859
534 Ga0501067_0315040
535 Ga0501068_0490061
536 Ga0501068_1057094
537 Ga0501069_0022550
538 Ga0501069_0131569
539 Ga0501069_0138636
540 Ga0501069_0301154
541 Ga0501069_0717687
542 Ga0501070_0027725
543 Ga0501070_0172506
544 Ga0501070_0590159
545 Ga0501070_0885364
546 Ga0501070_1507492
547 Ga0501071_0021655
548 Ga0501071_0633523
549 Ga0501071_0687461
550 Ga0501072_0107965
551 Ga0501072_0212412
552 Ga0501073_0692150
553 Ga0501074_0012900
554 Ga0501074_0067896
555 Ga0501074_0184313
556 Ga0501076_0004142
557 Ga0501076_0219268
558 Ga0501077_0208416
559 Ga0501079_0221544
560 Ga0501080_0224772
561 Ga0501080_1025753
562 Ga0501081_0026701
563 Ga0501081_0059760
564 Ga0501083_0066117
565 Ga0501045_0043844
566 nmdc:mga03683_29907_c1
567 nmdc:mga03683_407572_c1
568 nmdc:mga03n38_110873_c1
569 nmdc:mga03n38_135218_c1
570 nmdc:mga03n38_37985_c1
571 nmdc:mga03n38_746803_c1
572 nmdc:mga03n38_84637_c1
573 nmdc:mga00v17_123229_c1
574 nmdc:mga00v17_126898_c1
575 nmdc:mga00v17_15387_c1
576 nmdc:mga00v17_17050_c1
577 nmdc:mga00v17_172638_c1
578 nmdc:mga00v17_17563_c1
579 nmdc:mga00v17_214716_c1
580 nmdc:mga00v17_25389_c1
581 nmdc:mga00v17_337322_c1
582 nmdc:mga00v17_402104_c1
583 nmdc:mga00v17_433426_c1
584 nmdc:mga00v17_554562_c1
585 nmdc:mga00v17_837722_c1
586 nmdc:mga00v17_9316_c1
587 nmdc:mga0yw44_137457_c1
588 nmdc:mga0yw44_1526_c1
589 nmdc:mga0yw44_170193_c1
590 nmdc:mga0yw44_233346_c1
591 nmdc:mga0yw44_268962_c1
592 nmdc:mga0yw44_291983_c1
593 nmdc:mga0yw44_303685_c1
594 nmdc:mga0yw44_42507_c2
595 nmdc:mga0yw44_64114_c1
596 nmdc:mga0yw44_658434_c1
597 nmdc:mga0yw44_85654_c1
598 nmdc:mga06z11_118803_c1
599 nmdc:mga06z11_172457_c1
600 nmdc:mga06z11_22139_c1
601 nmdc:mga06z11_22512_c1
602 nmdc:mga06z11_270443_c1
603 nmdc:mga06z11_282591_c1
604 nmdc:mga04h51_111786_c1
605 nmdc:mga04h51_11908_c1
606 nmdc:mga04h51_145567_c1
607 nmdc:mga07m45_11062_c1
608 nmdc:mga07m45_156330_c1
609 nmdc:mga07m45_17399_c1
610 nmdc:mga07m45_203549_c1
611 nmdc:mga07m45_295326_c1
612 nmdc:mga07m45_308296_c1
613 nmdc:mga07m45_376211_c1
614 nmdc:mga07m45_595179_c1
615 nmdc:mga07m45_628409_c1
616 nmdc:mga05p37_253_c1
617 nmdc:mga09592_502_c1
618 nmdc:mga0qj67_14356_c1
619 nmdc:mga06r32_742_c1
620 nmdc:mga08y16_3946_c1
621 nmdc:mga08y16_692377_c1
622 nmdc:mga08y16_857900_c1
623 nmdc:mga0n895_604109_c1
624 nmdc:mga0a205_44749_c2
625 nmdc:mga0sz30_312370_c1
626 Ga0495655_0044035
627 Ga0495655_0293283
628 Ga0495595_0361286
629 Ga0500644_0000203
630 Ga0500573_0113329
631 Ga0501082_0573667
632 Ga0466962_0064121
633 Ga0466962_0247526
634 Ga0530510_0594980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j9d-assembly2.cif.gz_F structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.6629 8 39
2j9e-assembly1.cif.gz_A structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.662 8 39
1gmu-assembly3.cif.gz_C structure of uree 0.6443 7 124
1o8b-assembly1.cif.gz_A structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate. 0.6076 7 118
1o8b-assembly1.cif.gz_B structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate. 0.6075 7 118
ID Description Score Start End Superfamily
af_B9ZSI5_2_337_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6402 11 80 3.60.10.10
af_A0A1X7YGG3_447_560_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6327 9 119 3.30.70.240
1vi7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6114 8 124 3.30.70.240
1vi7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6041 8 124 3.30.70.240
af_Q2FXY7_377_486_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5948 9 119 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A4S4ZPF7-F1-model_v4 Uncharacterized protein 0.9827 6 127
AF-A0A852RGY6-F1-model_v4 Uncharacterized protein 0.9762 5 131
AF-A0A417XS86-F1-model_v4 Uncharacterized protein 0.9761 6 129
AF-A0A7W5A9Z0-F1-model_v4 Uncharacterized protein 0.9683 6 128
AF-A0A4S4ZPF7-F1-model_v4 Uncharacterized protein 0.967 6 127

Map