F404242

General Info

Members Datasets Scaffolds Average Seq Length
317 201 634 189

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0053019|Ga0373955_0053019_530_1174
Length 214
Sequence MLSPRRHVPAGSAEQEGETPMLTLYFAPGASSMAAHIALHEVGAGFESRPLSFLRKDTRTREYLAMNPDGRVPMLLIDGRPLTEVAGILFYLARRYPEADLLPTGDVEAEAQVVSWMSFIAATVHPARRQGAEHARRIYAIAEQRLVGREWAVGRRYSIADIHLFRLYWRFRGWLDPAPGEFPALTAHYDRMMARAAVKKTIEIEAAIGYELPA

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 1.89
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0053019 3300035172 Bacteria 2213
2 JGI25404J52841_10001311 3300003659 Bacteria 4325
3 JGI25404J52841_10012362 3300003659 Bacteria 1848
4 Ga0070683_100094133 3300005329 Bacteria 2815
5 Ga0070680_100032348 3300005336 Bacteria 4210
6 Ga0070680_100358101 3300005336 Bacteria 1241
7 Ga0070682_100496169 3300005337 Bacteria 945
8 Ga0070691_10073207 3300005341 Bacteria 1665
9 Ga0070673_100219959 3300005364 Bacteria 1643
10 Ga0070709_10223344 3300005434 Bacteria 1344
11 Ga0070714_100319083 3300005435 Bacteria 1452
12 Ga0070714_100396679 3300005435 Unclassified 1303
13 Ga0070714_100741446 3300005435 Bacteria 949
14 Ga0070713_100016729 3300005436 Bacteria 5521
15 Ga0070713_100023798 3300005436 Bacteria 4761
16 Ga0070713_100122573 3300005436 Bacteria 2282
17 Ga0070713_100833296 3300005436 Bacteria 885
18 Ga0070710_10302900 3300005437 Unclassified 1044
19 Ga0070710_10330080 3300005437 Bacteria 1004
20 Ga0070701_10070616 3300005438 Bacteria 1866
21 Ga0070711_100602966 3300005439 Bacteria 916
22 Ga0070711_100617240 3300005439 Unclassified 906
23 Ga0070705_100001242 3300005440 Bacteria 13785
24 Ga0070700_100003327 3300005441 Bacteria 8286
25 Ga0070694_100001475 3300005444 Bacteria 13785
26 Ga0070694_100024792 3300005444 Unclassified 3874
27 Ga0070708_100210392 3300005445 Bacteria 1822
28 Ga0070663_100066119 3300005455 Bacteria 2619
29 Ga0070663_100428912 3300005455 Bacteria 1086
30 Ga0070678_100837839 3300005456 Bacteria 837
31 Ga0070681_10006411 3300005458 Bacteria 11447
32 Ga0070681_10022485 3300005458 Bacteria 6332
33 Ga0070706_100028357 3300005467 Bacteria 5155
34 Ga0070707_100235308 3300005468 Bacteria 1783
35 Ga0070698_100052819 3300005471 Bacteria 4132
36 Ga0070699_100019152 3300005518 Bacteria 5888
37 Ga0070699_100898066 3300005518 Bacteria 811
38 Ga0070679_100013787 3300005530 Bacteria 7745
39 Ga0070679_100061311 3300005530 Bacteria 3749
40 Ga0070679_100094866 3300005530 Bacteria 2971
41 Ga0070684_100537595 3300005535 Bacteria 1084
42 Ga0070697_100038102 3300005536 Bacteria 3884
43 Ga0068853_100256620 3300005539 Bacteria 1606
44 Ga0070695_100000577 3300005545 Bacteria 19311
45 Ga0070695_100479116 3300005545 Bacteria 959
46 Ga0070696_100012105 3300005546 Bacteria 5780
47 Ga0070693_100096764 3300005547 Bacteria 1790
48 Ga0070665_100122879 3300005548 Bacteria 2598
49 Ga0070665_100261849 3300005548 Bacteria 1730
50 Ga0070704_100022893 3300005549 Bacteria 4071
51 Ga0068855_100446993 3300005563 Bacteria 1411
52 Ga0070664_100920504 3300005564 Bacteria 820
53 Ga0068857_100054076 3300005577 Bacteria 3562
54 Ga0068857_100160318 3300005577 Bacteria 2041
55 Ga0068854_100452097 3300005578 Bacteria 1073
56 Ga0068856_100265973 3300005614 Bacteria 1731
57 Ga0068856_100515931 3300005614 Unclassified 1216
58 Ga0068852_100942177 3300005616 Bacteria 881
59 Ga0068859_100025016 3300005617 Bacteria 5993
60 Ga0068864_100069978 3300005618 Bacteria 3052
61 Ga0068864_100162467 3300005618 Bacteria 2031
62 Ga0068858_100507643 3300005842 Bacteria 1165
63 Ga0068858_100950582 3300005842 Bacteria 841
64 Ga0068860_100001542 3300005843 Bacteria 24802
65 Ga0068860_100005455 3300005843 Bacteria 12893
66 Ga0068862_100003858 3300005844 Bacteria 12764
67 Ga0081455_10038013 3300005937 Bacteria 4265
68 Ga0081540_1001860 3300005983 Bacteria 17663
69 Ga0081540_1007566 3300005983 Bacteria 7722
70 Ga0081540_1011064 3300005983 Bacteria 6058
71 Ga0081540_1104444 3300005983 Bacteria 1213
72 Ga0070717_10003074 3300006028 Bacteria 11898
73 Ga0070717_10208391 3300006028 Bacteria 1715
74 Ga0070717_10414113 3300006028 Unclassified 1212
75 Ga0075365_10256998 3300006038 Bacteria 1228
76 Ga0075368_10139182 3300006042 Bacteria 1011
77 Ga0075363_100017475 3300006048 Bacteria 3558
78 Ga0070716_100219274 3300006173 Bacteria 1277
79 Ga0070712_100197201 3300006175 Bacteria 1579
80 Ga0075362_10145424 3300006177 Bacteria 1135
81 Ga0075367_10002797 3300006178 Bacteria 8092
82 Ga0097621_101178121 3300006237 Bacteria 721
83 Ga0075370_10208016 3300006353 Bacteria 1155
84 Ga0075428_100059829 3300006844 Bacteria 4171
85 Ga0075428_100119076 3300006844 Bacteria 2875
86 Ga0075428_100127709 3300006844 Bacteria 2766
87 Ga0075428_100159577 3300006844 Bacteria 2448
88 Ga0075428_100212904 3300006844 Bacteria 2088
89 Ga0075428_100318831 3300006844 Bacteria 1670
90 Ga0075430_100016984 3300006846 Bacteria 6197
91 Ga0075430_100051159 3300006846 Bacteria 3482
92 Ga0075431_100013949 3300006847 Bacteria 8117
93 Ga0075431_100019768 3300006847 Bacteria 6874
94 Ga0075431_100105470 3300006847 Bacteria 2908
95 Ga0075431_100672935 3300006847 Bacteria 1014
96 Ga0075431_100820703 3300006847 Unclassified 902
97 Ga0075431_100886066 3300006847 Bacteria 862
98 Ga0075434_100606612 3300006871 Bacteria 1114
99 Ga0075429_100024391 3300006880 Bacteria 5248
100 Ga0075429_100200459 3300006880 Unclassified 1748
101 Ga0075429_100292298 3300006880 Bacteria 1427
102 Ga0097620_100025015 3300006931 Bacteria 5993
103 Ga0097620_100316978 3300006931 Bacteria 1653
104 Ga0097620_100577055 3300006931 Unclassified 1218
105 Ga0105240_10033307 3300009093 Bacteria 6659
106 Ga0105240_10143904 3300009093 Bacteria 2847
107 Ga0111539_10070228 3300009094 Bacteria 4134
108 Ga0105245_10174337 3300009098 Bacteria 2050
109 Ga0105245_10565099 3300009098 Bacteria 1161
110 Ga0105245_10792422 3300009098 Bacteria 985
111 Ga0105247_10314384 3300009101 Bacteria 1091
112 Ga0114129_10078948 3300009147 Bacteria 4577
113 Ga0114129_10228234 3300009147 Bacteria 2508
114 Ga0105248_10430037 3300009177 Bacteria 1487
115 Ga0105237_10432527 3300009545 Bacteria 1322
116 Ga0105238_10085459 3300009551 Bacteria 3142
117 Ga0105249_10012347 3300009553 Bacteria 7527
118 Ga0105249_11079381 3300009553 Bacteria 873
119 Ga0099796_10036711 3300010159 Bacteria 1633
120 Ga0105239_10179218 3300010375 Bacteria 2370
121 Ga0105239_10502487 3300010375 Bacteria 1378
122 Ga0105239_11107137 3300010375 Bacteria 912
123 Ga0105246_10449373 3300011119 Bacteria 1083
124 Ga0157370_10141009 3300013104 Bacteria 2246
125 Ga0157369_10094646 3300013105 Bacteria 3188
126 Ga0157369_10186381 3300013105 Bacteria 2182
127 Ga0157374_10989642 3300013296 Bacteria 860
128 Ga0157372_10030290 3300013307 Bacteria 5919
129 Ga0157372_10075935 3300013307 Bacteria 3793
130 Ga0163163_12010543 3300014325 Unclassified 638
131 Ga0157380_10178713 3300014326 Unclassified 1862
132 Ga0157380_10340157 3300014326 Bacteria 1399
133 Ga0207692_10300565 3300025898 Unclassified 977
134 Ga0207685_10364476 3300025905 Bacteria 732
135 Ga0207699_10216339 3300025906 Bacteria 1306
136 Ga0207699_10223600 3300025906 Bacteria 1286
137 Ga0207705_10788361 3300025909 Bacteria 738
138 Ga0207684_10084720 3300025910 Bacteria 2700
139 Ga0207654_11256481 3300025911 Unclassified 540
140 Ga0207707_10000143 3300025912 Bacteria 74226
141 Ga0207707_10105344 3300025912 Bacteria 2465
142 Ga0207695_11266743 3300025913 Unclassified 618
143 Ga0207671_10450428 3300025914 Bacteria 1025
144 Ga0207693_10099432 3300025915 Bacteria 2281
145 Ga0207663_10578603 3300025916 Bacteria 880
146 Ga0207660_10017202 3300025917 Bacteria 4798
147 Ga0207660_10352108 3300025917 Bacteria 1180
148 Ga0207660_10889203 3300025917 Bacteria 727
149 Ga0207652_10011338 3300025921 Bacteria 7184
150 Ga0207652_10014159 3300025921 Bacteria 6458
151 Ga0207652_10139176 3300025921 Unclassified 2169
152 Ga0207646_10131299 3300025922 Unclassified 2254
153 Ga0207646_11329100 3300025922 Bacteria 627
154 Ga0207694_10118714 3300025924 Bacteria 2110
155 Ga0207687_10054282 3300025927 Bacteria 2802
156 Ga0207687_10430532 3300025927 Bacteria 1090
157 Ga0207700_10074953 3300025928 Bacteria 2620
158 Ga0207700_10220909 3300025928 Bacteria 1606
159 Ga0207700_10667937 3300025928 Bacteria 927
160 Ga0207700_11031304 3300025928 Bacteria 736
161 Ga0207664_10066588 3300025929 Bacteria 2888
162 Ga0207664_10221932 3300025929 Bacteria 1639
163 Ga0207664_10560207 3300025929 Bacteria 1026
164 Ga0207661_10078601 3300025944 Bacteria 2717
165 Ga0207667_10362690 3300025949 Bacteria 1477
166 Ga0207712_10015276 3300025961 Bacteria 4949
167 Ga0207712_10868118 3300025961 Bacteria 796
168 Ga0207640_10729871 3300025981 Bacteria 852
169 Ga0207658_10228392 3300025986 Bacteria 1570
170 Ga0207703_10255171 3300026035 Bacteria 1583
171 Ga0207703_10788041 3300026035 Bacteria 907
172 Ga0207678_10072817 3300026067 Bacteria 2944
173 Ga0207708_10002798 3300026075 Bacteria 12820
174 Ga0207708_10501296 3300026075 Unclassified 1017
175 Ga0207702_10307828 3300026078 Bacteria 1505
176 Ga0207676_10101838 3300026095 Bacteria 2382
177 Ga0207674_10069414 3300026116 Bacteria 3544
178 Ga0207674_10101381 3300026116 Bacteria 2860
179 Ga0207683_10036416 3300026121 Unclassified 4285
180 Ga0207683_10118225 3300026121 Bacteria 2378
181 Ga0207683_10834592 3300026121 Bacteria 856
182 Ga0209813_10068903 3300027866 Bacteria 1146
183 Ga0268266_10071548 3300028379 Bacteria 3006
184 Ga0268265_10002505 3300028380 Bacteria 13784
185 Ga0268264_10007739 3300028381 Bacteria 8946
186 Ga0265338_10011932 3300028800 Bacteria 9966
187 Ga0265338_10335758 3300028800 Bacteria 1090
188 Ga0265325_10002097 3300031241 Bacteria 13623
189 Ga0265340_10133736 3300031247 Unclassified 1136
190 Ga0265339_10009693 3300031249 Bacteria 6023
191 Ga0265339_10060848 3300031249 Bacteria 2034
192 Ga0265316_10073985 3300031344 Bacteria 2623
193 Ga0265313_10001697 3300031595 Bacteria 20308
194 Ga0307508_10000715 3300031616 Bacteria 39415
195 Ga0265342_10209549 3300031712 Unclassified 1055
196 Ga0373934_0161417 3300035086 Bacteria 919
197 Ga0373944_0031852 3300035089 Unclassified 1590
198 Ga0373923_0011810 3300035111 Bacteria 3215
199 Ga0373936_0030756 3300035113 Bacteria 2118
200 Ga0373936_0068641 3300035113 Bacteria 1458
201 Ga0373953_0005096 3300035117 Bacteria 4242
202 Ga0373953_0197485 3300035117 Bacteria 870
203 Ga0373954_0293791 3300035118 Bacteria 801
204 Ga0373957_0021921 3300035120 Bacteria 2272
205 Ga0373957_0214844 3300035120 Bacteria 804
206 Ga0373955_0088424 3300035172 Bacteria 1762
207 Ga0373955_0125365 3300035172 Bacteria 1496
208 Ga0373924_0195106 3300035410 Bacteria 892
209 Ga0373927_0742637 3300035695 Bacteria 648
210 Ga0373933_0006606 3300035724 Bacteria 6321
211 Ga0373947_0078641 3300035725 Bacteria 2036
212 Ga0373947_0193220 3300035725 Bacteria 1329
213 Ga0373937_0001752 3300036401 Bacteria 18253
214 Ga0373937_0010930 3300036401 Bacteria 7950
215 Ga0373937_0026515 3300036401 Bacteria 5236
216 Ga0373925_0187072 3300037068 Bacteria 1642
217 Ga0373925_0279972 3300037068 Bacteria 1343
218 Ga0373925_0845296 3300037068 Unclassified 754
219 Ga0395899_0513594 3300037312 Bacteria 775
220 Ga0395900_0009565 3300037418 Bacteria 9939
221 Ga0395900_0139090 3300037418 Bacteria 2487
222 Ga0395898_0003274 3300037466 Bacteria 18201
223 Ga0395898_0487026 3300037466 Bacteria 1173
224 Ga0436364_0629704 3300037853 Bacteria 3861
225 Ga0436364_0923371 3300037853 Unclassified 1815
226 Ga0395901_0004819 3300038443 Bacteria 13613
227 Ga0395901_0458542 3300038443 Bacteria 1303
228 Ga0395901_1162163 3300038443 Bacteria 739
229 Ga0436365_0045906 3300039437 Bacteria 10690
230 Ga0436365_1336454 3300039437 Bacteria 740
231 Ga0436360_0083901 3300039438 Bacteria 1491
232 Ga0436360_0171311 3300039438 Bacteria 1574
233 Ga0436360_0298691 3300039438 Bacteria 4481
234 Ga0436360_1180961 3300039438 Bacteria 707
235 Ga0436362_0875299 3300039453 Bacteria 1139
236 Ga0451791_1591620 3300041451 Bacteria 912
237 Ga0495603_0331353 3300046455 Unclassified 874
238 Ga0495629_0303259 3300046459 Bacteria 1094
239 Ga0495651_0006879 3300046462 Bacteria 8692
240 Ga0495651_0061920 3300046462 Bacteria 2864
241 Ga0495651_0091489 3300046462 Bacteria 2280
242 Ga0495653_0076762 3300046463 Bacteria 2483
243 Ga0495653_0111328 3300046463 Bacteria 1967
244 Ga0495653_0226648 3300046463 Bacteria 1253
245 Ga0495580_0081994 3300046472 Bacteria 2248
246 Ga0495582_0079692 3300046473 Bacteria 1818
247 Ga0495664_0002418 3300046477 Bacteria 10035
248 Ga0495608_0049626 3300046511 Bacteria 2786
249 Ga0495628_0304887 3300046516 Bacteria 1178
250 Ga0495630_0245837 3300046517 Bacteria 1367
251 Ga0495652_0047728 3300046529 Bacteria 3672
252 Ga0495640_0173223 3300046533 Bacteria 1378
253 Ga0495587_0255757 3300046536 Bacteria 984
254 Ga0495667_0218922 3300046559 Unclassified 1215
255 Ga0495657_0026053 3300046675 Bacteria 4146
256 Ga0495599_0268771 3300046678 Bacteria 1035
257 Ga0495623_0023773 3300046679 Bacteria 3954
258 Ga0495646_0008683 3300046680 Bacteria 6459
259 Ga0495658_0091611 3300046683 Bacteria 1801
260 Ga0495613_0389725 3300046689 Bacteria 952
261 Ga0495600_0168592 3300046809 Bacteria 1414
262 Ga0495604_0050273 3300047317 Bacteria 3237
263 Ga0495674_0021834 3300047319 Bacteria 5914
264 Ga0495674_0073541 3300047319 Bacteria 2946
265 Ga0495672_0187624 3300047320 Bacteria 1042
266 Ga0495680_0104847 3300047322 Bacteria 2103
267 Ga0495680_0235982 3300047322 Bacteria 1300
268 Ga0495675_0109381 3300047444 Bacteria 1726
269 Ga0495684_0125728 3300047471 Bacteria 1929
270 Ga0495684_0280935 3300047471 Bacteria 1201
271 Ga0495602_0000599 3300048088 Bacteria 33832
272 Ga0495602_0041103 3300048088 Bacteria 4228
273 Ga0495602_0110293 3300048088 Bacteria 2237
274 Ga0496102_0012657 3300048905 Bacteria 7306
275 Ga0496105_0181025 3300048908 Bacteria 1726
276 Ga0496106_0001668 3300048909 Bacteria 16638
277 Ga0496107_0007404 3300048910 Bacteria 7568
278 Ga0496114_0279164 3300048917 Bacteria 1473
279 Ga0496119_0007805 3300048922 Bacteria 9543
280 Ga0496120_0001320 3300048923 Bacteria 30668
281 Ga0496121_0165236 3300048924 Bacteria 1614
282 Ga0501074_0282802 3300049590 Bacteria 1179
283 Ga0501076_1010252 3300049592 Bacteria 685
284 Ga0501079_0941094 3300049741 Bacteria 680
285 nmdc:mga03683_46784_c1 3300050489 Bacteria 1794
286 nmdc:mga03n38_44966_c1 3300050490 Bacteria 1942
287 nmdc:mga06z11_2143_c1 3300050494 Bacteria 7485
288 nmdc:mga04h51_82019_c1 3300050495 Bacteria 1146
289 nmdc:mga05p37_1209528_c1 3300050507 Unclassified 780
290 nmdc:mga05p37_154784_c1 3300050507 Bacteria 2802
291 nmdc:mga05p37_362655_c1 3300050507 Bacteria 1703
292 nmdc:mga09592_210365_c1 3300050508 Bacteria 1685
293 nmdc:mga09592_21853_c1 3300050508 Bacteria 5276
294 nmdc:mga09592_299769_c1 3300050508 Bacteria 1394
295 nmdc:mga09592_84662_c1 3300050508 Bacteria 2704
296 nmdc:mga0qj67_176018_c1 3300050509 Bacteria 1737
297 nmdc:mga0qj67_204780_c1 3300050509 Bacteria 1603
298 nmdc:mga0qj67_3046_c1 3300050509 Bacteria 12035
299 nmdc:mga0qj67_37632_c1 3300050509 Bacteria 3792
300 nmdc:mga0qj67_379117_c1 3300050509 Unclassified 1142
301 nmdc:mga06r32_350079_c1 3300050510 Bacteria 1462
302 nmdc:mga06r32_3543_c1 3300050510 Bacteria 13937
303 nmdc:mga06r32_59895_c1 3300050510 Bacteria 3663
304 nmdc:mga06r32_647666_c1 3300050510 Bacteria 1025
305 nmdc:mga06r32_959693_c1 3300050510 Bacteria 809
306 nmdc:mga08y16_604523_c1 3300050511 Unclassified 1105
307 nmdc:mga0n895_582565_c1 3300050512 Bacteria 1122
308 Ga0495601_0000358 3300053077 Bacteria 23987
309 Ga0495612_0002468 3300053078 Bacteria 7624
310 Ga0495612_0005007 3300053078 Bacteria 5488
311 Ga0495595_0091544 3300053084 Bacteria 1459
312 Ga0495619_0104537 3300053085 Bacteria 1930
313 Ga0495619_0183790 3300053085 Bacteria 1446
314 Ga0500651_0285166 3300053093 Bacteria 951
315 Ga0500658_0043741 3300053134 Bacteria 1804
316 Ga0500568_0002568 3300053139 Bacteria 10581
317 Ga0500616_0064007 3300053153 Bacteria 1895
318 Ga0373955_0053019
319 JGI25404J52841_10001311
320 JGI25404J52841_10012362
321 Ga0070683_100094133
322 Ga0070680_100032348
323 Ga0070680_100358101
324 Ga0070682_100496169
325 Ga0070691_10073207
326 Ga0070673_100219959
327 Ga0070709_10223344
328 Ga0070714_100319083
329 Ga0070714_100396679
330 Ga0070714_100741446
331 Ga0070713_100016729
332 Ga0070713_100023798
333 Ga0070713_100122573
334 Ga0070713_100833296
335 Ga0070710_10302900
336 Ga0070710_10330080
337 Ga0070701_10070616
338 Ga0070711_100602966
339 Ga0070711_100617240
340 Ga0070705_100001242
341 Ga0070700_100003327
342 Ga0070694_100001475
343 Ga0070694_100024792
344 Ga0070708_100210392
345 Ga0070663_100066119
346 Ga0070663_100428912
347 Ga0070678_100837839
348 Ga0070681_10006411
349 Ga0070681_10022485
350 Ga0070706_100028357
351 Ga0070707_100235308
352 Ga0070698_100052819
353 Ga0070699_100019152
354 Ga0070699_100898066
355 Ga0070679_100013787
356 Ga0070679_100061311
357 Ga0070679_100094866
358 Ga0070684_100537595
359 Ga0070697_100038102
360 Ga0068853_100256620
361 Ga0070695_100000577
362 Ga0070695_100479116
363 Ga0070696_100012105
364 Ga0070693_100096764
365 Ga0070665_100122879
366 Ga0070665_100261849
367 Ga0070704_100022893
368 Ga0068855_100446993
369 Ga0070664_100920504
370 Ga0068857_100054076
371 Ga0068857_100160318
372 Ga0068854_100452097
373 Ga0068856_100265973
374 Ga0068856_100515931
375 Ga0068852_100942177
376 Ga0068859_100025016
377 Ga0068864_100069978
378 Ga0068864_100162467
379 Ga0068858_100507643
380 Ga0068858_100950582
381 Ga0068860_100001542
382 Ga0068860_100005455
383 Ga0068862_100003858
384 Ga0081455_10038013
385 Ga0081540_1001860
386 Ga0081540_1007566
387 Ga0081540_1011064
388 Ga0081540_1104444
389 Ga0070717_10003074
390 Ga0070717_10208391
391 Ga0070717_10414113
392 Ga0075365_10256998
393 Ga0075368_10139182
394 Ga0075363_100017475
395 Ga0070716_100219274
396 Ga0070712_100197201
397 Ga0075362_10145424
398 Ga0075367_10002797
399 Ga0097621_101178121
400 Ga0075370_10208016
401 Ga0075428_100059829
402 Ga0075428_100119076
403 Ga0075428_100127709
404 Ga0075428_100159577
405 Ga0075428_100212904
406 Ga0075428_100318831
407 Ga0075430_100016984
408 Ga0075430_100051159
409 Ga0075431_100013949
410 Ga0075431_100019768
411 Ga0075431_100105470
412 Ga0075431_100672935
413 Ga0075431_100820703
414 Ga0075431_100886066
415 Ga0075434_100606612
416 Ga0075429_100024391
417 Ga0075429_100200459
418 Ga0075429_100292298
419 Ga0097620_100025015
420 Ga0097620_100316978
421 Ga0097620_100577055
422 Ga0105240_10033307
423 Ga0105240_10143904
424 Ga0111539_10070228
425 Ga0105245_10174337
426 Ga0105245_10565099
427 Ga0105245_10792422
428 Ga0105247_10314384
429 Ga0114129_10078948
430 Ga0114129_10228234
431 Ga0105248_10430037
432 Ga0105237_10432527
433 Ga0105238_10085459
434 Ga0105249_10012347
435 Ga0105249_11079381
436 Ga0099796_10036711
437 Ga0105239_10179218
438 Ga0105239_10502487
439 Ga0105239_11107137
440 Ga0105246_10449373
441 Ga0157370_10141009
442 Ga0157369_10094646
443 Ga0157369_10186381
444 Ga0157374_10989642
445 Ga0157372_10030290
446 Ga0157372_10075935
447 Ga0163163_12010543
448 Ga0157380_10178713
449 Ga0157380_10340157
450 Ga0207692_10300565
451 Ga0207685_10364476
452 Ga0207699_10216339
453 Ga0207699_10223600
454 Ga0207705_10788361
455 Ga0207684_10084720
456 Ga0207654_11256481
457 Ga0207707_10000143
458 Ga0207707_10105344
459 Ga0207695_11266743
460 Ga0207671_10450428
461 Ga0207693_10099432
462 Ga0207663_10578603
463 Ga0207660_10017202
464 Ga0207660_10352108
465 Ga0207660_10889203
466 Ga0207652_10011338
467 Ga0207652_10014159
468 Ga0207652_10139176
469 Ga0207646_10131299
470 Ga0207646_11329100
471 Ga0207694_10118714
472 Ga0207687_10054282
473 Ga0207687_10430532
474 Ga0207700_10074953
475 Ga0207700_10220909
476 Ga0207700_10667937
477 Ga0207700_11031304
478 Ga0207664_10066588
479 Ga0207664_10221932
480 Ga0207664_10560207
481 Ga0207661_10078601
482 Ga0207667_10362690
483 Ga0207712_10015276
484 Ga0207712_10868118
485 Ga0207640_10729871
486 Ga0207658_10228392
487 Ga0207703_10255171
488 Ga0207703_10788041
489 Ga0207678_10072817
490 Ga0207708_10002798
491 Ga0207708_10501296
492 Ga0207702_10307828
493 Ga0207676_10101838
494 Ga0207674_10069414
495 Ga0207674_10101381
496 Ga0207683_10036416
497 Ga0207683_10118225
498 Ga0207683_10834592
499 Ga0209813_10068903
500 Ga0268266_10071548
501 Ga0268265_10002505
502 Ga0268264_10007739
503 Ga0265338_10011932
504 Ga0265338_10335758
505 Ga0265325_10002097
506 Ga0265340_10133736
507 Ga0265339_10009693
508 Ga0265339_10060848
509 Ga0265316_10073985
510 Ga0265313_10001697
511 Ga0307508_10000715
512 Ga0265342_10209549
513 Ga0373934_0161417
514 Ga0373944_0031852
515 Ga0373923_0011810
516 Ga0373936_0030756
517 Ga0373936_0068641
518 Ga0373953_0005096
519 Ga0373953_0197485
520 Ga0373954_0293791
521 Ga0373957_0021921
522 Ga0373957_0214844
523 Ga0373955_0088424
524 Ga0373955_0125365
525 Ga0373924_0195106
526 Ga0373927_0742637
527 Ga0373933_0006606
528 Ga0373947_0078641
529 Ga0373947_0193220
530 Ga0373937_0001752
531 Ga0373937_0010930
532 Ga0373937_0026515
533 Ga0373925_0187072
534 Ga0373925_0279972
535 Ga0373925_0845296
536 Ga0395899_0513594
537 Ga0395900_0009565
538 Ga0395900_0139090
539 Ga0395898_0003274
540 Ga0395898_0487026
541 Ga0436364_0629704
542 Ga0436364_0923371
543 Ga0395901_0004819
544 Ga0395901_0458542
545 Ga0395901_1162163
546 Ga0436365_0045906
547 Ga0436365_1336454
548 Ga0436360_0083901
549 Ga0436360_0171311
550 Ga0436360_0298691
551 Ga0436360_1180961
552 Ga0436362_0875299
553 Ga0451791_1591620
554 Ga0495603_0331353
555 Ga0495629_0303259
556 Ga0495651_0006879
557 Ga0495651_0061920
558 Ga0495651_0091489
559 Ga0495653_0076762
560 Ga0495653_0111328
561 Ga0495653_0226648
562 Ga0495580_0081994
563 Ga0495582_0079692
564 Ga0495664_0002418
565 Ga0495608_0049626
566 Ga0495628_0304887
567 Ga0495630_0245837
568 Ga0495652_0047728
569 Ga0495640_0173223
570 Ga0495587_0255757
571 Ga0495667_0218922
572 Ga0495657_0026053
573 Ga0495599_0268771
574 Ga0495623_0023773
575 Ga0495646_0008683
576 Ga0495658_0091611
577 Ga0495613_0389725
578 Ga0495600_0168592
579 Ga0495604_0050273
580 Ga0495674_0021834
581 Ga0495674_0073541
582 Ga0495672_0187624
583 Ga0495680_0104847
584 Ga0495680_0235982
585 Ga0495675_0109381
586 Ga0495684_0125728
587 Ga0495684_0280935
588 Ga0495602_0000599
589 Ga0495602_0041103
590 Ga0495602_0110293
591 Ga0496102_0012657
592 Ga0496105_0181025
593 Ga0496106_0001668
594 Ga0496107_0007404
595 Ga0496114_0279164
596 Ga0496119_0007805
597 Ga0496120_0001320
598 Ga0496121_0165236
599 Ga0501074_0282802
600 Ga0501076_1010252
601 Ga0501079_0941094
602 nmdc:mga03683_46784_c1
603 nmdc:mga03n38_44966_c1
604 nmdc:mga06z11_2143_c1
605 nmdc:mga04h51_82019_c1
606 nmdc:mga05p37_1209528_c1
607 nmdc:mga05p37_154784_c1
608 nmdc:mga05p37_362655_c1
609 nmdc:mga09592_210365_c1
610 nmdc:mga09592_21853_c1
611 nmdc:mga09592_299769_c1
612 nmdc:mga09592_84662_c1
613 nmdc:mga0qj67_176018_c1
614 nmdc:mga0qj67_204780_c1
615 nmdc:mga0qj67_3046_c1
616 nmdc:mga0qj67_37632_c1
617 nmdc:mga0qj67_379117_c1
618 nmdc:mga06r32_350079_c1
619 nmdc:mga06r32_3543_c1
620 nmdc:mga06r32_59895_c1
621 nmdc:mga06r32_647666_c1
622 nmdc:mga06r32_959693_c1
623 nmdc:mga08y16_604523_c1
624 nmdc:mga0n895_582565_c1
625 Ga0495601_0000358
626 Ga0495612_0002468
627 Ga0495612_0005007
628 Ga0495595_0091544
629 Ga0495619_0104537
630 Ga0495619_0183790
631 Ga0500651_0285166
632 Ga0500658_0043741
633 Ga0500568_0002568
634 Ga0500616_0064007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

20

94

0.95

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

24

100

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

116

203

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

107

196

0.87

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

30

95

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zfg-assembly1.cif.gz_B crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori 0.8978 1 185
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.8958 3 184
3f6d-assembly1.cif.gz_B crystal structure of a genetically modified delta class gst (adgstd4-4) from anopheles dirus, f123a, in complex with s-hexyl glutathione 0.8945 3 186
3f6d-assembly1.cif.gz_A crystal structure of a genetically modified delta class gst (adgstd4-4) from anopheles dirus, f123a, in complex with s-hexyl glutathione 0.8935 3 185
6f05-assembly2.cif.gz_A arabidopsis thaliana gstf9, gso3 bound 0.8932 1 181
ID Description Score Start End Superfamily
4gf0A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9545 1 80 3.40.30.10
4mpgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.952 2 77 3.40.30.10
3ljrB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9488 2 77 3.40.30.10
4gf0B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9413 3 80 3.40.30.10
af_D3Z8I7_45_138_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9373 2 77 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4S0J812-F1-model_v4 Glutathione S-transferase 0.9807 2 83 GO:0016740
AF-A0A2D9F2W1-F1-model_v4 Glutathione S-transferase 0.9664 2 185 GO:0016740
AF-A0A2E4Y1A4-F1-model_v4 Glutathione S-transferase 0.9659 1 185 GO:0016740
AF-T0IDY0-F1-model_v4 GST N-terminal domain-containing protein 0.9647 1 101
AF-A0A1Q3KB35-F1-model_v4 Glutathione S-transferase 0.9635 1 185

Map