F404209

General Info

Members Datasets Scaffolds Average Seq Length
317 200 634 239

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10031595|Ga0265760_100315951
Length 255
Sequence VLLQNPVFSGGPQMPNLNSIDTQLLQIVSGASPASIGDVIAVMQSIDGLLPSNDGVKWFNRLYLMVTQEVDAQPPPKGWEDATWLTRLDVVFAGFYFAAIAGALEQNADTASSWDALFEARASAGVDRIQFALAGMNAHINHDLALALLQTDDELHLTPALQSPEHDDYERVNGLLEDVLPSALNLLATGIVGELAQDTGKVGRLLAIWNVRAARDLAWDFADHLRNLRGMSRDLALEGQDKLTGVIGRSLLLPV

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 2.52
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 18.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10031595 3300031090 Unclassified 1562
2 rootL2_10100555 3300003322 Bacteria 13667
3 Ga0070658_10004653 3300005327 Bacteria 11162
4 Ga0070658_10410447 3300005327 Unclassified 1164
5 Ga0070683_100224878 3300005329 Bacteria 1783
6 Ga0068869_100032277 3300005334 Unclassified 3689
7 Ga0070660_100189038 3300005339 Unclassified 1668
8 Ga0070660_100222056 3300005339 Bacteria 1536
9 Ga0070689_100510044 3300005340 Unclassified 1031
10 Ga0070668_100203988 3300005347 Unclassified 1624
11 Ga0070671_100523624 3300005355 Unclassified 1021
12 Ga0070659_100163904 3300005366 Bacteria 1819
13 Ga0070659_100702982 3300005366 Bacteria 874
14 Ga0070667_100191452 3300005367 Unclassified 1812
15 Ga0070714_100396637 3300005435 Bacteria 1303
16 Ga0070713_100129518 3300005436 Unclassified 2223
17 Ga0070713_100171227 3300005436 Bacteria 1945
18 Ga0070663_100019283 3300005455 Bacteria 4492
19 Ga0070663_100070337 3300005455 Bacteria 2545
20 Ga0070681_10117799 3300005458 Bacteria 2592
21 Ga0070681_10288860 3300005458 Bacteria 1550
22 Ga0068867_100040515 3300005459 Unclassified 3400
23 Ga0070685_10034594 3300005466 Bacteria 2846
24 Ga0070679_100001639 3300005530 Bacteria 20156
25 Ga0070684_100343170 3300005535 Bacteria 1373
26 Ga0068853_100157740 3300005539 Bacteria 2045
27 Ga0068853_100493483 3300005539 Unclassified 1155
28 Ga0068853_100670267 3300005539 Bacteria 988
29 Ga0070693_100013382 3300005547 Unclassified 4178
30 Ga0070665_100067806 3300005548 Unclassified 3577
31 Ga0068855_100042659 3300005563 Bacteria 5375
32 Ga0070664_100366515 3300005564 Bacteria 1313
33 Ga0068857_100737917 3300005577 Bacteria 937
34 Ga0068854_100043417 3300005578 Bacteria 3186
35 Ga0068856_100218268 3300005614 Bacteria 1922
36 Ga0068856_101157730 3300005614 Bacteria 790
37 Ga0068852_100218736 3300005616 Bacteria 1811
38 Ga0068859_100014305 3300005617 Bacteria 7960
39 Ga0068866_10022807 3300005718 Bacteria 2902
40 Ga0068851_10317365 3300005834 Bacteria 899
41 Ga0068863_100018680 3300005841 Bacteria 6634
42 Ga0068858_100005662 3300005842 Bacteria 12214
43 Ga0068860_100031844 3300005843 Bacteria 5070
44 Ga0070717_10001998 3300006028 Bacteria 14260
45 Ga0070717_10003111 3300006028 Bacteria 11837
46 Ga0070717_10162801 3300006028 Bacteria 1936
47 Ga0097621_100343774 3300006237 Bacteria 1325
48 Ga0075433_10049662 3300006852 Bacteria 3649
49 Ga0075434_100046218 3300006871 Bacteria 4320
50 Ga0068865_100035354 3300006881 Unclassified 3358
51 Ga0097620_100014305 3300006931 Bacteria 7960
52 Ga0105240_10000002 3300009093 Bacteria 1924170
53 Ga0105240_10118124 3300009093 Bacteria 3196
54 Ga0105240_10498916 3300009093 Bacteria 1354
55 Ga0111539_10543658 3300009094 Unclassified 1353
56 Ga0105245_10081915 3300009098 Unclassified 2951
57 Ga0114129_10029285 3300009147 Bacteria 7799
58 Ga0105242_10263614 3300009176 Unclassified 1558
59 Ga0105248_10030495 3300009177 Bacteria 6022
60 Ga0105248_10152473 3300009177 Unclassified 2608
61 Ga0105237_10027092 3300009545 Bacteria 5854
62 Ga0105237_10100909 3300009545 Bacteria 2878
63 Ga0105237_10194298 3300009545 Bacteria 2029
64 Ga0105237_10515491 3300009545 Bacteria 1202
65 Ga0105237_10624319 3300009545 Bacteria 1085
66 Ga0105238_10120521 3300009551 Bacteria 2603
67 Ga0105238_10467573 3300009551 Bacteria 1259
68 Ga0105239_10005609 3300010375 Bacteria 14674
69 Ga0105239_10709579 3300010375 Unclassified 1150
70 Ga0157371_10346351 3300013102 Unclassified 1081
71 Ga0157370_10021363 3300013104 Bacteria 6449
72 Ga0157370_10031210 3300013104 Bacteria 5214
73 Ga0157369_10032320 3300013105 Bacteria 5756
74 Ga0157369_10192952 3300013105 Bacteria 2140
75 Ga0157369_10267152 3300013105 Unclassified 1783
76 Ga0157369_10391800 3300013105 Bacteria 1441
77 Ga0157369_10793566 3300013105 Bacteria 973
78 Ga0157374_10005199 3300013296 Bacteria 10913
79 Ga0157374_10042021 3300013296 Bacteria 4216
80 Ga0157374_10092904 3300013296 Bacteria 2880
81 Ga0157374_10351497 3300013296 Bacteria 1465
82 Ga0157374_10899125 3300013296 Bacteria 903
83 Ga0157378_10097404 3300013297 Bacteria 2681
84 Ga0163162_10009075 3300013306 Bacteria 9669
85 Ga0163162_10039533 3300013306 Bacteria 4714
86 Ga0163162_10280152 3300013306 Bacteria 1799
87 Ga0157372_10108144 3300013307 Bacteria 3182
88 Ga0157372_10209671 3300013307 Bacteria 2258
89 Ga0157372_10587389 3300013307 Bacteria 1298
90 Ga0157372_10679804 3300013307 Bacteria 1198
91 Ga0157375_10005423 3300013308 Bacteria 11088
92 Ga0163163_10007023 3300014325 Bacteria 9893
93 Ga0157377_10212819 3300014745 Bacteria 1233
94 Ga0157379_10014881 3300014968 Bacteria 6825
95 Ga0157379_10672663 3300014968 Unclassified 970
96 Ga0157376_10704588 3300014969 Unclassified 1015
97 Ga0182005_1050720 3300015265 Bacteria 1128
98 Ga0213875_10092478 3300021388 Bacteria 1411
99 Ga0209233_1002749 3300025261 Bacteria 6331
100 Ga0207692_10347419 3300025898 Unclassified 914
101 Ga0207642_10087513 3300025899 Bacteria 1530
102 Ga0207688_10438570 3300025901 Unclassified 813
103 Ga0207647_10002197 3300025904 Bacteria 14883
104 Ga0207647_10119998 3300025904 Bacteria 1551
105 Ga0207705_10001622 3300025909 Bacteria 17864
106 Ga0207705_10005476 3300025909 Bacteria 9494
107 Ga0207705_10019005 3300025909 Bacteria 4915
108 Ga0207705_10026581 3300025909 Bacteria 4127
109 Ga0207695_10000002 3300025913 Bacteria 2188391
110 Ga0207695_10184798 3300025913 Bacteria 2004
111 Ga0207671_10048906 3300025914 Bacteria 3129
112 Ga0207671_10159511 3300025914 Bacteria 1746
113 Ga0207663_10377651 3300025916 Bacteria 1079
114 Ga0207657_10181160 3300025919 Unclassified 1703
115 Ga0207652_10003063 3300025921 Bacteria 13955
116 Ga0207652_10036194 3300025921 Bacteria 4173
117 Ga0207694_10138424 3300025924 Unclassified 1956
118 Ga0207694_10266332 3300025924 Bacteria 1405
119 Ga0207700_10236105 3300025928 Bacteria 1557
120 Ga0207664_10108680 3300025929 Bacteria 2303
121 Ga0207664_10408280 3300025929 Bacteria 1209
122 Ga0207690_10103883 3300025932 Bacteria 2034
123 Ga0207690_10515028 3300025932 Bacteria 969
124 Ga0207686_10169058 3300025934 Unclassified 1540
125 Ga0207711_10799402 3300025941 Unclassified 878
126 Ga0207689_10002398 3300025942 Bacteria 17451
127 Ga0207661_10249436 3300025944 Bacteria 1577
128 Ga0207667_10035239 3300025949 Bacteria 5369
129 Ga0207667_10100774 3300025949 Bacteria 2979
130 Ga0207667_10168717 3300025949 Bacteria 2250
131 Ga0207703_10001099 3300026035 Bacteria 25670
132 Ga0207639_10171793 3300026041 Bacteria 1836
133 Ga0207678_10006446 3300026067 Bacteria 10410
134 Ga0207678_10781873 3300026067 Unclassified 842
135 Ga0207641_10015642 3300026088 Bacteria 6218
136 Ga0207648_10057963 3300026089 Unclassified 3378
137 Ga0207674_10020892 3300026116 Bacteria 7065
138 Ga0207698_10461611 3300026142 Bacteria 1228
139 Ga0207698_10704295 3300026142 Unclassified 1005
140 Ga0268266_10536598 3300028379 Bacteria 1120
141 Ga0268266_10711166 3300028379 Unclassified 968
142 Ga0268264_10048523 3300028381 Unclassified 3532
143 Ga0265762_1000112 3300030760 Bacteria 12060
144 Ga0265765_1009013 3300030879 Unclassified 1094
145 Ga0265325_10045121 3300031241 Bacteria 2291
146 Ga0265340_10022356 3300031247 Bacteria 3234
147 Ga0265340_10134728 3300031247 Bacteria 1131
148 Ga0265339_10052900 3300031249 Bacteria 2210
149 Ga0265313_10096990 3300031595 Bacteria 1314
150 Ga0373941_0022170 3300035115 Bacteria 1799
151 Ga0373955_0005999 3300035172 Bacteria 5511
152 Ga0373935_0120411 3300035692 Bacteria 1753
153 Ga0373937_0001995 3300036401 Bacteria 17066
154 Ga0373937_0055655 3300036401 Bacteria 3632
155 Ga0373925_0003699 3300037068 Bacteria 11744
156 Ga0436364_1181573 3300037853 Bacteria 4147
157 Ga0436365_0677678 3300039437 Unclassified 1829
158 Ga0451853_3810776 3300041512 Unclassified 981
159 Ga0439448_0045256 3300042005 Unclassified 1432
160 Ga0495592_0013269 3300046454 Bacteria 6273
161 Ga0495603_0001678 3300046455 Bacteria 13004
162 Ga0495603_0053708 3300046455 Bacteria 2390
163 Ga0495629_0006353 3300046459 Bacteria 8770
164 Ga0495651_0050584 3300046462 Bacteria 3206
165 Ga0495651_0084637 3300046462 Unclassified 2389
166 Ga0495650_0000029 3300046471 Bacteria 453466
167 Ga0495580_0025470 3300046472 Bacteria 4324
168 Ga0495580_0257119 3300046472 Bacteria 1195
169 Ga0495582_0006120 3300046473 Bacteria 6700
170 Ga0495582_0036053 3300046473 Bacteria 2720
171 Ga0495582_0363296 3300046473 Unclassified 834
172 Ga0495605_0041587 3300046474 Bacteria 2289
173 Ga0495639_0006248 3300046475 Bacteria 5119
174 Ga0495639_0149238 3300046475 Bacteria 1127
175 Ga0495664_0016853 3300046477 Bacteria 4171
176 Ga0495585_0008642 3300046492 Bacteria 6162
177 Ga0495594_0000220 3300046499 Bacteria 27809
178 Ga0495594_0000888 3300046499 Bacteria 15435
179 Ga0495594_0001332 3300046499 Bacteria 12832
180 Ga0495583_0035353 3300046506 Bacteria 2385
181 Ga0495606_0032504 3300046507 Bacteria 3613
182 Ga0495628_0091146 3300046516 Bacteria 2359
183 Ga0495630_0118637 3300046517 Bacteria 2007
184 Ga0495644_0000004 3300046523 Bacteria 158166
185 Ga0495642_0016966 3300046528 Bacteria 2842
186 Ga0495652_0222527 3300046529 Bacteria 1418
187 Ga0495665_0023218 3300046531 Bacteria 3330
188 Ga0495640_0317989 3300046533 Bacteria 964
189 Ga0495586_0237145 3300046535 Bacteria 1039
190 Ga0495609_0007664 3300046538 Bacteria 5364
191 Ga0495645_0054723 3300046543 Bacteria 2899
192 Ga0495622_0033097 3300046557 Bacteria 2413
193 Ga0495633_0031040 3300046558 Bacteria 2593
194 Ga0495667_0060659 3300046559 Bacteria 2480
195 Ga0495668_0252488 3300046616 Bacteria 965
196 Ga0495611_0010100 3300046648 Bacteria 3995
197 Ga0495625_0020306 3300046660 Bacteria 5131
198 Ga0495625_0211738 3300046660 Bacteria 1274
199 Ga0495635_0236002 3300046663 Bacteria 1234
200 Ga0495661_0040216 3300046665 Bacteria 2902
201 Ga0495588_0135848 3300046674 Bacteria 1298
202 Ga0495599_0018067 3300046678 Bacteria 4391
203 Ga0495623_0098402 3300046679 Bacteria 1785
204 Ga0495646_0058890 3300046680 Bacteria 2295
205 Ga0495646_0363520 3300046680 Bacteria 756
206 Ga0495658_0513057 3300046683 Unclassified 767
207 Ga0495669_0003351 3300046684 Bacteria 6595
208 Ga0495613_0002395 3300046689 Bacteria 14200
209 Ga0495613_0626003 3300046689 Unclassified 714
210 Ga0495600_0031026 3300046809 Bacteria 3461
211 Ga0495600_0117482 3300046809 Unclassified 1731
212 Ga0495581_0062699 3300047315 Bacteria 2148
213 Ga0495604_0027532 3300047317 Bacteria 4520
214 Ga0495680_0423332 3300047322 Bacteria 916
215 Ga0495675_0020127 3300047444 Bacteria 4241
216 Ga0495673_0008185 3300047469 Bacteria 5911
217 Ga0495686_0011483 3300047472 Bacteria 6238
218 Ga0495593_0023713 3300047673 Bacteria 3407
219 Ga0495593_0033326 3300047673 Bacteria 2805
220 Ga0495602_0080172 3300048088 Bacteria 2751
221 Ga0495614_0019299 3300048089 Bacteria 2950
222 Ga0496104_0284499 3300048907 Unclassified 1566
223 Ga0496104_0345430 3300048907 Unclassified 1401
224 Ga0496105_0152305 3300048908 Bacteria 1900
225 Ga0496112_0006059 3300048915 Bacteria 10563
226 Ga0496112_0466423 3300048915 Unclassified 1200
227 Ga0496114_0230321 3300048917 Unclassified 1628
228 Ga0496115_0354538 3300048918 Unclassified 1196
229 Ga0496115_0691341 3300048918 Unclassified 803
230 Ga0496119_0112292 3300048922 Bacteria 1511
231 Ga0496126_0001764 3300048929 Bacteria 32000
232 Ga0501031_0003652 3300049568 Bacteria 9905
233 Ga0501031_0046444 3300049568 Bacteria 2831
234 Ga0501031_0072509 3300049568 Unclassified 2242
235 Ga0501032_0010601 3300049569 Bacteria 6635
236 Ga0501032_0010692 3300049569 Bacteria 6605
237 Ga0501032_0016093 3300049569 Bacteria 5264
238 Ga0501033_0013556 3300049570 Bacteria 6205
239 Ga0501033_0017665 3300049570 Bacteria 5387
240 Ga0501033_0023314 3300049570 Bacteria 4668
241 Ga0501033_0076271 3300049570 Unclassified 2461
242 Ga0501034_0063703 3300049571 Bacteria 3700
243 Ga0501034_0135802 3300049571 Bacteria 2440
244 Ga0501036_0015739 3300049572 Bacteria 6317
245 Ga0501036_0037043 3300049572 Bacteria 4126
246 Ga0501036_0203804 3300049572 Unclassified 1663
247 Ga0501036_0521770 3300049572 Bacteria 988
248 Ga0501037_0000289 3300049573 Bacteria 42700
249 Ga0501037_0011335 3300049573 Bacteria 6562
250 Ga0501037_0061907 3300049573 Bacteria 2729
251 Ga0501038_0009516 3300049574 Bacteria 8919
252 Ga0501038_0021378 3300049574 Bacteria 5808
253 Ga0501038_0031338 3300049574 Bacteria 4699
254 Ga0501039_0007850 3300049575 Bacteria 8137
255 Ga0501042_0001011 3300049578 Bacteria 15990
256 Ga0501042_0025254 3300049578 Bacteria 4172
257 Ga0501042_0251834 3300049578 Viruses 1274
258 Ga0501043_0012902 3300049579 Bacteria 6530
259 Ga0501043_0038720 3300049579 Bacteria 3749
260 Ga0501046_0004276 3300049580 Bacteria 12997
261 Ga0501046_0012303 3300049580 Bacteria 7292
262 Ga0501046_0096930 3300049580 Bacteria 2266
263 Ga0501047_0088655 3300049581 Bacteria 2970
264 Ga0501047_0460554 3300049581 Bacteria 1100
265 Ga0501048_0001534 3300049582 Bacteria 17522
266 Ga0501048_0007958 3300049582 Bacteria 8028
267 Ga0501048_0014570 3300049582 Bacteria 5819
268 Ga0501067_0001911 3300049583 Bacteria 11457
269 Ga0501067_0005617 3300049583 Bacteria 6962
270 Ga0501067_0077856 3300049583 Viruses 1837
271 Ga0501068_0001440 3300049584 Bacteria 12628
272 Ga0501068_0012934 3300049584 Bacteria 4743
273 Ga0501068_0056631 3300049584 Bacteria 2376
274 Ga0501069_0004455 3300049585 Bacteria 7234
275 Ga0501069_0008874 3300049585 Bacteria 5299
276 Ga0501070_0065055 3300049586 Bacteria 3019
277 Ga0501070_0136568 3300049586 Bacteria 2024
278 Ga0501070_0465451 3300049586 Bacteria 1018
279 Ga0501071_0029926 3300049587 Bacteria 3847
280 Ga0501072_0059815 3300049588 Bacteria 3004
281 Ga0501072_0124989 3300049588 Bacteria 2049
282 Ga0501073_0006451 3300049589 Bacteria 8728
283 Ga0501073_0021668 3300049589 Bacteria 4629
284 Ga0501073_0081420 3300049589 Bacteria 2252
285 Ga0501074_0006521 3300049590 Bacteria 8426
286 Ga0501074_0026320 3300049590 Bacteria 4217
287 Ga0501074_0132946 3300049590 Unclassified 1779
288 Ga0501076_0025210 3300049592 Bacteria 4601
289 Ga0501079_0002760 3300049741 Bacteria 12807
290 Ga0501079_0009570 3300049741 Bacteria 7348
291 Ga0501079_0013577 3300049741 Bacteria 6213
292 Ga0501080_0011464 3300049742 Bacteria 8117
293 Ga0501080_0031601 3300049742 Bacteria 4933
294 Ga0501080_0047251 3300049742 Bacteria 4006
295 Ga0501080_0522354 3300049742 Bacteria 1059
296 Ga0501083_0015150 3300049744 Bacteria 5398
297 Ga0501083_0026237 3300049744 Bacteria 4028
298 Ga0501035_0009336 3300049822 Bacteria 9114
299 Ga0501035_0150161 3300049822 Bacteria 2022
300 Ga0501035_0222596 3300049822 Unclassified 1610
301 Ga0501044_0016255 3300049823 Bacteria 7995
302 Ga0501044_0044105 3300049823 Bacteria 4630
303 Ga0501044_0130170 3300049823 Unclassified 2511
304 Ga0501044_0254815 3300049823 Unclassified 1694
305 Ga0501045_0009857 3300049824 Bacteria 6683
306 Ga0501045_0021587 3300049824 Bacteria 4607
307 nmdc:mga08y16_1181497_c1 3300050511 Unclassified 736
308 nmdc:mga0a205_69142_c1 3300050515 Bacteria 3411
309 Ga0495601_0065556 3300053077 Bacteria 2312
310 Ga0500651_0000080 3300053093 Bacteria 62179
311 Ga0500595_000532 3300053119 Bacteria 22973
312 Ga0500573_0136009 3300053140 Bacteria 1357
313 Ga0501084_0116072 3300054114 Unclassified 2250
314 Ga0500661_000816 3300055283 Bacteria 5809
315 Ga0501082_0000913 3300060353 Bacteria 26035
316 Ga0501082_0015023 3300060353 Bacteria 6672
317 Ga0501082_0196351 3300060353 Unclassified 1755
318 Ga0265760_10031595
319 rootL2_10100555
320 Ga0070658_10004653
321 Ga0070658_10410447
322 Ga0070683_100224878
323 Ga0068869_100032277
324 Ga0070660_100189038
325 Ga0070660_100222056
326 Ga0070689_100510044
327 Ga0070668_100203988
328 Ga0070671_100523624
329 Ga0070659_100163904
330 Ga0070659_100702982
331 Ga0070667_100191452
332 Ga0070714_100396637
333 Ga0070713_100129518
334 Ga0070713_100171227
335 Ga0070663_100019283
336 Ga0070663_100070337
337 Ga0070681_10117799
338 Ga0070681_10288860
339 Ga0068867_100040515
340 Ga0070685_10034594
341 Ga0070679_100001639
342 Ga0070684_100343170
343 Ga0068853_100157740
344 Ga0068853_100493483
345 Ga0068853_100670267
346 Ga0070693_100013382
347 Ga0070665_100067806
348 Ga0068855_100042659
349 Ga0070664_100366515
350 Ga0068857_100737917
351 Ga0068854_100043417
352 Ga0068856_100218268
353 Ga0068856_101157730
354 Ga0068852_100218736
355 Ga0068859_100014305
356 Ga0068866_10022807
357 Ga0068851_10317365
358 Ga0068863_100018680
359 Ga0068858_100005662
360 Ga0068860_100031844
361 Ga0070717_10001998
362 Ga0070717_10003111
363 Ga0070717_10162801
364 Ga0097621_100343774
365 Ga0075433_10049662
366 Ga0075434_100046218
367 Ga0068865_100035354
368 Ga0097620_100014305
369 Ga0105240_10000002
370 Ga0105240_10118124
371 Ga0105240_10498916
372 Ga0111539_10543658
373 Ga0105245_10081915
374 Ga0114129_10029285
375 Ga0105242_10263614
376 Ga0105248_10030495
377 Ga0105248_10152473
378 Ga0105237_10027092
379 Ga0105237_10100909
380 Ga0105237_10194298
381 Ga0105237_10515491
382 Ga0105237_10624319
383 Ga0105238_10120521
384 Ga0105238_10467573
385 Ga0105239_10005609
386 Ga0105239_10709579
387 Ga0157371_10346351
388 Ga0157370_10021363
389 Ga0157370_10031210
390 Ga0157369_10032320
391 Ga0157369_10192952
392 Ga0157369_10267152
393 Ga0157369_10391800
394 Ga0157369_10793566
395 Ga0157374_10005199
396 Ga0157374_10042021
397 Ga0157374_10092904
398 Ga0157374_10351497
399 Ga0157374_10899125
400 Ga0157378_10097404
401 Ga0163162_10009075
402 Ga0163162_10039533
403 Ga0163162_10280152
404 Ga0157372_10108144
405 Ga0157372_10209671
406 Ga0157372_10587389
407 Ga0157372_10679804
408 Ga0157375_10005423
409 Ga0163163_10007023
410 Ga0157377_10212819
411 Ga0157379_10014881
412 Ga0157379_10672663
413 Ga0157376_10704588
414 Ga0182005_1050720
415 Ga0213875_10092478
416 Ga0209233_1002749
417 Ga0207692_10347419
418 Ga0207642_10087513
419 Ga0207688_10438570
420 Ga0207647_10002197
421 Ga0207647_10119998
422 Ga0207705_10001622
423 Ga0207705_10005476
424 Ga0207705_10019005
425 Ga0207705_10026581
426 Ga0207695_10000002
427 Ga0207695_10184798
428 Ga0207671_10048906
429 Ga0207671_10159511
430 Ga0207663_10377651
431 Ga0207657_10181160
432 Ga0207652_10003063
433 Ga0207652_10036194
434 Ga0207694_10138424
435 Ga0207694_10266332
436 Ga0207700_10236105
437 Ga0207664_10108680
438 Ga0207664_10408280
439 Ga0207690_10103883
440 Ga0207690_10515028
441 Ga0207686_10169058
442 Ga0207711_10799402
443 Ga0207689_10002398
444 Ga0207661_10249436
445 Ga0207667_10035239
446 Ga0207667_10100774
447 Ga0207667_10168717
448 Ga0207703_10001099
449 Ga0207639_10171793
450 Ga0207678_10006446
451 Ga0207678_10781873
452 Ga0207641_10015642
453 Ga0207648_10057963
454 Ga0207674_10020892
455 Ga0207698_10461611
456 Ga0207698_10704295
457 Ga0268266_10536598
458 Ga0268266_10711166
459 Ga0268264_10048523
460 Ga0265762_1000112
461 Ga0265765_1009013
462 Ga0265325_10045121
463 Ga0265340_10022356
464 Ga0265340_10134728
465 Ga0265339_10052900
466 Ga0265313_10096990
467 Ga0373941_0022170
468 Ga0373955_0005999
469 Ga0373935_0120411
470 Ga0373937_0001995
471 Ga0373937_0055655
472 Ga0373925_0003699
473 Ga0436364_1181573
474 Ga0436365_0677678
475 Ga0451853_3810776
476 Ga0439448_0045256
477 Ga0495592_0013269
478 Ga0495603_0001678
479 Ga0495603_0053708
480 Ga0495629_0006353
481 Ga0495651_0050584
482 Ga0495651_0084637
483 Ga0495650_0000029
484 Ga0495580_0025470
485 Ga0495580_0257119
486 Ga0495582_0006120
487 Ga0495582_0036053
488 Ga0495582_0363296
489 Ga0495605_0041587
490 Ga0495639_0006248
491 Ga0495639_0149238
492 Ga0495664_0016853
493 Ga0495585_0008642
494 Ga0495594_0000220
495 Ga0495594_0000888
496 Ga0495594_0001332
497 Ga0495583_0035353
498 Ga0495606_0032504
499 Ga0495628_0091146
500 Ga0495630_0118637
501 Ga0495644_0000004
502 Ga0495642_0016966
503 Ga0495652_0222527
504 Ga0495665_0023218
505 Ga0495640_0317989
506 Ga0495586_0237145
507 Ga0495609_0007664
508 Ga0495645_0054723
509 Ga0495622_0033097
510 Ga0495633_0031040
511 Ga0495667_0060659
512 Ga0495668_0252488
513 Ga0495611_0010100
514 Ga0495625_0020306
515 Ga0495625_0211738
516 Ga0495635_0236002
517 Ga0495661_0040216
518 Ga0495588_0135848
519 Ga0495599_0018067
520 Ga0495623_0098402
521 Ga0495646_0058890
522 Ga0495646_0363520
523 Ga0495658_0513057
524 Ga0495669_0003351
525 Ga0495613_0002395
526 Ga0495613_0626003
527 Ga0495600_0031026
528 Ga0495600_0117482
529 Ga0495581_0062699
530 Ga0495604_0027532
531 Ga0495680_0423332
532 Ga0495675_0020127
533 Ga0495673_0008185
534 Ga0495686_0011483
535 Ga0495593_0023713
536 Ga0495593_0033326
537 Ga0495602_0080172
538 Ga0495614_0019299
539 Ga0496104_0284499
540 Ga0496104_0345430
541 Ga0496105_0152305
542 Ga0496112_0006059
543 Ga0496112_0466423
544 Ga0496114_0230321
545 Ga0496115_0354538
546 Ga0496115_0691341
547 Ga0496119_0112292
548 Ga0496126_0001764
549 Ga0501031_0003652
550 Ga0501031_0046444
551 Ga0501031_0072509
552 Ga0501032_0010601
553 Ga0501032_0010692
554 Ga0501032_0016093
555 Ga0501033_0013556
556 Ga0501033_0017665
557 Ga0501033_0023314
558 Ga0501033_0076271
559 Ga0501034_0063703
560 Ga0501034_0135802
561 Ga0501036_0015739
562 Ga0501036_0037043
563 Ga0501036_0203804
564 Ga0501036_0521770
565 Ga0501037_0000289
566 Ga0501037_0011335
567 Ga0501037_0061907
568 Ga0501038_0009516
569 Ga0501038_0021378
570 Ga0501038_0031338
571 Ga0501039_0007850
572 Ga0501042_0001011
573 Ga0501042_0025254
574 Ga0501042_0251834
575 Ga0501043_0012902
576 Ga0501043_0038720
577 Ga0501046_0004276
578 Ga0501046_0012303
579 Ga0501046_0096930
580 Ga0501047_0088655
581 Ga0501047_0460554
582 Ga0501048_0001534
583 Ga0501048_0007958
584 Ga0501048_0014570
585 Ga0501067_0001911
586 Ga0501067_0005617
587 Ga0501067_0077856
588 Ga0501068_0001440
589 Ga0501068_0012934
590 Ga0501068_0056631
591 Ga0501069_0004455
592 Ga0501069_0008874
593 Ga0501070_0065055
594 Ga0501070_0136568
595 Ga0501070_0465451
596 Ga0501071_0029926
597 Ga0501072_0059815
598 Ga0501072_0124989
599 Ga0501073_0006451
600 Ga0501073_0021668
601 Ga0501073_0081420
602 Ga0501074_0006521
603 Ga0501074_0026320
604 Ga0501074_0132946
605 Ga0501076_0025210
606 Ga0501079_0002760
607 Ga0501079_0009570
608 Ga0501079_0013577
609 Ga0501080_0011464
610 Ga0501080_0031601
611 Ga0501080_0047251
612 Ga0501080_0522354
613 Ga0501083_0015150
614 Ga0501083_0026237
615 Ga0501035_0009336
616 Ga0501035_0150161
617 Ga0501035_0222596
618 Ga0501044_0016255
619 Ga0501044_0044105
620 Ga0501044_0130170
621 Ga0501044_0254815
622 Ga0501045_0009857
623 Ga0501045_0021587
624 nmdc:mga08y16_1181497_c1
625 nmdc:mga0a205_69142_c1
626 Ga0495601_0065556
627 Ga0500651_0000080
628 Ga0500595_000532
629 Ga0500573_0136009
630 Ga0501084_0116072
631 Ga0500661_000816
632 Ga0501082_0000913
633 Ga0501082_0015023
634 Ga0501082_0196351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19458

DUF5995

Family of unknown function (DUF5995)

36

254

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lz3-assembly1.cif.gz_A f95h epi-isozizaene synthase: complex with mg, inorganic pyrophosphate and benzyl triethyl ammonium cation 0.285 54 281
3atr-assembly1.cif.gz_A geranylgeranyl reductase (ggr) from sulfolobus acidocaldarius co-crystallized with its ligand 0.2661 118 280
5k7v-assembly1.cif.gz_A computational design of self-assembling cyclic protein homooligomers 0.2472 32 281
4lz3-assembly1.cif.gz_A f95h epi-isozizaene synthase: complex with mg, inorganic pyrophosphate and benzyl triethyl ammonium cation 0.2457 54 281
4lzc-assembly1.cif.gz_A w325f epi-isozizaene synthase: complex with mg, inorganic pyrophosphate 0.2358 54 281
ID Description Score Start End Superfamily
af_I1KZ54_5_149_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2904 31 206 1.25.40.10
af_Q9FRI5_169_312_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2852 35 220 1.25.40.10
af_Q9FRI5_169_312_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2822 35 220 1.25.40.10
af_I1KZ54_5_149_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.263 31 206 1.25.40.10
af_A0A0R4IJ79_48_239_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.263 84 272 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2N9M8E8-F1-model_v4 Uncharacterized protein 0.9667 50 284
AF-A0A535VRM5-F1-model_v4 Uncharacterized protein 0.9424 50 284
AF-A0A2N9M8E8-F1-model_v4 Uncharacterized protein 0.9393 50 284
AF-A0A7W0NMC4-F1-model_v4 Uncharacterized protein 0.934 55 192
AF-A0A3B7DCB9-F1-model_v4 Uncharacterized protein 0.9275 63 282

Map