F404214

General Info

Members Datasets Scaffolds Average Seq Length
317 224 634 316

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10080076|Ga0307508_100800763
Length 364
Sequence MALYNDAVMPGLVPGIHVLGGSRKKDVDGRVKPGHDESIYLRERGRPMNEPADAITPQDIERCERLIRPYIRRTPVIAVDGSEFGAVTGPLTLKLELLQHAGVFKARGAFTHLLTREIPKAGVVAASGGNHGAAVAYAAMRLGKPAKIFVPSVSSPAKIARIREYGADLTVGGEFYAEALAASEAWVQQTGAMPVHAFDQVETIMGQGTLALELEQQAPDIDTLLVSVGGGGLVAGIAAWYAGRVKVVGVEPEASPTLTKALEAGHPVDANVGGLAADSLAPRQVGQIVFPIVQKYAPQTVLVTDEAIAGAQKTLWRALRIVAEPGGACAFSAITSGAYRPATGERVAVVISGGNTTAVNFDAR

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
207 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
210 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
214 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
215 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
216 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
217 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
218 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
219 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
220 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
221 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
222 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
223 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
224 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 3.15
Rhizoplane 4.1
Rhizosphere 73.82
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10080076 3300031616 Bacteria 2848
2 JGI25153J46596_10009435 3300003215 Bacteria 4534
3 JGI25404J52841_10008871 3300003659 Bacteria 2146
4 Ga0068869_100021002 3300005334 Bacteria 4487
5 Ga0068869_100133936 3300005334 Bacteria 1907
6 Ga0070680_100288222 3300005336 Bacteria 1391
7 Ga0068868_100088411 3300005338 Bacteria 2493
8 Ga0070668_100086518 3300005347 Bacteria 2464
9 Ga0070668_100149701 3300005347 Bacteria 1886
10 Ga0070669_100213986 3300005353 Bacteria 1522
11 Ga0070671_100486389 3300005355 Bacteria 1061
12 Ga0070674_100025726 3300005356 Bacteria 3834
13 Ga0070674_100435692 3300005356 Bacteria 1079
14 Ga0070667_100058688 3300005367 Bacteria 3253
15 Ga0070709_10014232 3300005434 Bacteria 4497
16 Ga0070709_10149015 3300005434 Unclassified 1615
17 Ga0070714_100047041 3300005435 Bacteria 3663
18 Ga0070714_100099474 3300005435 Bacteria 2560
19 Ga0070713_100002876 3300005436 Bacteria 11264
20 Ga0070713_100016544 3300005436 Bacteria 5546
21 Ga0070701_10128702 3300005438 Bacteria 1436
22 Ga0070711_100039293 3300005439 Unclassified 3186
23 Ga0070700_100249017 3300005441 Bacteria 1273
24 Ga0070678_100018201 3300005456 Bacteria 4549
25 Ga0070681_10022333 3300005458 Bacteria 6353
26 Ga0070706_100104587 3300005467 Bacteria 2633
27 Ga0070707_100033090 3300005468 Bacteria 4928
28 Ga0070698_100027088 3300005471 Bacteria 5961
29 Ga0070679_100137073 3300005530 Bacteria 2428
30 Ga0070672_100055321 3300005543 Bacteria 3108
31 Ga0070665_100009064 3300005548 Bacteria 10079
32 Ga0070665_100132139 3300005548 Bacteria 2498
33 Ga0068855_100208334 3300005563 Bacteria 2198
34 Ga0068857_100092893 3300005577 Bacteria 2702
35 Ga0068852_100013206 3300005616 Bacteria 6314
36 Ga0068852_100196246 3300005616 Bacteria 1908
37 Ga0068859_100055291 3300005617 Bacteria 3994
38 Ga0068859_100439413 3300005617 Bacteria 1401
39 Ga0068866_10032130 3300005718 Bacteria 2535
40 Ga0068861_100156667 3300005719 Bacteria 1874
41 Ga0068861_100184884 3300005719 Bacteria 1737
42 Ga0068870_10129942 3300005840 Bacteria 1462
43 Ga0068863_100326289 3300005841 Bacteria 1492
44 Ga0068858_100111873 3300005842 Bacteria 2550
45 Ga0068860_100162250 3300005843 Bacteria 2155
46 Ga0068860_100265954 3300005843 Bacteria 1672
47 Ga0068862_100063057 3300005844 Bacteria 3189
48 Ga0068862_100176690 3300005844 Bacteria 1914
49 Ga0068862_100191106 3300005844 Bacteria 1842
50 Ga0081455_10003793 3300005937 Bacteria 17254
51 Ga0081455_10024687 3300005937 Bacteria 5561
52 Ga0081540_1002721 3300005983 Bacteria 14386
53 Ga0081540_1006906 3300005983 Bacteria 8187
54 Ga0081540_1077091 3300005983 Bacteria 1516
55 Ga0081539_10078485 3300005985 Bacteria 1743
56 Ga0070717_10001946 3300006028 Bacteria 14419
57 Ga0070717_10031075 3300006028 Bacteria 4294
58 Ga0070717_10367724 3300006028 Bacteria 1288
59 Ga0075365_10012023 3300006038 Bacteria 5119
60 Ga0075365_10076578 3300006038 Bacteria 2259
61 Ga0075365_10213103 3300006038 Bacteria 1354
62 Ga0075364_10005205 3300006051 Bacteria 7547
63 Ga0075364_10010223 3300006051 Bacteria 5660
64 Ga0070716_100043991 3300006173 Bacteria 2500
65 Ga0075362_10001212 3300006177 Bacteria 8111
66 Ga0075367_10083422 3300006178 Bacteria 1936
67 Ga0075369_10042176 3300006186 Bacteria 1955
68 Ga0075370_10058052 3300006353 Bacteria 2201
69 Ga0075433_10003083 3300006852 Bacteria 12811
70 Ga0075434_100003560 3300006871 Bacteria 13909
71 Ga0075434_100021279 3300006871 Bacteria 6304
72 Ga0075434_100611071 3300006871 Bacteria 1109
73 Ga0068865_100229811 3300006881 Bacteria 1455
74 Ga0075436_100006135 3300006914 Bacteria 8254
75 Ga0075436_100100999 3300006914 Bacteria 2009
76 Ga0097620_100055300 3300006931 Bacteria 3994
77 Ga0097620_100439389 3300006931 Bacteria 1401
78 Ga0075435_100024686 3300007076 Bacteria 4668
79 Ga0075435_100116595 3300007076 Bacteria 2225
80 Ga0105250_10028655 3300009092 Bacteria 2242
81 Ga0105240_10001363 3300009093 Bacteria 41954
82 Ga0105240_10063341 3300009093 Bacteria 4600
83 Ga0111539_10396006 3300009094 Bacteria 1608
84 Ga0105245_10150941 3300009098 Bacteria 2197
85 Ga0105247_10054432 3300009101 Bacteria 2469
86 Ga0114129_10339611 3300009147 Bacteria 1992
87 Ga0105243_10460299 3300009148 Bacteria 1196
88 Ga0105241_10014169 3300009174 Bacteria 5842
89 Ga0105241_10496268 3300009174 Bacteria 1088
90 Ga0105237_10030554 3300009545 Bacteria 5470
91 Ga0105237_10239644 3300009545 Bacteria 1815
92 Ga0105238_10006744 3300009551 Bacteria 11467
93 Ga0105238_10362146 3300009551 Bacteria 1440
94 Ga0105249_10120704 3300009553 Bacteria 2490
95 Ga0105249_10201121 3300009553 Bacteria 1950
96 Ga0105249_10338535 3300009553 Bacteria 1520
97 Ga0105239_10108053 3300010375 Bacteria 3082
98 Ga0105239_10675576 3300010375 Bacteria 1180
99 Ga0105246_10084077 3300011119 Bacteria 2276
100 Ga0157373_10001642 3300013100 Bacteria 17076
101 Ga0157370_10012463 3300013104 Bacteria 8814
102 Ga0157369_10014455 3300013105 Bacteria 8911
103 Ga0157374_10037205 3300013296 Bacteria 4465
104 Ga0157378_10058128 3300013297 Bacteria 3449
105 Ga0157375_10249185 3300013308 Bacteria 1937
106 Ga0157375_10580137 3300013308 Bacteria 1282
107 Ga0163163_10087878 3300014325 Bacteria 3119
108 Ga0163163_10237483 3300014325 Bacteria 1872
109 Ga0157380_10091584 3300014326 Bacteria 2510
110 Ga0157380_10257400 3300014326 Bacteria 1583
111 Ga0157379_10028257 3300014968 Bacteria 4991
112 Ga0157379_10060226 3300014968 Bacteria 3394
113 Ga0157376_10064473 3300014969 Bacteria 3090
114 Ga0157376_10427835 3300014969 Bacteria 1286
115 Ga0163161_10192135 3300017792 Bacteria 1570
116 Ga0213876_10009160 3300021384 Bacteria 5331
117 Ga0213876_10075173 3300021384 Unclassified 1784
118 Ga0213875_10003370 3300021388 Bacteria 9107
119 Ga0209758_1001512 3300025297 Bacteria 26996
120 Ga0209758_1004654 3300025297 Bacteria 11239
121 Ga0209758_1005382 3300025297 Bacteria 9906
122 Ga0207696_1036408 3300025711 Bacteria 1461
123 Ga0207642_10015304 3300025899 Bacteria 2855
124 Ga0207642_10036984 3300025899 Bacteria 2100
125 Ga0207688_10033296 3300025901 Bacteria 2849
126 Ga0207699_10022770 3300025906 Bacteria 3400
127 Ga0207699_10054324 3300025906 Bacteria 2378
128 Ga0207643_10197655 3300025908 Bacteria 1223
129 Ga0207684_10076402 3300025910 Bacteria 2847
130 Ga0207684_10459800 3300025910 Bacteria 1092
131 Ga0207660_10080000 3300025917 Bacteria 2398
132 Ga0207652_10026675 3300025921 Bacteria 4814
133 Ga0207681_10115942 3300025923 Bacteria 1956
134 Ga0207681_10174461 3300025923 Bacteria 1632
135 Ga0207694_10231640 3300025924 Bacteria 1508
136 Ga0207700_10025286 3300025928 Bacteria 4121
137 Ga0207664_10140163 3300025929 Bacteria 2044
138 Ga0207644_10055581 3300025931 Bacteria 2854
139 Ga0207644_10109530 3300025931 Bacteria 2087
140 Ga0207690_10107385 3300025932 Bacteria 2005
141 Ga0207669_10017935 3300025937 Bacteria 3645
142 Ga0207669_10104330 3300025937 Bacteria 1883
143 Ga0207665_10181206 3300025939 Bacteria 1526
144 Ga0207691_10015973 3300025940 Bacteria 7132
145 Ga0207689_10027064 3300025942 Bacteria 4800
146 Ga0207689_10044773 3300025942 Bacteria 3659
147 Ga0207689_10115064 3300025942 Bacteria 2211
148 Ga0207689_10182475 3300025942 Bacteria 1730
149 Ga0207667_10289141 3300025949 Bacteria 1675
150 Ga0207712_10164931 3300025961 Bacteria 1726
151 Ga0207712_10191881 3300025961 Bacteria 1613
152 Ga0207668_10020457 3300025972 Bacteria 4205
153 Ga0207668_10063852 3300025972 Bacteria 2600
154 Ga0207677_10303845 3300026023 Bacteria 1319
155 Ga0207703_10041250 3300026035 Bacteria 3696
156 Ga0207703_10158620 3300026035 Bacteria 1979
157 Ga0207678_10238334 3300026067 Bacteria 1558
158 Ga0207708_10223099 3300026075 Bacteria 1511
159 Ga0207702_10100756 3300026078 Bacteria 2549
160 Ga0207648_10387591 3300026089 Bacteria 1264
161 Ga0207676_10162358 3300026095 Bacteria 1937
162 Ga0207674_10175455 3300026116 Bacteria 2096
163 Ga0207675_100055502 3300026118 Bacteria 3695
164 Ga0207675_100110040 3300026118 Bacteria 2600
165 Ga0207675_100172146 3300026118 Bacteria 2070
166 Ga0207675_100245883 3300026118 Bacteria 1730
167 Ga0268266_10002502 3300028379 Bacteria 19605
168 Ga0268266_10027058 3300028379 Bacteria 4879
169 Ga0268266_10119526 3300028379 Bacteria 2343
170 Ga0268265_10097296 3300028380 Bacteria 2367
171 Ga0268265_10107422 3300028380 Bacteria 2269
172 Ga0268264_10596398 3300028381 Bacteria 1088
173 Ga0307517_10000098 3300028786 Bacteria 126044
174 Ga0307513_10084453 3300031456 Bacteria 3261
175 Ga0307509_10249460 3300031507 Bacteria 1560
176 Ga0307408_100152985 3300031548 Archaea 1823
177 Ga0307407_10190597 3300031903 Bacteria 1366
178 Ga0307412_10048505 3300031911 Unclassified 2793
179 Ga0307412_10103860 3300031911 Bacteria 2015
180 Ga0307416_100091890 3300032002 Archaea 2608
181 Ga0307510_10002727 3300033180 Bacteria 20213
182 Ga0373958_0007718 3300034819 Bacteria 1724
183 Ga0373959_0025011 3300034820 Bacteria 1171
184 Ga0373928_0007559 3300035084 Bacteria 2098
185 Ga0373940_0017919 3300035088 Unclassified 1770
186 Ga0373952_0007348 3300035092 Unclassified 2063
187 Ga0373939_0005441 3300035114 Bacteria 3033
188 Ga0373941_0016723 3300035115 Bacteria 1999
189 Ga0373960_0043371 3300035121 Bacteria 1310
190 Ga0373943_0017758 3300035170 Bacteria 3258
191 Ga0373961_0006273 3300035241 Bacteria 2858
192 Ga0373931_0004388 3300035691 Bacteria 6441
193 Ga0373927_0041938 3300035695 Bacteria 2967
194 Ga0373927_0068521 3300035695 Bacteria 2296
195 Ga0373927_0114970 3300035695 Bacteria 1754
196 Ga0373925_0114574 3300037068 Bacteria 2087
197 Ga0436364_0535331 3300037853 Bacteria 45862
198 Ga0436365_0291649 3300039437 Bacteria 1788
199 Ga0436365_0469579 3300039437 Bacteria 37854
200 Ga0436365_1430330 3300039437 Bacteria 3253
201 Ga0439450_003048 3300042008 Bacteria 2722
202 Ga0439460_0000342 3300042461 Bacteria 9765
203 Ga0466967_0515137 3300045976 Bacteria 1175
204 Ga0495617_017912 3300046452 Bacteria 2394
205 Ga0495603_0006481 3300046455 Bacteria 7010
206 Ga0495590_0024499 3300046457 Bacteria 2126
207 Ga0495638_0014559 3300046460 Bacteria 5310
208 Ga0495638_0073229 3300046460 Bacteria 2091
209 Ga0495638_0124344 3300046460 Bacteria 1521
210 Ga0495582_0030781 3300046473 Bacteria 2948
211 Ga0495639_0104879 3300046475 Bacteria 1338
212 Ga0495584_0037219 3300046491 Bacteria 2458
213 Ga0495584_0209760 3300046491 Bacteria 990
214 Ga0495585_0019356 3300046492 Bacteria 3925
215 Ga0495594_0142864 3300046499 Bacteria 1358
216 Ga0495606_0066799 3300046507 Bacteria 2279
217 Ga0495610_0070004 3300046512 Bacteria 1640
218 Ga0495631_0008671 3300046518 Bacteria 5117
219 Ga0495632_0046907 3300046519 Bacteria 2145
220 Ga0495632_0051286 3300046519 Bacteria 2031
221 Ga0495632_0077972 3300046519 Bacteria 1584
222 Ga0495643_0174986 3300046522 Bacteria 1046
223 Ga0495666_0043023 3300046526 Bacteria 2183
224 Ga0495642_0112875 3300046528 Bacteria 1163
225 Ga0495609_0038041 3300046538 Bacteria 2170
226 Ga0495622_0025457 3300046557 Bacteria 2763
227 Ga0495622_0057551 3300046557 Bacteria 1802
228 Ga0495668_0012228 3300046616 Bacteria 5100
229 Ga0495668_0017318 3300046616 Bacteria 4180
230 Ga0495668_0092926 3300046616 Bacteria 1652
231 Ga0495668_0127641 3300046616 Bacteria 1392
232 Ga0495611_0072514 3300046648 Bacteria 1576
233 Ga0495625_0148610 3300046660 Bacteria 1576
234 Ga0495625_0231454 3300046660 Bacteria 1207
235 Ga0495658_0238466 3300046683 Bacteria 1142
236 Ga0495670_0051802 3300046691 Bacteria 2054
237 Ga0495604_0249780 3300047317 Bacteria 1210
238 Ga0495672_0005964 3300047320 Bacteria 9545
239 Ga0495672_0183206 3300047320 Bacteria 1059
240 Ga0495676_0048493 3300047321 Bacteria 3424
241 Ga0495673_0049155 3300047469 Bacteria 1857
242 Ga0495686_0103557 3300047472 Bacteria 1715
243 Ga0495602_0304364 3300048088 Bacteria 1165
244 Ga0496100_0170479 3300048903 Bacteria 1567
245 Ga0496102_0105547 3300048905 Bacteria 2621
246 Ga0496102_0428596 3300048905 Bacteria 1242
247 Ga0496103_0098839 3300048906 Bacteria 1846
248 Ga0496104_0000563 3300048907 Bacteria 31633
249 Ga0496105_0007588 3300048908 Bacteria 8407
250 Ga0496105_0147190 3300048908 Bacteria 1936
251 Ga0496107_0030997 3300048910 Bacteria 3813
252 Ga0496107_0360756 3300048910 Bacteria 1081
253 Ga0496108_0010490 3300048911 Bacteria 7526
254 Ga0496112_0022164 3300048915 Bacteria 6052
255 Ga0496113_0003665 3300048916 Bacteria 9243
256 Ga0496115_0088073 3300048918 Bacteria 2534
257 Ga0496118_0041772 3300048921 Bacteria 3626
258 Ga0496119_0072404 3300048922 Bacteria 2014
259 Ga0496119_0079437 3300048922 Bacteria 1895
260 Ga0496120_0071633 3300048923 Bacteria 1902
261 Ga0496121_0000754 3300048924 Bacteria 59457
262 Ga0496121_0034817 3300048924 Bacteria 4525
263 Ga0496121_0053002 3300048924 Bacteria 3401
264 Ga0496121_0072096 3300048924 Bacteria 2774
265 Ga0496121_0108053 3300048924 Bacteria 2129
266 Ga0496124_0128314 3300048927 Bacteria 2018
267 Ga0496124_0195460 3300048927 Bacteria 1544
268 Ga0496125_0041953 3300048928 Bacteria 3905
269 Ga0496125_0054114 3300048928 Bacteria 3283
270 Ga0496126_0013909 3300048929 Bacteria 8163
271 Ga0496126_0028888 3300048929 Bacteria 5276
272 Ga0496126_0166716 3300048929 Bacteria 1879
273 Ga0496126_0180288 3300048929 Bacteria 1795
274 Ga0495678_065755 3300049459 Bacteria 1345
275 Ga0501039_0169813 3300049575 Bacteria 1715
276 Ga0501048_0084489 3300049582 Bacteria 2239
277 Ga0501067_0013424 3300049583 Bacteria 4537
278 Ga0501075_0050098 3300049591 Bacteria 3139
279 Ga0501079_0107347 3300049741 Bacteria 2167
280 Ga0501080_0301582 3300049742 Bacteria 1453
281 Ga0501081_0065793 3300049743 Bacteria 2520
282 Ga0501081_0073583 3300049743 Bacteria 2383
283 nmdc:mga00v17_28861_c1 3300050491 Bacteria 3252
284 nmdc:mga0yw44_114799_c1 3300050492 Bacteria 1729
285 nmdc:mga0yw44_90118_c1 3300050492 Bacteria 1937
286 nmdc:mga05p37_631476_c1 3300050507 Bacteria 1203
287 nmdc:mga0n895_47337_c1 3300050512 Bacteria 4204
288 nmdc:mga0n895_5632_c1 3300050512 Bacteria 10498
289 nmdc:mga0rr50_120562_c1 3300050513 Bacteria 2087
290 nmdc:mga0rr50_67059_c1 3300050513 Bacteria 2725
291 nmdc:mga0sz30_34448_c1 3300050516 Bacteria 2108
292 Ga0500581_090095 3300053089 Bacteria 1521
293 Ga0500566_0086518 3300053094 Bacteria 1737
294 Ga0500650_0049609 3300053098 Bacteria 1948
295 Ga0500562_012076 3300053108 Bacteria 2194
296 Ga0500595_004102 3300053119 Bacteria 6605
297 Ga0500577_0057901 3300053142 Bacteria 1480
298 Ga0500589_088688 3300053147 Bacteria 1367
299 Ga0500590_069171 3300053148 Bacteria 1758
300 Ga0500622_0065689 3300053156 Bacteria 1843
301 Ga0500638_060256 3300053162 Bacteria 1825
302 Ga0500637_0062291 3300053178 Bacteria 2137
303 Ga0500645_042720 3300053730 Bacteria 1336
304 Ga0530510_0137346 3300061734 Bacteria 1800
305 Ga0530510_0291209 3300061734 Bacteria 1221
306 2513697214 2513237101 Bacteria 7952346
307 2723848741 2721755755 Bacteria 8322773
308 2874606131 2874604998 Bacteria 7834745
309 2876817320 2876808645 Bacteria 8824342
310 2879117770 2879110137 Bacteria 8907982
311 2889036657 2889033259 Bacteria 9099371
312 2922363513 2922361189 Bacteria 7436256
313 2922389630 2922386360 Bacteria 7017218
314 8006970114 8006964411 Bacteria 8966052
315 8006999006 8006994254 Bacteria 8309700
316 8056675459 8056673599 Bacteria 7871253
317 8056681803 8056681323 Bacteria 8472857
318 Ga0307508_10080076
319 JGI25153J46596_10009435
320 JGI25404J52841_10008871
321 Ga0068869_100021002
322 Ga0068869_100133936
323 Ga0070680_100288222
324 Ga0068868_100088411
325 Ga0070668_100086518
326 Ga0070668_100149701
327 Ga0070669_100213986
328 Ga0070671_100486389
329 Ga0070674_100025726
330 Ga0070674_100435692
331 Ga0070667_100058688
332 Ga0070709_10014232
333 Ga0070709_10149015
334 Ga0070714_100047041
335 Ga0070714_100099474
336 Ga0070713_100002876
337 Ga0070713_100016544
338 Ga0070701_10128702
339 Ga0070711_100039293
340 Ga0070700_100249017
341 Ga0070678_100018201
342 Ga0070681_10022333
343 Ga0070706_100104587
344 Ga0070707_100033090
345 Ga0070698_100027088
346 Ga0070679_100137073
347 Ga0070672_100055321
348 Ga0070665_100009064
349 Ga0070665_100132139
350 Ga0068855_100208334
351 Ga0068857_100092893
352 Ga0068852_100013206
353 Ga0068852_100196246
354 Ga0068859_100055291
355 Ga0068859_100439413
356 Ga0068866_10032130
357 Ga0068861_100156667
358 Ga0068861_100184884
359 Ga0068870_10129942
360 Ga0068863_100326289
361 Ga0068858_100111873
362 Ga0068860_100162250
363 Ga0068860_100265954
364 Ga0068862_100063057
365 Ga0068862_100176690
366 Ga0068862_100191106
367 Ga0081455_10003793
368 Ga0081455_10024687
369 Ga0081540_1002721
370 Ga0081540_1006906
371 Ga0081540_1077091
372 Ga0081539_10078485
373 Ga0070717_10001946
374 Ga0070717_10031075
375 Ga0070717_10367724
376 Ga0075365_10012023
377 Ga0075365_10076578
378 Ga0075365_10213103
379 Ga0075364_10005205
380 Ga0075364_10010223
381 Ga0070716_100043991
382 Ga0075362_10001212
383 Ga0075367_10083422
384 Ga0075369_10042176
385 Ga0075370_10058052
386 Ga0075433_10003083
387 Ga0075434_100003560
388 Ga0075434_100021279
389 Ga0075434_100611071
390 Ga0068865_100229811
391 Ga0075436_100006135
392 Ga0075436_100100999
393 Ga0097620_100055300
394 Ga0097620_100439389
395 Ga0075435_100024686
396 Ga0075435_100116595
397 Ga0105250_10028655
398 Ga0105240_10001363
399 Ga0105240_10063341
400 Ga0111539_10396006
401 Ga0105245_10150941
402 Ga0105247_10054432
403 Ga0114129_10339611
404 Ga0105243_10460299
405 Ga0105241_10014169
406 Ga0105241_10496268
407 Ga0105237_10030554
408 Ga0105237_10239644
409 Ga0105238_10006744
410 Ga0105238_10362146
411 Ga0105249_10120704
412 Ga0105249_10201121
413 Ga0105249_10338535
414 Ga0105239_10108053
415 Ga0105239_10675576
416 Ga0105246_10084077
417 Ga0157373_10001642
418 Ga0157370_10012463
419 Ga0157369_10014455
420 Ga0157374_10037205
421 Ga0157378_10058128
422 Ga0157375_10249185
423 Ga0157375_10580137
424 Ga0163163_10087878
425 Ga0163163_10237483
426 Ga0157380_10091584
427 Ga0157380_10257400
428 Ga0157379_10028257
429 Ga0157379_10060226
430 Ga0157376_10064473
431 Ga0157376_10427835
432 Ga0163161_10192135
433 Ga0213876_10009160
434 Ga0213876_10075173
435 Ga0213875_10003370
436 Ga0209758_1001512
437 Ga0209758_1004654
438 Ga0209758_1005382
439 Ga0207696_1036408
440 Ga0207642_10015304
441 Ga0207642_10036984
442 Ga0207688_10033296
443 Ga0207699_10022770
444 Ga0207699_10054324
445 Ga0207643_10197655
446 Ga0207684_10076402
447 Ga0207684_10459800
448 Ga0207660_10080000
449 Ga0207652_10026675
450 Ga0207681_10115942
451 Ga0207681_10174461
452 Ga0207694_10231640
453 Ga0207700_10025286
454 Ga0207664_10140163
455 Ga0207644_10055581
456 Ga0207644_10109530
457 Ga0207690_10107385
458 Ga0207669_10017935
459 Ga0207669_10104330
460 Ga0207665_10181206
461 Ga0207691_10015973
462 Ga0207689_10027064
463 Ga0207689_10044773
464 Ga0207689_10115064
465 Ga0207689_10182475
466 Ga0207667_10289141
467 Ga0207712_10164931
468 Ga0207712_10191881
469 Ga0207668_10020457
470 Ga0207668_10063852
471 Ga0207677_10303845
472 Ga0207703_10041250
473 Ga0207703_10158620
474 Ga0207678_10238334
475 Ga0207708_10223099
476 Ga0207702_10100756
477 Ga0207648_10387591
478 Ga0207676_10162358
479 Ga0207674_10175455
480 Ga0207675_100055502
481 Ga0207675_100110040
482 Ga0207675_100172146
483 Ga0207675_100245883
484 Ga0268266_10002502
485 Ga0268266_10027058
486 Ga0268266_10119526
487 Ga0268265_10097296
488 Ga0268265_10107422
489 Ga0268264_10596398
490 Ga0307517_10000098
491 Ga0307513_10084453
492 Ga0307509_10249460
493 Ga0307408_100152985
494 Ga0307407_10190597
495 Ga0307412_10048505
496 Ga0307412_10103860
497 Ga0307416_100091890
498 Ga0307510_10002727
499 Ga0373958_0007718
500 Ga0373959_0025011
501 Ga0373928_0007559
502 Ga0373940_0017919
503 Ga0373952_0007348
504 Ga0373939_0005441
505 Ga0373941_0016723
506 Ga0373960_0043371
507 Ga0373943_0017758
508 Ga0373961_0006273
509 Ga0373931_0004388
510 Ga0373927_0041938
511 Ga0373927_0068521
512 Ga0373927_0114970
513 Ga0373925_0114574
514 Ga0436364_0535331
515 Ga0436365_0291649
516 Ga0436365_0469579
517 Ga0436365_1430330
518 Ga0439450_003048
519 Ga0439460_0000342
520 Ga0466967_0515137
521 Ga0495617_017912
522 Ga0495603_0006481
523 Ga0495590_0024499
524 Ga0495638_0014559
525 Ga0495638_0073229
526 Ga0495638_0124344
527 Ga0495582_0030781
528 Ga0495639_0104879
529 Ga0495584_0037219
530 Ga0495584_0209760
531 Ga0495585_0019356
532 Ga0495594_0142864
533 Ga0495606_0066799
534 Ga0495610_0070004
535 Ga0495631_0008671
536 Ga0495632_0046907
537 Ga0495632_0051286
538 Ga0495632_0077972
539 Ga0495643_0174986
540 Ga0495666_0043023
541 Ga0495642_0112875
542 Ga0495609_0038041
543 Ga0495622_0025457
544 Ga0495622_0057551
545 Ga0495668_0012228
546 Ga0495668_0017318
547 Ga0495668_0092926
548 Ga0495668_0127641
549 Ga0495611_0072514
550 Ga0495625_0148610
551 Ga0495625_0231454
552 Ga0495658_0238466
553 Ga0495670_0051802
554 Ga0495604_0249780
555 Ga0495672_0005964
556 Ga0495672_0183206
557 Ga0495676_0048493
558 Ga0495673_0049155
559 Ga0495686_0103557
560 Ga0495602_0304364
561 Ga0496100_0170479
562 Ga0496102_0105547
563 Ga0496102_0428596
564 Ga0496103_0098839
565 Ga0496104_0000563
566 Ga0496105_0007588
567 Ga0496105_0147190
568 Ga0496107_0030997
569 Ga0496107_0360756
570 Ga0496108_0010490
571 Ga0496112_0022164
572 Ga0496113_0003665
573 Ga0496115_0088073
574 Ga0496118_0041772
575 Ga0496119_0072404
576 Ga0496119_0079437
577 Ga0496120_0071633
578 Ga0496121_0000754
579 Ga0496121_0034817
580 Ga0496121_0053002
581 Ga0496121_0072096
582 Ga0496121_0108053
583 Ga0496124_0128314
584 Ga0496124_0195460
585 Ga0496125_0041953
586 Ga0496125_0054114
587 Ga0496126_0013909
588 Ga0496126_0028888
589 Ga0496126_0166716
590 Ga0496126_0180288
591 Ga0495678_065755
592 Ga0501039_0169813
593 Ga0501048_0084489
594 Ga0501067_0013424
595 Ga0501075_0050098
596 Ga0501079_0107347
597 Ga0501080_0301582
598 Ga0501081_0065793
599 Ga0501081_0073583
600 nmdc:mga00v17_28861_c1
601 nmdc:mga0yw44_114799_c1
602 nmdc:mga0yw44_90118_c1
603 nmdc:mga05p37_631476_c1
604 nmdc:mga0n895_47337_c1
605 nmdc:mga0n895_5632_c1
606 nmdc:mga0rr50_120562_c1
607 nmdc:mga0rr50_67059_c1
608 nmdc:mga0sz30_34448_c1
609 Ga0500581_090095
610 Ga0500566_0086518
611 Ga0500650_0049609
612 Ga0500562_012076
613 Ga0500595_004102
614 Ga0500577_0057901
615 Ga0500589_088688
616 Ga0500590_069171
617 Ga0500622_0065689
618 Ga0500638_060256
619 Ga0500637_0062291
620 Ga0500645_042720
621 Ga0530510_0137346
622 Ga0530510_0291209
623 2513697214
624 2723848741
625 2874606131
626 2876817320
627 2879117770
628 2889036657
629 2922363513
630 2922389630
631 8006970114
632 8006999006
633 8056675459
634 8056681803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

67

353

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9472 6 311
2zpu-assembly1.cif.gz_A crystal structure of modified serine racemase from s.pombe. 0.9308 7 311
1ve5-assembly1.cif.gz_A crystal structure of t.th. hb8 threonine deaminase 0.9237 8 310
5cvc-assembly2.cif.gz_B-2 structure of maize serine racemase 0.9223 11 317
6zsp-assembly1.cif.gz_BBB human serine racemase bound to atp and malonate. 0.9198 8 311
ID Description Score Start End Superfamily
af_X1WC99_42_136_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9582 74 151 3.40.50.1100
2gn1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9511 59 148 3.40.50.1100
af_P09367_100_172_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9447 82 151 3.40.50.1100
1pwhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9442 76 149 3.40.50.1100
af_Q9VHF0_106_202_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9432 58 151 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A1G5DT08-F1-model_v4 Threonine dehydratase 0.9878 7 311 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A2A3DHL2-F1-model_v4 Threonine dehydratase (EC 4.3.1.19) 0.9808 3 314 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A528ARW6-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9805 163 314 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0016020
AF-A0A6I3WPN7-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9792 18 310 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A520GST4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9792 63 310 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097

Map