F404154

General Info

Members Datasets Scaffolds Average Seq Length
317 171 634 308

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10088159|Ga0163162_100881594
Length 349
Sequence MTIVQSWCGPRLYTHKSICGLHRWMFRFAMNHDVTRRKFLGATLAGGATILAGGLPKLVTAADATKSTFQLGGDVTVDRLGFGAMRLTGAGIWGWPPDRENAKKVLRRAIELGVNLIDTADAYGPETDELLIAEALHPYPRGLVIATKGGITRPGPGQWVPNGRPEYLSQCVDKSLKRLKLDRIDLYQLHTVDRKVPIEESLGALKAAQDAGKIRHVGLSNVTTQEIERAKKILPIVSIQNRYNIEDRDSQEVLSYCEKEKMGFLPWAPVGGSGRSSLTKTGNPLEAEAKRRNVSAVQLALAWLLQKSPVILPIPGTSSLAHLEENMAAAKLQLTPEEWKKIEDSAGKS

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.73
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 11.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10088159 3300013306 Bacteria 3183
2 CNXas_1000047 3300000545 Bacteria 23788
3 Ga0070658_10020351 3300005327 Bacteria 5318
4 Ga0070658_10338860 3300005327 Unclassified 1286
5 Ga0070676_10125809 3300005328 Bacteria 1615
6 Ga0070683_100000705 3300005329 Bacteria 24278
7 Ga0070683_100543385 3300005329 Bacteria 1111
8 Ga0070690_100157392 3300005330 Bacteria 1554
9 Ga0070666_10033186 3300005335 Bacteria 3414
10 Ga0070666_10271987 3300005335 Bacteria 1203
11 Ga0070680_100039839 3300005336 Bacteria 3801
12 Ga0070682_100029503 3300005337 Bacteria 3303
13 Ga0068868_100178458 3300005338 Bacteria 1761
14 Ga0070660_100144131 3300005339 Bacteria 1913
15 Ga0070689_100097130 3300005340 Bacteria 2329
16 Ga0070687_100097945 3300005343 Bacteria 1636
17 Ga0070692_10027683 3300005345 Bacteria 2812
18 Ga0070668_100160191 3300005347 Bacteria 1825
19 Ga0070668_100211336 3300005347 Unclassified 1596
20 Ga0070675_100293528 3300005354 Unclassified 1431
21 Ga0070671_100028260 3300005355 Bacteria 4618
22 Ga0070671_100055981 3300005355 Unclassified 3281
23 Ga0070671_100127920 3300005355 Unclassified 2139
24 Ga0070671_100197112 3300005355 Bacteria 1707
25 Ga0070674_100387170 3300005356 Bacteria 1139
26 Ga0070673_100094156 3300005364 Unclassified 2455
27 Ga0070688_100001889 3300005365 Bacteria 10508
28 Ga0070688_100002037 3300005365 Bacteria 10197
29 Ga0070659_100050013 3300005366 Bacteria 3288
30 Ga0070659_100248920 3300005366 Bacteria 1472
31 Ga0070667_100008695 3300005367 Bacteria 8417
32 Ga0070667_100028202 3300005367 Unclassified 4673
33 Ga0070667_100126937 3300005367 Bacteria 2223
34 Ga0070709_10354217 3300005434 Bacteria 1085
35 Ga0070713_100221794 3300005436 Bacteria 1715
36 Ga0070713_100265679 3300005436 Bacteria 1569
37 Ga0070711_100006730 3300005439 Bacteria 6953
38 Ga0070705_100049870 3300005440 Bacteria 2433
39 Ga0070700_100041822 3300005441 Bacteria 2811
40 Ga0070694_100099921 3300005444 Bacteria 2051
41 Ga0070708_100031571 3300005445 Bacteria 4586
42 Ga0070708_100135662 3300005445 Bacteria 2279
43 Ga0070708_100295670 3300005445 Bacteria 1525
44 Ga0070678_100058344 3300005456 Bacteria 2832
45 Ga0070678_100068465 3300005456 Bacteria 2646
46 Ga0070678_100162769 3300005456 Bacteria 1810
47 Ga0070678_100173635 3300005456 Bacteria 1758
48 Ga0068867_100219629 3300005459 Bacteria 1531
49 Ga0070706_100004713 3300005467 Bacteria 13077
50 Ga0070706_100007576 3300005467 Bacteria 10164
51 Ga0070706_100013856 3300005467 Bacteria 7455
52 Ga0070706_100192855 3300005467 Bacteria 1904
53 Ga0070707_100008928 3300005468 Bacteria 9298
54 Ga0070707_100011787 3300005468 Bacteria 8161
55 Ga0070707_100015274 3300005468 Bacteria 7207
56 Ga0070707_100086504 3300005468 Bacteria 3031
57 Ga0070707_100461788 3300005468 Unclassified 1231
58 Ga0070698_100000323 3300005471 Bacteria 48831
59 Ga0070698_100015764 3300005471 Bacteria 7983
60 Ga0070698_100091058 3300005471 Bacteria 3033
61 Ga0070698_100210957 3300005471 Bacteria 1877
62 Ga0070699_100004886 3300005518 Bacteria 11824
63 Ga0070699_100413352 3300005518 Bacteria 1221
64 Ga0070684_100000520 3300005535 Bacteria 26402
65 Ga0070684_100005454 3300005535 Bacteria 9744
66 Ga0070697_100005744 3300005536 Bacteria 9564
67 Ga0070697_100006407 3300005536 Bacteria 9112
68 Ga0070697_100221501 3300005536 Bacteria 1612
69 Ga0070672_100007468 3300005543 Bacteria 7419
70 Ga0070672_100119859 3300005543 Bacteria 2153
71 Ga0070672_100184933 3300005543 Bacteria 1737
72 Ga0070693_100140173 3300005547 Bacteria 1521
73 Ga0070665_100001493 3300005548 Bacteria 27224
74 Ga0070665_100034756 3300005548 Bacteria 5069
75 Ga0070665_100121276 3300005548 Unclassified 2616
76 Ga0070665_100472962 3300005548 Bacteria 1264
77 Ga0070704_100002081 3300005549 Bacteria 11118
78 Ga0070664_100053046 3300005564 Bacteria 3436
79 Ga0070664_100175033 3300005564 Bacteria 1905
80 Ga0068856_100028253 3300005614 Bacteria 5476
81 Ga0068864_100064445 3300005618 Bacteria 3178
82 Ga0068861_100197500 3300005719 Bacteria 1686
83 Ga0068863_100013955 3300005841 Bacteria 7745
84 Ga0068858_100017702 3300005842 Bacteria 6677
85 Ga0081455_10106908 3300005937 Bacteria 2231
86 Ga0081540_1000152 3300005983 Bacteria 70858
87 Ga0070717_10074726 3300006028 Bacteria 2833
88 Ga0070712_100195022 3300006175 Bacteria 1587
89 Ga0070712_100374646 3300006175 Bacteria 1170
90 Ga0070712_100406119 3300006175 Bacteria 1126
91 Ga0068871_100069185 3300006358 Unclassified 2898
92 Ga0075430_100136046 3300006846 Bacteria 2047
93 Ga0099794_10024584 3300007265 Bacteria 2767
94 Ga0105245_10003548 3300009098 Bacteria 13920
95 Ga0105245_10006460 3300009098 Bacteria 10313
96 Ga0105245_10457165 3300009098 Bacteria 1286
97 Ga0105247_10078376 3300009101 Unclassified 2078
98 Ga0114129_10836335 3300009147 Bacteria 1172
99 Ga0105243_10537235 3300009148 Bacteria 1114
100 Ga0105242_10348145 3300009176 Bacteria 1368
101 Ga0105248_10197979 3300009177 Unclassified 2264
102 Ga0105237_10216265 3300009545 Bacteria 1916
103 Ga0105249_10020278 3300009553 Bacteria 5943
104 Ga0105249_10073600 3300009553 Bacteria 3161
105 Ga0105249_10349520 3300009553 Bacteria 1497
106 Ga0105249_10429757 3300009553 Bacteria 1356
107 Ga0105239_10010783 3300010375 Bacteria 10208
108 Ga0105239_10015237 3300010375 Bacteria 8518
109 Ga0105246_10001084 3300011119 Bacteria 15747
110 Ga0105246_10285815 3300011119 Bacteria 1325
111 Ga0105246_10441421 3300011119 Unclassified 1091
112 Ga0157369_10033198 3300013105 Bacteria 5674
113 Ga0157374_10061030 3300013296 Bacteria 3530
114 Ga0157374_10132013 3300013296 Bacteria 2417
115 Ga0157378_10019253 3300013297 Bacteria 5999
116 Ga0157378_10082745 3300013297 Bacteria 2903
117 Ga0157378_10182266 3300013297 Unclassified 1976
118 Ga0157378_10351807 3300013297 Bacteria 1439
119 Ga0163162_10007664 3300013306 Bacteria 10512
120 Ga0163162_10029927 3300013306 Bacteria 5391
121 Ga0163162_10103695 3300013306 Bacteria 2938
122 Ga0163162_10160980 3300013306 Bacteria 2366
123 Ga0163162_10499170 3300013306 Bacteria 1347
124 Ga0157372_10131666 3300013307 Bacteria 2878
125 Ga0157375_10008707 3300013308 Bacteria 8892
126 Ga0157375_10049336 3300013308 Unclassified 4123
127 Ga0157375_10103919 3300013308 Bacteria 2929
128 Ga0157375_10110916 3300013308 Bacteria 2841
129 Ga0157375_10213338 3300013308 Bacteria 2088
130 Ga0157375_10577523 3300013308 Bacteria 1284
131 Ga0163163_10301886 3300014325 Bacteria 1653
132 Ga0157379_10005670 3300014968 Bacteria 10734
133 Ga0157379_10014451 3300014968 Bacteria 6928
134 Ga0157376_10033602 3300014969 Unclassified 4131
135 Ga0157376_10072398 3300014969 Bacteria 2932
136 Ga0157376_10077487 3300014969 Unclassified 2844
137 Ga0157376_10272593 3300014969 Bacteria 1590
138 Ga0207697_10000209 3300025315 Bacteria 31321
139 Ga0207697_10003364 3300025315 Bacteria 7948
140 Ga0207697_10013653 3300025315 Bacteria 3385
141 Ga0207653_10019380 3300025885 Bacteria 2144
142 Ga0207692_10053191 3300025898 Bacteria 2061
143 Ga0207688_10002947 3300025901 Bacteria 9261
144 Ga0207688_10033209 3300025901 Bacteria 2853
145 Ga0207688_10054378 3300025901 Bacteria 2246
146 Ga0207688_10068007 3300025901 Bacteria 2016
147 Ga0207680_10106030 3300025903 Unclassified 1814
148 Ga0207647_10003300 3300025904 Bacteria 12122
149 Ga0207647_10037454 3300025904 Bacteria 3075
150 Ga0207647_10079433 3300025904 Bacteria 1969
151 Ga0207699_10033762 3300025906 Bacteria 2895
152 Ga0207645_10002845 3300025907 Bacteria 13417
153 Ga0207645_10011723 3300025907 Bacteria 5975
154 Ga0207684_10000276 3300025910 Bacteria 75551
155 Ga0207684_10005743 3300025910 Bacteria 11392
156 Ga0207684_10017305 3300025910 Bacteria 6183
157 Ga0207684_10040249 3300025910 Bacteria 3963
158 Ga0207684_10101177 3300025910 Bacteria 2463
159 Ga0207684_10112547 3300025910 Bacteria 2330
160 Ga0207684_10135287 3300025910 Bacteria 2116
161 Ga0207671_10125984 3300025914 Bacteria 1962
162 Ga0207693_10008841 3300025915 Bacteria 8227
163 Ga0207663_10023450 3300025916 Bacteria 3541
164 Ga0207660_10039984 3300025917 Bacteria 3281
165 Ga0207662_10038304 3300025918 Bacteria 2809
166 Ga0207662_10115559 3300025918 Bacteria 1677
167 Ga0207657_10126357 3300025919 Bacteria 2100
168 Ga0207652_10014910 3300025921 Bacteria 6302
169 Ga0207646_10000364 3300025922 Bacteria 60964
170 Ga0207646_10010173 3300025922 Bacteria 9215
171 Ga0207646_10048564 3300025922 Bacteria 3804
172 Ga0207646_10383875 3300025922 Bacteria 1269
173 Ga0207681_10006617 3300025923 Bacteria 7115
174 Ga0207681_10053793 3300025923 Bacteria 2734
175 Ga0207650_10011676 3300025925 Bacteria 6051
176 Ga0207650_10020576 3300025925 Bacteria 4655
177 Ga0207659_10047554 3300025926 Bacteria 3035
178 Ga0207659_10108692 3300025926 Unclassified 2104
179 Ga0207687_10008242 3300025927 Bacteria 6817
180 Ga0207687_10198882 3300025927 Bacteria 1565
181 Ga0207687_10210730 3300025927 Bacteria 1524
182 Ga0207664_10265027 3300025929 Bacteria 1503
183 Ga0207644_10005337 3300025931 Bacteria 8386
184 Ga0207644_10023127 3300025931 Bacteria 4253
185 Ga0207644_10066639 3300025931 Bacteria 2622
186 Ga0207644_10071720 3300025931 Bacteria 2535
187 Ga0207644_10163572 3300025931 Unclassified 1732
188 Ga0207690_10009832 3300025932 Bacteria 5681
189 Ga0207706_10115586 3300025933 Bacteria 2360
190 Ga0207706_10159746 3300025933 Bacteria 1981
191 Ga0207704_10027157 3300025938 Unclassified 3153
192 Ga0207665_10041585 3300025939 Bacteria 3071
193 Ga0207665_10068424 3300025939 Bacteria 2420
194 Ga0207665_10185703 3300025939 Bacteria 1508
195 Ga0207691_10001964 3300025940 Bacteria 20104
196 Ga0207691_10006701 3300025940 Bacteria 11110
197 Ga0207691_10041574 3300025940 Bacteria 4243
198 Ga0207661_10017002 3300025944 Bacteria 5372
199 Ga0207661_10437587 3300025944 Bacteria 1190
200 Ga0207679_10049438 3300025945 Bacteria 3068
201 Ga0207667_10397310 3300025949 Bacteria 1404
202 Ga0207651_10239128 3300025960 Unclassified 1479
203 Ga0207712_10142784 3300025961 Bacteria 1840
204 Ga0207712_10282116 3300025961 Bacteria 1356
205 Ga0207668_10041534 3300025972 Bacteria 3110
206 Ga0207668_10068484 3300025972 Bacteria 2524
207 Ga0207677_10223019 3300026023 Bacteria 1513
208 Ga0207677_10289048 3300026023 Unclassified 1349
209 Ga0207708_10048856 3300026075 Bacteria 3221
210 Ga0207702_10492545 3300026078 Bacteria 1194
211 Ga0207641_10683054 3300026088 Bacteria 1010
212 Ga0207648_10014296 3300026089 Bacteria 7336
213 Ga0207648_10223079 3300026089 Bacteria 1675
214 Ga0207676_10048409 3300026095 Bacteria 3300
215 Ga0207674_10002877 3300026116 Bacteria 21385
216 Ga0207675_100259704 3300026118 Bacteria 1683
217 Ga0207683_10021861 3300026121 Bacteria 5486
218 Ga0207683_10031696 3300026121 Unclassified 4588
219 Ga0207683_10038139 3300026121 Bacteria 4186
220 Ga0207683_10047381 3300026121 Bacteria 3764
221 Ga0207683_10157350 3300026121 Bacteria 2053
222 Ga0268266_10004461 3300028379 Bacteria 13384
223 Ga0268266_10097969 3300028379 Unclassified 2579
224 Ga0268266_10330111 3300028379 Bacteria 1429
225 Ga0268264_10022132 3300028381 Bacteria 5188
226 Ga0307513_10233228 3300031456 Bacteria 1651
227 Ga0373926_0086555 3300035083 Bacteria 1163
228 Ga0373944_0120181 3300035089 Bacteria 905
229 Ga0373945_0084986 3300035116 Bacteria 1218
230 Ga0373945_0092885 3300035116 Bacteria 1171
231 Ga0373945_0113968 3300035116 Bacteria 1069
232 Ga0373943_0020069 3300035170 Bacteria 3078
233 Ga0373946_0066898 3300035171 Bacteria 1542
234 Ga0373946_0116401 3300035171 Bacteria 1216
235 Ga0373935_0099099 3300035692 Bacteria 1919
236 Ga0373935_0132731 3300035692 Bacteria 1675
237 Ga0373927_0075948 3300035695 Bacteria 2176
238 Ga0373927_0164893 3300035695 Bacteria 1452
239 Ga0373927_0210002 3300035695 Unclassified 1279
240 Ga0373925_0042250 3300037068 Bacteria 3382
241 Ga0373925_0243491 3300037068 Unclassified 1441
242 Ga0395900_0015282 3300037418 Bacteria 7827
243 Ga0395900_0017412 3300037418 Bacteria 7334
244 Ga0395898_0024313 3300037466 Bacteria 6110
245 Ga0395898_0124470 3300037466 Bacteria 2470
246 Ga0395901_0006855 3300038443 Bacteria 11506
247 Ga0395901_0011662 3300038443 Bacteria 8902
248 Ga0439455_0010258 3300042012 Bacteria 2057
249 Ga0439464_0069746 3300042439 Bacteria 1039
250 Ga0466963_0098692 3300044694 Bacteria 1997
251 Ga0466967_0034591 3300045976 Bacteria 4291
252 Ga0466967_0142442 3300045976 Bacteria 2234
253 Ga0466967_0180373 3300045976 Bacteria 1991
254 Ga0466967_0303056 3300045976 Bacteria 1538
255 Ga0495669_0069645 3300046684 Bacteria 1601
256 Ga0496100_0064306 3300048903 Unclassified 2427
257 Ga0496100_0431271 3300048903 Bacteria 1008
258 Ga0496101_0005384 3300048904 Bacteria 8154
259 Ga0496101_0137527 3300048904 Bacteria 1860
260 Ga0496101_0388007 3300048904 Bacteria 1099
261 Ga0496102_0008013 3300048905 Bacteria 9031
262 Ga0496102_0122994 3300048905 Bacteria 2424
263 Ga0496102_0166060 3300048905 Bacteria 2077
264 Ga0496103_0062123 3300048906 Bacteria 2325
265 Ga0496104_0123150 3300048907 Bacteria 2489
266 Ga0496104_0330205 3300048907 Unclassified 1438
267 Ga0496105_0076378 3300048908 Bacteria 2766
268 Ga0496106_0015552 3300048909 Bacteria 5628
269 Ga0496106_0065245 3300048909 Unclassified 2772
270 Ga0496106_0207153 3300048909 Unclassified 1561
271 Ga0496106_0597012 3300048909 Bacteria 884
272 Ga0496107_0004255 3300048910 Bacteria 9680
273 Ga0496107_0163220 3300048910 Bacteria 1652
274 Ga0496107_0502278 3300048910 Bacteria 900
275 Ga0496108_0123231 3300048911 Unclassified 2224
276 Ga0496108_0141499 3300048911 Bacteria 2073
277 Ga0496108_0361604 3300048911 Bacteria 1267
278 Ga0496109_0020350 3300048912 Bacteria 5861
279 Ga0496109_0097513 3300048912 Unclassified 2725
280 Ga0496109_0408759 3300048912 Bacteria 1282
281 Ga0496110_0118301 3300048913 Bacteria 2386
282 Ga0496111_0044140 3300048914 Bacteria 3204
283 Ga0496112_0111368 3300048915 Unclassified 2707
284 Ga0496114_0006692 3300048917 Bacteria 9077
285 Ga0496114_0134089 3300048917 Bacteria 2140
286 Ga0496115_0023784 3300048918 Bacteria 4757
287 Ga0496115_0049639 3300048918 Bacteria 3359
288 Ga0496115_0078666 3300048918 Bacteria 2683
289 Ga0496115_0098482 3300048918 Unclassified 2395
290 Ga0501034_0026415 3300049571 Bacteria 5913
291 Ga0501034_0583682 3300049571 Bacteria 1024
292 Ga0501036_0223176 3300049572 Bacteria 1582
293 Ga0501038_0169859 3300049574 Bacteria 1766
294 Ga0501039_0203846 3300049575 Bacteria 1555
295 Ga0501046_0019566 3300049580 Bacteria 5613
296 Ga0501047_0395653 3300049581 Bacteria 1215
297 Ga0501048_0007769 3300049582 Bacteria 8132
298 Ga0501067_0000532 3300049583 Bacteria 20747
299 Ga0501068_0007464 3300049584 Bacteria 6053
300 Ga0501070_0013879 3300049586 Bacteria 6784
301 Ga0501070_0342055 3300049586 Bacteria 1215
302 Ga0501071_0011957 3300049587 Bacteria 5864
303 Ga0501072_0022772 3300049588 Bacteria 4862
304 Ga0501073_0020593 3300049589 Bacteria 4756
305 Ga0501074_0021524 3300049590 Bacteria 4681
306 Ga0501076_0355151 3300049592 Bacteria 1204
307 Ga0501077_0020706 3300049593 Bacteria 4164
308 Ga0501079_0013759 3300049741 Bacteria 6170
309 Ga0501080_0010887 3300049742 Bacteria 8323
310 Ga0501080_0014957 3300049742 Bacteria 7144
311 Ga0501080_0056529 3300049742 Bacteria 3654
312 Ga0501083_0014861 3300049744 Bacteria 5443
313 Ga0501083_0027513 3300049744 Bacteria 3924
314 nmdc:mga09592_8847_c1 3300050508 Bacteria 8190
315 Ga0501084_0002512 3300054114 Bacteria 14766
316 Ga0501084_0085369 3300054114 Bacteria 2650
317 Ga0501082_0012069 3300060353 Bacteria 7425
318 Ga0163162_10088159
319 CNXas_1000047
320 Ga0070658_10020351
321 Ga0070658_10338860
322 Ga0070676_10125809
323 Ga0070683_100000705
324 Ga0070683_100543385
325 Ga0070690_100157392
326 Ga0070666_10033186
327 Ga0070666_10271987
328 Ga0070680_100039839
329 Ga0070682_100029503
330 Ga0068868_100178458
331 Ga0070660_100144131
332 Ga0070689_100097130
333 Ga0070687_100097945
334 Ga0070692_10027683
335 Ga0070668_100160191
336 Ga0070668_100211336
337 Ga0070675_100293528
338 Ga0070671_100028260
339 Ga0070671_100055981
340 Ga0070671_100127920
341 Ga0070671_100197112
342 Ga0070674_100387170
343 Ga0070673_100094156
344 Ga0070688_100001889
345 Ga0070688_100002037
346 Ga0070659_100050013
347 Ga0070659_100248920
348 Ga0070667_100008695
349 Ga0070667_100028202
350 Ga0070667_100126937
351 Ga0070709_10354217
352 Ga0070713_100221794
353 Ga0070713_100265679
354 Ga0070711_100006730
355 Ga0070705_100049870
356 Ga0070700_100041822
357 Ga0070694_100099921
358 Ga0070708_100031571
359 Ga0070708_100135662
360 Ga0070708_100295670
361 Ga0070678_100058344
362 Ga0070678_100068465
363 Ga0070678_100162769
364 Ga0070678_100173635
365 Ga0068867_100219629
366 Ga0070706_100004713
367 Ga0070706_100007576
368 Ga0070706_100013856
369 Ga0070706_100192855
370 Ga0070707_100008928
371 Ga0070707_100011787
372 Ga0070707_100015274
373 Ga0070707_100086504
374 Ga0070707_100461788
375 Ga0070698_100000323
376 Ga0070698_100015764
377 Ga0070698_100091058
378 Ga0070698_100210957
379 Ga0070699_100004886
380 Ga0070699_100413352
381 Ga0070684_100000520
382 Ga0070684_100005454
383 Ga0070697_100005744
384 Ga0070697_100006407
385 Ga0070697_100221501
386 Ga0070672_100007468
387 Ga0070672_100119859
388 Ga0070672_100184933
389 Ga0070693_100140173
390 Ga0070665_100001493
391 Ga0070665_100034756
392 Ga0070665_100121276
393 Ga0070665_100472962
394 Ga0070704_100002081
395 Ga0070664_100053046
396 Ga0070664_100175033
397 Ga0068856_100028253
398 Ga0068864_100064445
399 Ga0068861_100197500
400 Ga0068863_100013955
401 Ga0068858_100017702
402 Ga0081455_10106908
403 Ga0081540_1000152
404 Ga0070717_10074726
405 Ga0070712_100195022
406 Ga0070712_100374646
407 Ga0070712_100406119
408 Ga0068871_100069185
409 Ga0075430_100136046
410 Ga0099794_10024584
411 Ga0105245_10003548
412 Ga0105245_10006460
413 Ga0105245_10457165
414 Ga0105247_10078376
415 Ga0114129_10836335
416 Ga0105243_10537235
417 Ga0105242_10348145
418 Ga0105248_10197979
419 Ga0105237_10216265
420 Ga0105249_10020278
421 Ga0105249_10073600
422 Ga0105249_10349520
423 Ga0105249_10429757
424 Ga0105239_10010783
425 Ga0105239_10015237
426 Ga0105246_10001084
427 Ga0105246_10285815
428 Ga0105246_10441421
429 Ga0157369_10033198
430 Ga0157374_10061030
431 Ga0157374_10132013
432 Ga0157378_10019253
433 Ga0157378_10082745
434 Ga0157378_10182266
435 Ga0157378_10351807
436 Ga0163162_10007664
437 Ga0163162_10029927
438 Ga0163162_10103695
439 Ga0163162_10160980
440 Ga0163162_10499170
441 Ga0157372_10131666
442 Ga0157375_10008707
443 Ga0157375_10049336
444 Ga0157375_10103919
445 Ga0157375_10110916
446 Ga0157375_10213338
447 Ga0157375_10577523
448 Ga0163163_10301886
449 Ga0157379_10005670
450 Ga0157379_10014451
451 Ga0157376_10033602
452 Ga0157376_10072398
453 Ga0157376_10077487
454 Ga0157376_10272593
455 Ga0207697_10000209
456 Ga0207697_10003364
457 Ga0207697_10013653
458 Ga0207653_10019380
459 Ga0207692_10053191
460 Ga0207688_10002947
461 Ga0207688_10033209
462 Ga0207688_10054378
463 Ga0207688_10068007
464 Ga0207680_10106030
465 Ga0207647_10003300
466 Ga0207647_10037454
467 Ga0207647_10079433
468 Ga0207699_10033762
469 Ga0207645_10002845
470 Ga0207645_10011723
471 Ga0207684_10000276
472 Ga0207684_10005743
473 Ga0207684_10017305
474 Ga0207684_10040249
475 Ga0207684_10101177
476 Ga0207684_10112547
477 Ga0207684_10135287
478 Ga0207671_10125984
479 Ga0207693_10008841
480 Ga0207663_10023450
481 Ga0207660_10039984
482 Ga0207662_10038304
483 Ga0207662_10115559
484 Ga0207657_10126357
485 Ga0207652_10014910
486 Ga0207646_10000364
487 Ga0207646_10010173
488 Ga0207646_10048564
489 Ga0207646_10383875
490 Ga0207681_10006617
491 Ga0207681_10053793
492 Ga0207650_10011676
493 Ga0207650_10020576
494 Ga0207659_10047554
495 Ga0207659_10108692
496 Ga0207687_10008242
497 Ga0207687_10198882
498 Ga0207687_10210730
499 Ga0207664_10265027
500 Ga0207644_10005337
501 Ga0207644_10023127
502 Ga0207644_10066639
503 Ga0207644_10071720
504 Ga0207644_10163572
505 Ga0207690_10009832
506 Ga0207706_10115586
507 Ga0207706_10159746
508 Ga0207704_10027157
509 Ga0207665_10041585
510 Ga0207665_10068424
511 Ga0207665_10185703
512 Ga0207691_10001964
513 Ga0207691_10006701
514 Ga0207691_10041574
515 Ga0207661_10017002
516 Ga0207661_10437587
517 Ga0207679_10049438
518 Ga0207667_10397310
519 Ga0207651_10239128
520 Ga0207712_10142784
521 Ga0207712_10282116
522 Ga0207668_10041534
523 Ga0207668_10068484
524 Ga0207677_10223019
525 Ga0207677_10289048
526 Ga0207708_10048856
527 Ga0207702_10492545
528 Ga0207641_10683054
529 Ga0207648_10014296
530 Ga0207648_10223079
531 Ga0207676_10048409
532 Ga0207674_10002877
533 Ga0207675_100259704
534 Ga0207683_10021861
535 Ga0207683_10031696
536 Ga0207683_10038139
537 Ga0207683_10047381
538 Ga0207683_10157350
539 Ga0268266_10004461
540 Ga0268266_10097969
541 Ga0268266_10330111
542 Ga0268264_10022132
543 Ga0307513_10233228
544 Ga0373926_0086555
545 Ga0373944_0120181
546 Ga0373945_0084986
547 Ga0373945_0092885
548 Ga0373945_0113968
549 Ga0373943_0020069
550 Ga0373946_0066898
551 Ga0373946_0116401
552 Ga0373935_0099099
553 Ga0373935_0132731
554 Ga0373927_0075948
555 Ga0373927_0164893
556 Ga0373927_0210002
557 Ga0373925_0042250
558 Ga0373925_0243491
559 Ga0395900_0015282
560 Ga0395900_0017412
561 Ga0395898_0024313
562 Ga0395898_0124470
563 Ga0395901_0006855
564 Ga0395901_0011662
565 Ga0439455_0010258
566 Ga0439464_0069746
567 Ga0466963_0098692
568 Ga0466967_0034591
569 Ga0466967_0142442
570 Ga0466967_0180373
571 Ga0466967_0303056
572 Ga0495669_0069645
573 Ga0496100_0064306
574 Ga0496100_0431271
575 Ga0496101_0005384
576 Ga0496101_0137527
577 Ga0496101_0388007
578 Ga0496102_0008013
579 Ga0496102_0122994
580 Ga0496102_0166060
581 Ga0496103_0062123
582 Ga0496104_0123150
583 Ga0496104_0330205
584 Ga0496105_0076378
585 Ga0496106_0015552
586 Ga0496106_0065245
587 Ga0496106_0207153
588 Ga0496106_0597012
589 Ga0496107_0004255
590 Ga0496107_0163220
591 Ga0496107_0502278
592 Ga0496108_0123231
593 Ga0496108_0141499
594 Ga0496108_0361604
595 Ga0496109_0020350
596 Ga0496109_0097513
597 Ga0496109_0408759
598 Ga0496110_0118301
599 Ga0496111_0044140
600 Ga0496112_0111368
601 Ga0496114_0006692
602 Ga0496114_0134089
603 Ga0496115_0023784
604 Ga0496115_0049639
605 Ga0496115_0078666
606 Ga0496115_0098482
607 Ga0501034_0026415
608 Ga0501034_0583682
609 Ga0501036_0223176
610 Ga0501038_0169859
611 Ga0501039_0203846
612 Ga0501046_0019566
613 Ga0501047_0395653
614 Ga0501048_0007769
615 Ga0501067_0000532
616 Ga0501068_0007464
617 Ga0501070_0013879
618 Ga0501070_0342055
619 Ga0501071_0011957
620 Ga0501072_0022772
621 Ga0501073_0020593
622 Ga0501074_0021524
623 Ga0501076_0355151
624 Ga0501077_0020706
625 Ga0501079_0013759
626 Ga0501080_0010887
627 Ga0501080_0014957
628 Ga0501080_0056529
629 Ga0501083_0014861
630 Ga0501083_0027513
631 nmdc:mga09592_8847_c1
632 Ga0501084_0002512
633 Ga0501084_0085369
634 Ga0501082_0012069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

79

346

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9482 32 311
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9092 32 311
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9076 44 314
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9063 44 313
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9036 37 313
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9778 42 317 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9229 43 239 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9211 42 317 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9156 46 316 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9114 37 317 3.20.20.100
ID Description Score Start End GO Terms
AF-K0W5M5-F1-model_v4 Aldo/keto reductase 0.9798 32 228 GO:0004033
GO:0005737
AF-A0A5P9QCX1-F1-model_v4 Pyridoxine 4-dehydrogenase (EC 1.1.1.65) 0.9739 32 315 GO:0005737
GO:0050236
AF-A0A0K3BC70-F1-model_v4 L-fuco-beta-pyranose dehydrogenase (EC 1.1.1.122) 0.9726 32 314 GO:0004033
GO:0005737
GO:0047834
AF-A0A8A3LYI6-F1-model_v4 deleted 0.9724 32 317
AF-A0A2S8BC76-F1-model_v4 L-glyceraldehyde 3-phosphate reductase (EC 1.1.1.-) 0.9721 73 317 GO:0004033
GO:0005737

Map