F404144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 226 | 308 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_11042406|Ga0105239_110424062 |
| Length | 246 |
| Sequence | VGGCNVGAERFSLTSCNIKPACEDSTCCSFDQAETSMGKVRVAGFGVSIDGYGAGAEQSLEHPLRKGGKELHNWFYPTRTFRSMIGKDGGVDDRFARTASEGFGAFILGRNMFGPIRGEWPDESWKGWWGDNPPYHAPTFILTHNARAPIVMEGGTTFHFVTDGIEAALAQARAAAGDLDVKIGGGVSTVRQYLLARAIDELHLALSPVFLGHGESLFAGIDLPGLGYRVTEAVPTELATHLVLTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 2 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 3 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 4 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 5 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 6 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 7 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 8 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 9 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 67 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 122 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 123 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 124 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 125 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 126 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 127 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 128 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 129 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 130 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 131 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 223 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 224 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 225 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.27 |
| Metatranscriptomes | 1.89 |
| Isolates | 2.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.26 |
| Nodule | 1.26 |
| Rhizoplane | 8.2 |
| Rhizosphere | 80.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100691558 | 3300005331 | Bacteria | 917 |
| 2 | Ga0070680_100014676 | 3300005336 | Bacteria | 6126 |
| 3 | Ga0068868_100127284 | 3300005338 | Bacteria | 2082 |
| 4 | Ga0070661_100232235 | 3300005344 | Bacteria | 1418 |
| 5 | Ga0070671_100948516 | 3300005355 | Bacteria | 753 |
| 6 | Ga0070714_100007408 | 3300005435 | Bacteria | 8539 |
| 7 | Ga0070713_100065490 | 3300005436 | Bacteria | 3052 |
| 8 | Ga0070713_100313642 | 3300005436 | Bacteria | 1447 |
| 9 | Ga0070713_100343662 | 3300005436 | Bacteria | 1383 |
| 10 | Ga0070710_10399694 | 3300005437 | Bacteria | 921 |
| 11 | Ga0070705_100085570 | 3300005440 | Bacteria | 1949 |
| 12 | Ga0070708_100246218 | 3300005445 | Bacteria | 1679 |
| 13 | Ga0070663_100354004 | 3300005455 | Bacteria | 1189 |
| 14 | Ga0070681_10022680 | 3300005458 | Bacteria | 6307 |
| 15 | Ga0070681_10233519 | 3300005458 | Bacteria | 1753 |
| 16 | Ga0070706_100320935 | 3300005467 | Bacteria | 1444 |
| 17 | Ga0070707_100007568 | 3300005468 | Bacteria | 10085 |
| 18 | Ga0070707_100633006 | 3300005468 | Bacteria | 1032 |
| 19 | Ga0070699_100102317 | 3300005518 | Bacteria | 2512 |
| 20 | Ga0070679_100132649 | 3300005530 | Bacteria | 2472 |
| 21 | Ga0070679_100382248 | 3300005530 | Bacteria | 1355 |
| 22 | Ga0070684_100039454 | 3300005535 | Bacteria | 4061 |
| 23 | Ga0070697_100194190 | 3300005536 | Bacteria | 1724 |
| 24 | Ga0068853_100005841 | 3300005539 | Bacteria | 9693 |
| 25 | Ga0070686_100126985 | 3300005544 | Bacteria | 1759 |
| 26 | Ga0070695_100208038 | 3300005545 | Bacteria | 1402 |
| 27 | Ga0068855_100063026 | 3300005563 | Bacteria | 4327 |
| 28 | Ga0068855_100108954 | 3300005563 | Bacteria | 3181 |
| 29 | Ga0068854_100028297 | 3300005578 | Bacteria | 3871 |
| 30 | Ga0068854_100204514 | 3300005578 | Bacteria | 1554 |
| 31 | Ga0068854_100479966 | 3300005578 | Bacteria | 1044 |
| 32 | Ga0068856_100038601 | 3300005614 | Bacteria | 4688 |
| 33 | Ga0068861_100000375 | 3300005719 | Bacteria | 25742 |
| 34 | Ga0068858_100000092 | 3300005842 | Bacteria | 93550 |
| 35 | Ga0068858_100373347 | 3300005842 | Bacteria | 1368 |
| 36 | Ga0070717_10026242 | 3300006028 | Bacteria | 4646 |
| 37 | Ga0070717_10074535 | 3300006028 | Bacteria | 2837 |
| 38 | Ga0070717_10095322 | 3300006028 | Bacteria | 2519 |
| 39 | Ga0070717_10172218 | 3300006028 | Bacteria | 1883 |
| 40 | Ga0070716_100726012 | 3300006173 | Bacteria | 762 |
| 41 | Ga0070712_100094297 | 3300006175 | Bacteria | 2199 |
| 42 | Ga0075431_100001598 | 3300006847 | Bacteria | 21116 |
| 43 | Ga0075433_10841565 | 3300006852 | Bacteria | 801 |
| 44 | Ga0075434_100008352 | 3300006871 | Bacteria | 9623 |
| 45 | Ga0075436_100020333 | 3300006914 | Bacteria | 4557 |
| 46 | Ga0075435_100004144 | 3300007076 | Bacteria | 9936 |
| 47 | Ga0105240_10022811 | 3300009093 | Bacteria | 8293 |
| 48 | Ga0105240_10057758 | 3300009093 | Bacteria | 4845 |
| 49 | Ga0105240_10124766 | 3300009093 | Bacteria | 3096 |
| 50 | Ga0105240_10695827 | 3300009093 | Bacteria | 1110 |
| 51 | Ga0111539_10252587 | 3300009094 | Bacteria | 2053 |
| 52 | Ga0105245_10209351 | 3300009098 | Bacteria | 1876 |
| 53 | Ga0105245_10571218 | 3300009098 | Bacteria | 1154 |
| 54 | Ga0105241_10015359 | 3300009174 | Bacteria | 5608 |
| 55 | Ga0105248_10025939 | 3300009177 | Bacteria | 6518 |
| 56 | Ga0105237_10208662 | 3300009545 | Bacteria | 1954 |
| 57 | Ga0105237_10316768 | 3300009545 | Bacteria | 1563 |
| 58 | Ga0105237_10326261 | 3300009545 | Bacteria | 1539 |
| 59 | Ga0105238_10026170 | 3300009551 | Bacteria | 5945 |
| 60 | Ga0105238_10066442 | 3300009551 | Bacteria | 3608 |
| 61 | Ga0105238_10083356 | 3300009551 | Bacteria | 3186 |
| 62 | Ga0105238_10233817 | 3300009551 | Bacteria | 1815 |
| 63 | Ga0099796_10062968 | 3300010159 | Bacteria | 1320 |
| 64 | Ga0105239_10011216 | 3300010375 | Bacteria | 10001 |
| 65 | Ga0105239_11042406 | 3300010375 | Bacteria | 941 |
| 66 | Ga0157370_10187652 | 3300013104 | Bacteria | 1919 |
| 67 | Ga0157369_10021543 | 3300013105 | Bacteria | 7209 |
| 68 | Ga0157369_10023673 | 3300013105 | Bacteria | 6840 |
| 69 | Ga0157369_10028297 | 3300013105 | Bacteria | 6205 |
| 70 | Ga0157369_10349747 | 3300013105 | Bacteria | 1535 |
| 71 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 72 | Ga0157374_10418564 | 3300013296 | Bacteria | 1338 |
| 73 | Ga0157372_10012081 | 3300013307 | Bacteria | 9199 |
| 74 | Ga0157372_10086827 | 3300013307 | Bacteria | 3549 |
| 75 | Ga0157372_10115264 | 3300013307 | Bacteria | 3081 |
| 76 | Ga0163163_10253303 | 3300014325 | Bacteria | 1811 |
| 77 | Ga0157379_10051262 | 3300014968 | Bacteria | 3686 |
| 78 | Ga0163161_10091702 | 3300017792 | Bacteria | 2249 |
| 79 | Ga0163161_10822458 | 3300017792 | Bacteria | 782 |
| 80 | Ga0206356_11221166 | 3300020070 | Bacteria | 1220 |
| 81 | Ga0206352_10166636 | 3300020078 | Bacteria | 1021 |
| 82 | Ga0206354_11078640 | 3300020081 | Bacteria | 924 |
| 83 | Ga0213873_10004958 | 3300021358 | Bacteria | 2519 |
| 84 | Ga0213872_10193397 | 3300021361 | Bacteria | 875 |
| 85 | Ga0213875_10034770 | 3300021388 | Bacteria | 2379 |
| 86 | Ga0213871_10125922 | 3300021441 | Bacteria | 766 |
| 87 | Ga0224712_10007156 | 3300022467 | Bacteria | 3230 |
| 88 | Ga0207699_10357734 | 3300025906 | Bacteria | 1032 |
| 89 | Ga0207699_10399857 | 3300025906 | Bacteria | 978 |
| 90 | Ga0207684_10253501 | 3300025910 | Bacteria | 1518 |
| 91 | Ga0207654_10017149 | 3300025911 | Bacteria | 3782 |
| 92 | Ga0207707_10005763 | 3300025912 | Bacteria | 10830 |
| 93 | Ga0207707_10100098 | 3300025912 | Bacteria | 2533 |
| 94 | Ga0207695_10001998 | 3300025913 | Bacteria | 31500 |
| 95 | Ga0207695_10009334 | 3300025913 | Bacteria | 12136 |
| 96 | Ga0207671_10067018 | 3300025914 | Bacteria | 2673 |
| 97 | Ga0207671_10305089 | 3300025914 | Bacteria | 1258 |
| 98 | Ga0207693_10084925 | 3300025915 | Bacteria | 2480 |
| 99 | Ga0207660_10278290 | 3300025917 | Bacteria | 1327 |
| 100 | Ga0207652_10219512 | 3300025921 | Bacteria | 1713 |
| 101 | Ga0207652_10238910 | 3300025921 | Bacteria | 1637 |
| 102 | Ga0207646_10004860 | 3300025922 | Bacteria | 14396 |
| 103 | Ga0207694_10000157 | 3300025924 | Bacteria | 70076 |
| 104 | Ga0207694_10068151 | 3300025924 | Bacteria | 2778 |
| 105 | Ga0207694_10068700 | 3300025924 | Bacteria | 2767 |
| 106 | Ga0207700_10301575 | 3300025928 | Bacteria | 1384 |
| 107 | Ga0207664_10000737 | 3300025929 | Bacteria | 22232 |
| 108 | Ga0207664_10086649 | 3300025929 | Bacteria | 2559 |
| 109 | Ga0207690_10164060 | 3300025932 | Bacteria | 1659 |
| 110 | Ga0207706_10064402 | 3300025933 | Bacteria | 3227 |
| 111 | Ga0207670_10227893 | 3300025936 | Bacteria | 1430 |
| 112 | Ga0207665_10490477 | 3300025939 | Bacteria | 948 |
| 113 | Ga0207665_10753503 | 3300025939 | Bacteria | 768 |
| 114 | Ga0207711_10059553 | 3300025941 | Bacteria | 3288 |
| 115 | Ga0207679_10037399 | 3300025945 | Bacteria | 3450 |
| 116 | Ga0207667_10009414 | 3300025949 | Bacteria | 11508 |
| 117 | Ga0207667_10011520 | 3300025949 | Bacteria | 10275 |
| 118 | Ga0207667_10442617 | 3300025949 | Bacteria | 1321 |
| 119 | Ga0207677_10557320 | 3300026023 | Bacteria | 1000 |
| 120 | Ga0207703_10000737 | 3300026035 | Bacteria | 32201 |
| 121 | Ga0207703_10350638 | 3300026035 | Bacteria | 1359 |
| 122 | Ga0207703_11389087 | 3300026035 | Bacteria | 675 |
| 123 | Ga0207639_10014940 | 3300026041 | Bacteria | 5470 |
| 124 | Ga0207678_10311829 | 3300026067 | Bacteria | 1353 |
| 125 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 126 | Ga0207702_10057323 | 3300026078 | Bacteria | 3311 |
| 127 | Ga0207702_10573827 | 3300026078 | Bacteria | 1105 |
| 128 | Ga0207675_100000019 | 3300026118 | Bacteria | 122642 |
| 129 | Ga0207698_10063363 | 3300026142 | Bacteria | 2893 |
| 130 | Ga0207698_10109072 | 3300026142 | Bacteria | 2315 |
| 131 | Ga0207698_10110392 | 3300026142 | Bacteria | 2304 |
| 132 | Ga0207698_10520727 | 3300026142 | Bacteria | 1160 |
| 133 | Ga0307517_10039490 | 3300028786 | Bacteria | 5181 |
| 134 | Ga0265338_10161650 | 3300028800 | Bacteria | 1729 |
| 135 | Ga0307511_10031383 | 3300030521 | Bacteria | 4748 |
| 136 | Ga0265765_1018296 | 3300030879 | Bacteria | 832 |
| 137 | Ga0265760_10076245 | 3300031090 | Bacteria | 1034 |
| 138 | Ga0265328_10145845 | 3300031239 | Bacteria | 889 |
| 139 | Ga0265339_10004753 | 3300031249 | Bacteria | 9207 |
| 140 | Ga0265339_10067416 | 3300031249 | Bacteria | 1914 |
| 141 | Ga0265327_10016605 | 3300031251 | Bacteria | 4664 |
| 142 | Ga0307408_101087086 | 3300031548 | Bacteria | 741 |
| 143 | Ga0307508_10011619 | 3300031616 | Bacteria | 8047 |
| 144 | Ga0265314_10008536 | 3300031711 | Bacteria | 8758 |
| 145 | Ga0265314_10128014 | 3300031711 | Bacteria | 1588 |
| 146 | Ga0307409_100307394 | 3300031995 | Bacteria | 1478 |
| 147 | Ga0373934_0064343 | 3300035086 | Bacteria | 1464 |
| 148 | Ga0373923_0064313 | 3300035111 | Bacteria | 1564 |
| 149 | Ga0373954_0081906 | 3300035118 | Bacteria | 1542 |
| 150 | Ga0373955_0106772 | 3300035172 | Bacteria | 1614 |
| 151 | Ga0373924_0235629 | 3300035410 | Bacteria | 809 |
| 152 | Ga0373935_0205977 | 3300035692 | Bacteria | 1361 |
| 153 | Ga0373933_0204374 | 3300035724 | Bacteria | 1264 |
| 154 | Ga0373947_0535819 | 3300035725 | Bacteria | 797 |
| 155 | Ga0373925_0196568 | 3300037068 | Bacteria | 1602 |
| 156 | Ga0395899_0072708 | 3300037312 | Bacteria | 2516 |
| 157 | Ga0436364_1400663 | 3300037853 | Bacteria | 3285 |
| 158 | Ga0395901_0073703 | 3300038443 | Bacteria | 3561 |
| 159 | Ga0395901_0788373 | 3300038443 | Bacteria | 940 |
| 160 | Ga0436365_0670285 | 3300039437 | Bacteria | 836 |
| 161 | Ga0436365_1063831 | 3300039437 | Bacteria | 1881 |
| 162 | Ga0436360_0084123 | 3300039438 | Bacteria | 1018 |
| 163 | Ga0436363_0083618 | 3300039450 | Bacteria | 929 |
| 164 | Ga0451835_1085803 | 3300041492 | Bacteria | 3315 |
| 165 | Ga0451839_0090435 | 3300041496 | Bacteria | 968 |
| 166 | Ga0451849_0079886 | 3300041505 | Bacteria | 2637 |
| 167 | Ga0451843_0616296 | 3300041509 | Bacteria | 1264 |
| 168 | Ga0451855_1598589 | 3300041511 | Bacteria | 1807 |
| 169 | Ga0466965_0025688 | 3300044683 | Bacteria | 2852 |
| 170 | Ga0466968_0018501 | 3300044735 | Bacteria | 2795 |
| 171 | Ga0466968_0080652 | 3300044735 | Bacteria | 1429 |
| 172 | Ga0466970_0142324 | 3300044765 | Bacteria | 1321 |
| 173 | Ga0466960_0047813 | 3300044901 | Bacteria | 2053 |
| 174 | Ga0466960_0197319 | 3300044901 | Bacteria | 1098 |
| 175 | Ga0466960_0287575 | 3300044901 | Bacteria | 923 |
| 176 | Ga0466967_0004778 | 3300045976 | Bacteria | 9225 |
| 177 | Ga0466967_0136745 | 3300045976 | Bacteria | 2279 |
| 178 | Ga0495617_000785 | 3300046452 | Bacteria | 15390 |
| 179 | Ga0495638_0001285 | 3300046460 | Bacteria | 23401 |
| 180 | Ga0495650_0079681 | 3300046471 | Bacteria | 1266 |
| 181 | Ga0495580_0253219 | 3300046472 | Bacteria | 1205 |
| 182 | Ga0495664_0224032 | 3300046477 | Bacteria | 1138 |
| 183 | Ga0495585_0000063 | 3300046492 | Bacteria | 109530 |
| 184 | Ga0495594_0398663 | 3300046499 | Bacteria | 783 |
| 185 | Ga0495607_0000029 | 3300046501 | Bacteria | 155005 |
| 186 | Ga0495583_0027370 | 3300046506 | Bacteria | 2813 |
| 187 | Ga0495583_0148551 | 3300046506 | Bacteria | 972 |
| 188 | Ga0495606_0254004 | 3300046507 | Bacteria | 974 |
| 189 | Ga0495608_0257875 | 3300046511 | Bacteria | 1086 |
| 190 | Ga0495616_0050414 | 3300046513 | Bacteria | 2081 |
| 191 | Ga0495616_0179253 | 3300046513 | Bacteria | 942 |
| 192 | Ga0495620_0159165 | 3300046515 | Bacteria | 878 |
| 193 | Ga0495631_0002304 | 3300046518 | Bacteria | 10891 |
| 194 | Ga0495637_0011110 | 3300046520 | Bacteria | 4335 |
| 195 | Ga0495640_0078320 | 3300046533 | Bacteria | 2202 |
| 196 | Ga0495587_0322848 | 3300046536 | Bacteria | 862 |
| 197 | Ga0495609_0055386 | 3300046538 | Bacteria | 1759 |
| 198 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 199 | Ga0495625_0000019 | 3300046660 | Bacteria | 298330 |
| 200 | Ga0495661_0000703 | 3300046665 | Bacteria | 33156 |
| 201 | Ga0495670_0004940 | 3300046691 | Bacteria | 6549 |
| 202 | Ga0495671_0000549 | 3300046692 | Bacteria | 28132 |
| 203 | Ga0495671_0027578 | 3300046692 | Bacteria | 2932 |
| 204 | Ga0495589_0000018 | 3300046794 | Bacteria | 204851 |
| 205 | Ga0495589_0209415 | 3300046794 | Bacteria | 918 |
| 206 | Ga0495660_0000122 | 3300046810 | Bacteria | 85116 |
| 207 | Ga0495680_0123022 | 3300047322 | Bacteria | 1914 |
| 208 | Ga0495679_000017 | 3300047446 | Bacteria | 263230 |
| 209 | Ga0495673_0004051 | 3300047469 | Bacteria | 9338 |
| 210 | Ga0495686_0050315 | 3300047472 | Bacteria | 2619 |
| 211 | Ga0495602_0280410 | 3300048088 | Bacteria | 1228 |
| 212 | Ga0495614_0202319 | 3300048089 | Bacteria | 899 |
| 213 | Ga0496100_0000324 | 3300048903 | Bacteria | 23608 |
| 214 | Ga0496100_0029409 | 3300048903 | Bacteria | 3398 |
| 215 | Ga0496100_0201096 | 3300048903 | Bacteria | 1452 |
| 216 | Ga0496101_0001179 | 3300048904 | Bacteria | 15667 |
| 217 | Ga0496101_0096416 | 3300048904 | Bacteria | 2207 |
| 218 | Ga0496101_0296359 | 3300048904 | Bacteria | 1266 |
| 219 | Ga0496102_0012797 | 3300048905 | Bacteria | 7264 |
| 220 | Ga0496102_0015042 | 3300048905 | Bacteria | 6735 |
| 221 | Ga0496102_0202002 | 3300048905 | Bacteria | 1874 |
| 222 | Ga0496104_0004300 | 3300048907 | Bacteria | 12380 |
| 223 | Ga0496104_0118634 | 3300048907 | Bacteria | 2540 |
| 224 | Ga0496105_0063215 | 3300048908 | Bacteria | 3054 |
| 225 | Ga0496105_0064430 | 3300048908 | Bacteria | 3024 |
| 226 | Ga0496106_0040064 | 3300048909 | Bacteria | 3507 |
| 227 | Ga0496106_0314966 | 3300048909 | Bacteria | 1256 |
| 228 | Ga0496107_0059655 | 3300048910 | Bacteria | 2761 |
| 229 | Ga0496109_0180108 | 3300048912 | Bacteria | 1984 |
| 230 | Ga0496110_0073199 | 3300048913 | Bacteria | 3041 |
| 231 | Ga0496110_0400241 | 3300048913 | Bacteria | 1252 |
| 232 | Ga0496111_0044735 | 3300048914 | Bacteria | 3183 |
| 233 | Ga0496112_0810685 | 3300048915 | Bacteria | 861 |
| 234 | Ga0496114_0096708 | 3300048917 | Bacteria | 2514 |
| 235 | Ga0496114_0202905 | 3300048917 | Bacteria | 1737 |
| 236 | Ga0496115_0047569 | 3300048918 | Bacteria | 3431 |
| 237 | Ga0496115_0158449 | 3300048918 | Bacteria | 1870 |
| 238 | Ga0496115_0421182 | 3300048918 | Bacteria | 1082 |
| 239 | Ga0496116_0008351 | 3300048919 | Bacteria | 8997 |
| 240 | Ga0496117_0000035 | 3300048920 | Bacteria | 326449 |
| 241 | Ga0496117_0037920 | 3300048920 | Bacteria | 3583 |
| 242 | Ga0496118_0000054 | 3300048921 | Bacteria | 233617 |
| 243 | Ga0496118_0000423 | 3300048921 | Bacteria | 70256 |
| 244 | Ga0496118_0155312 | 3300048921 | Bacteria | 1425 |
| 245 | Ga0496119_0005770 | 3300048922 | Bacteria | 11726 |
| 246 | Ga0496120_0007388 | 3300048923 | Bacteria | 8187 |
| 247 | Ga0496124_0120737 | 3300048927 | Bacteria | 2095 |
| 248 | Ga0496125_0046520 | 3300048928 | Bacteria | 3639 |
| 249 | Ga0496126_0034701 | 3300048929 | Bacteria | 4735 |
| 250 | Ga0496126_0063283 | 3300048929 | Bacteria | 3316 |
| 251 | Ga0495678_000210 | 3300049459 | Bacteria | 68186 |
| 252 | Ga0495682_0004086 | 3300049460 | Bacteria | 6342 |
| 253 | Ga0495682_0057728 | 3300049460 | Bacteria | 1404 |
| 254 | Ga0501031_0007813 | 3300049568 | Bacteria | 6962 |
| 255 | Ga0501032_0000767 | 3300049569 | Bacteria | 26035 |
| 256 | Ga0501033_0035725 | 3300049570 | Bacteria | 3725 |
| 257 | Ga0501033_0211001 | 3300049570 | Bacteria | 1385 |
| 258 | Ga0501034_0054740 | 3300049571 | Bacteria | 4016 |
| 259 | Ga0501036_0007805 | 3300049572 | Bacteria | 8750 |
| 260 | Ga0501037_0003426 | 3300049573 | Bacteria | 11526 |
| 261 | Ga0501037_0077229 | 3300049573 | Bacteria | 2417 |
| 262 | Ga0501038_0037231 | 3300049574 | Bacteria | 4266 |
| 263 | Ga0501038_0258281 | 3300049574 | Bacteria | 1378 |
| 264 | Ga0501038_0480890 | 3300049574 | Bacteria | 952 |
| 265 | Ga0501039_0052551 | 3300049575 | Bacteria | 3152 |
| 266 | Ga0501043_0002085 | 3300049579 | Bacteria | 17072 |
| 267 | Ga0501046_0003083 | 3300049580 | Bacteria | 15390 |
| 268 | Ga0501047_0026148 | 3300049581 | Bacteria | 5614 |
| 269 | Ga0501047_0141046 | 3300049581 | Bacteria | 2288 |
| 270 | Ga0501048_0217959 | 3300049582 | Bacteria | 1353 |
| 271 | Ga0501067_0000653 | 3300049583 | Bacteria | 18676 |
| 272 | Ga0501067_0008290 | 3300049583 | Bacteria | 5770 |
| 273 | Ga0501068_0007420 | 3300049584 | Bacteria | 6071 |
| 274 | Ga0501069_0006325 | 3300049585 | Bacteria | 6191 |
| 275 | Ga0501069_0372167 | 3300049585 | Bacteria | 843 |
| 276 | Ga0501070_0004405 | 3300049586 | Bacteria | 12086 |
| 277 | Ga0501070_0034537 | 3300049586 | Bacteria | 4227 |
| 278 | Ga0501070_0235296 | 3300049586 | Bacteria | 1500 |
| 279 | Ga0501072_0001615 | 3300049588 | Bacteria | 16849 |
| 280 | Ga0501073_0001950 | 3300049589 | Bacteria | 15373 |
| 281 | Ga0501074_0060812 | 3300049590 | Bacteria | 2721 |
| 282 | Ga0501076_0140471 | 3300049592 | Bacteria | 1962 |
| 283 | Ga0501077_0003301 | 3300049593 | Bacteria | 9710 |
| 284 | Ga0501079_0011766 | 3300049741 | Bacteria | 6683 |
| 285 | Ga0501080_0000291 | 3300049742 | Bacteria | 38072 |
| 286 | Ga0501083_0034357 | 3300049744 | Bacteria | 3467 |
| 287 | Ga0501035_0064008 | 3300049822 | Bacteria | 3269 |
| 288 | Ga0501035_0107786 | 3300049822 | Bacteria | 2442 |
| 289 | Ga0501044_0032490 | 3300049823 | Bacteria | 5486 |
| 290 | Ga0501044_0100032 | 3300049823 | Bacteria | 2918 |
| 291 | Ga0501044_0168563 | 3300049823 | Bacteria | 2162 |
| 292 | Ga0501044_0551124 | 3300049823 | Bacteria | 1050 |
| 293 | Ga0501045_0449881 | 3300049824 | Bacteria | 957 |
| 294 | nmdc:mga05p37_686342_c1 | 3300050507 | Bacteria | 1140 |
| 295 | nmdc:mga06r32_599_c1 | 3300050510 | Bacteria | 31400 |
| 296 | nmdc:mga0n895_45041_c1 | 3300050512 | Bacteria | 4304 |
| 297 | nmdc:mga0rr50_13931_c1 | 3300050513 | Bacteria | 5254 |
| 298 | nmdc:mga08x19_589134_c1 | 3300050514 | Bacteria | 788 |
| 299 | nmdc:mga08x19_9922_c1 | 3300050514 | Bacteria | 5706 |
| 300 | nmdc:mga0a205_380674_c1 | 3300050515 | Bacteria | 1276 |
| 301 | Ga0495601_0301078 | 3300053077 | Bacteria | 1044 |
| 302 | Ga0495595_0093142 | 3300053084 | Bacteria | 1447 |
| 303 | Ga0500643_000029 | 3300053087 | Bacteria | 211149 |
| 304 | Ga0500643_002857 | 3300053087 | Bacteria | 8606 |
| 305 | Ga0500555_000067 | 3300053103 | Bacteria | 52543 |
| 306 | Ga0500564_212070 | 3300053138 | Bacteria | 789 |
| 307 | Ga0501084_0002646 | 3300054114 | Bacteria | 14436 |
| 308 | Ga0501082_0068063 | 3300060353 | Bacteria | 3066 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050514 | nmdc:mga08x19_589134_c1 | nmdc:mga08x19_589134_c1_217_738 | 165 |
| 2 | 3300005535 | Ga0070684_100039454 | Ga0070684_1000394547 | 177 |
| 3 | 3300006852 | Ga0075433_10841565 | Ga0075433_108415652 | 177 |
| 4 | 3300006871 | Ga0075434_100008352 | Ga0075434_10000835210 | 177 |
| 5 | 3300006914 | Ga0075436_100020333 | Ga0075436_1000203336 | 177 |
| 6 | 3300007076 | Ga0075435_100004144 | Ga0075435_10000414410 | 177 |
| 7 | 3300025914 | Ga0207671_10305089 | Ga0207671_103050892 | 177 |
| 8 | 3300025932 | Ga0207690_10164060 | Ga0207690_101640601 | 177 |
| 9 | 3300025945 | Ga0207679_10037399 | Ga0207679_100373994 | 177 |
| 10 | 3300039450 | Ga0436363_0083618 | Ga0436363_0083618_93_701 | 182 |
| 11 | 3300005544 | Ga0070686_100126985 | Ga0070686_1001269855 | 184 |
| 12 | 3300009098 | Ga0105245_10209351 | Ga0105245_102093512 | 184 |
| 13 | 3300009545 | Ga0105237_10316768 | Ga0105237_103167682 | 184 |
| 14 | 3300009551 | Ga0105238_10026170 | Ga0105238_100261706 | 184 |
| 15 | 3300013105 | Ga0157369_10023673 | Ga0157369_100236735 | 184 |
| 16 | 3300020081 | Ga0206354_11078640 | Ga0206354_110786401 | 184 |
| 17 | 3300026078 | Ga0207702_10573827 | Ga0207702_105738271 | 184 |
| 18 | 3300041496 | Ga0451839_0090435 | Ga0451839_0090435_339_944 | 184 |
| 19 | 3300044901 | Ga0466960_0287575 | Ga0466960_0287575_155_757 | 184 |
| 20 | 3300048903 | Ga0496100_0029409 | Ga0496100_0029409_1603_2214 | 184 |
| 21 | 3300048904 | Ga0496101_0096416 | Ga0496101_0096416_599_1210 | 184 |
| 22 | 3300048905 | Ga0496102_0015042 | Ga0496102_0015042_5538_6149 | 184 |
| 23 | 3300048907 | Ga0496104_0118634 | Ga0496104_0118634_1153_1764 | 184 |
| 24 | 3300048908 | Ga0496105_0063215 | Ga0496105_0063215_824_1435 | 184 |
| 25 | 3300048909 | Ga0496106_0040064 | Ga0496106_0040064_2129_2740 | 184 |
| 26 | 3300048910 | Ga0496107_0059655 | Ga0496107_0059655_381_992 | 184 |
| 27 | 3300048917 | Ga0496114_0096708 | Ga0496114_0096708_663_1274 | 184 |
| 28 | 3300048917 | Ga0496114_0202905 | Ga0496114_0202905_28_720 | 184 |
| 29 | 3300048918 | Ga0496115_0158449 | Ga0496115_0158449_568_1179 | 184 |
| 30 | 3300049583 | Ga0501067_0008290 | Ga0501067_0008290_2750_3364 | 184 |
| 31 | 3300049585 | Ga0501069_0372167 | Ga0501069_0372167_44_658 | 184 |
| 32 | 3300050512 | nmdc:mga0n895_45041_c1 | nmdc:mga0n895_45041_c1_1026_1640 | 184 |
| 33 | 3300050513 | nmdc:mga0rr50_13931_c1 | nmdc:mga0rr50_13931_c1_2000_2614 | 184 |
| 34 | 3300050514 | nmdc:mga08x19_9922_c1 | nmdc:mga08x19_9922_c1_2207_2821 | 184 |
| 35 | 3300050515 | nmdc:mga0a205_380674_c1 | nmdc:mga0a205_380674_c1_371_985 | 184 |
| 36 | 3300010159 | Ga0099796_10062968 | Ga0099796_100629681 | 185 |
| 37 | 3300005545 | Ga0070695_100208038 | Ga0070695_1002080382 | 187 |
| 38 | 3300005563 | Ga0068855_100108954 | Ga0068855_1001089544 | 187 |
| 39 | 3300006028 | Ga0070717_10074535 | Ga0070717_100745352 | 187 |
| 40 | 3300020070 | Ga0206356_11221166 | Ga0206356_112211662 | 187 |
| 41 | 3300022467 | Ga0224712_10007156 | Ga0224712_100071563 | 187 |
| 42 | 3300025917 | Ga0207660_10278290 | Ga0207660_102782902 | 187 |
| 43 | 3300025929 | Ga0207664_10086649 | Ga0207664_100866493 | 187 |
| 44 | 3300025949 | Ga0207667_10442617 | Ga0207667_104426172 | 187 |
| 45 | 3300035410 | Ga0373924_0235629 | Ga0373924_0235629_12_635 | 187 |
| 46 | 3300046533 | Ga0495640_0078320 | Ga0495640_0078320_1191_1814 | 187 |
| 47 | 3300026067 | Ga0207678_10311829 | Ga0207678_103118292 | 188 |
| 48 | 3300005336 | Ga0070680_100014676 | Ga0070680_1000146763 | 189 |
| 49 | 3300005338 | Ga0068868_100127284 | Ga0068868_1001272841 | 189 |
| 50 | 3300005458 | Ga0070681_10022680 | Ga0070681_100226808 | 189 |
| 51 | 3300009093 | Ga0105240_10124766 | Ga0105240_101247663 | 189 |
| 52 | 3300028786 | Ga0307517_10039490 | Ga0307517_100394903 | 189 |
| 53 | 3300038443 | Ga0395901_0788373 | Ga0395901_0788373_134_712 | 189 |
| 54 | 3300044735 | Ga0466968_0080652 | Ga0466968_0080652_682_1269 | 189 |
| 55 | 3300045976 | Ga0466967_0004778 | Ga0466967_0004778_45_626 | 189 |
| 56 | 3300045976 | Ga0466967_0136745 | Ga0466967_0136745_848_1441 | 189 |
| 57 | 3300047322 | Ga0495680_0123022 | Ga0495680_0123022_39_632 | 189 |
| 58 | 3300048905 | Ga0496102_0202002 | Ga0496102_0202002_1242_1835 | 189 |
| 59 | 3300048918 | Ga0496115_0421182 | Ga0496115_0421182_473_1066 | 189 |
| 60 | 3300039437 | Ga0436365_0670285 | Ga0436365_0670285_22_696 | 190 |
| 61 | iso_pu_bacteria | 2517287029 | 2517407072 | 191 |
| 62 | iso_pu_bacteria | 2818991435 | 2819540462 | 191 |
| 63 | iso_pu_bacteria | 2818991454 | 2819649422 | 191 |
| 64 | 3300050507 | nmdc:mga05p37_686342_c1 | nmdc:mga05p37_686342_c1_232_834 | 192 |
| 65 | iso_pu_bacteria | 2884338543 | 2884338895 | 192 |
| 66 | iso_pu_bacteria | 2885305155 | 2885310844 | 192 |
| 67 | iso_pu_bacteria | 2885326080 | 2885331077 | 192 |
| 68 | iso_pu_bacteria | 2965062239 | 2965069948 | 192 |
| 69 | iso_pu_bacteria | 2968128360 | 2968132983 | 192 |
| 70 | iso_pu_bacteria | 2811994872 | 2812324196 | 193 |
| 71 | 3300005436 | Ga0070713_100313642 | Ga0070713_1003136422 | 195 |
| 72 | 3300005440 | Ga0070705_100085570 | Ga0070705_1000855702 | 195 |
| 73 | 3300005445 | Ga0070708_100246218 | Ga0070708_1002462182 | 195 |
| 74 | 3300005455 | Ga0070663_100354004 | Ga0070663_1003540042 | 195 |
| 75 | 3300005458 | Ga0070681_10233519 | Ga0070681_102335192 | 195 |
| 76 | 3300005467 | Ga0070706_100320935 | Ga0070706_1003209352 | 195 |
| 77 | 3300005468 | Ga0070707_100007568 | Ga0070707_1000075682 | 195 |
| 78 | 3300005518 | Ga0070699_100102317 | Ga0070699_1001023174 | 195 |
| 79 | 3300005530 | Ga0070679_100382248 | Ga0070679_1003822481 | 195 |
| 80 | 3300005536 | Ga0070697_100194190 | Ga0070697_1001941902 | 195 |
| 81 | 3300005563 | Ga0068855_100063026 | Ga0068855_1000630263 | 195 |
| 82 | 3300005578 | Ga0068854_100204514 | Ga0068854_1002045143 | 195 |
| 83 | 3300005842 | Ga0068858_100000092 | Ga0068858_10000009256 | 195 |
| 84 | 3300005842 | Ga0068858_100373347 | Ga0068858_1003733472 | 195 |
| 85 | 3300006028 | Ga0070717_10172218 | Ga0070717_101722182 | 195 |
| 86 | 3300006173 | Ga0070716_100726012 | Ga0070716_1007260121 | 195 |
| 87 | 3300006175 | Ga0070712_100094297 | Ga0070712_1000942971 | 195 |
| 88 | 3300009093 | Ga0105240_10022811 | Ga0105240_100228112 | 195 |
| 89 | 3300009093 | Ga0105240_10695827 | Ga0105240_106958272 | 195 |
| 90 | 3300009098 | Ga0105245_10571218 | Ga0105245_105712181 | 195 |
| 91 | 3300009177 | Ga0105248_10025939 | Ga0105248_100259392 | 195 |
| 92 | 3300009551 | Ga0105238_10066442 | Ga0105238_100664423 | 195 |
| 93 | 3300009551 | Ga0105238_10233817 | Ga0105238_102338174 | 195 |
| 94 | 3300010375 | Ga0105239_11042406 | Ga0105239_110424062 | 195 |
| 95 | 3300013105 | Ga0157369_10028297 | Ga0157369_100282976 | 195 |
| 96 | 3300013296 | Ga0157374_10418564 | Ga0157374_104185641 | 195 |
| 97 | 3300014325 | Ga0163163_10253303 | Ga0163163_102533032 | 195 |
| 98 | 3300014968 | Ga0157379_10051262 | Ga0157379_100512625 | 195 |
| 99 | 3300017792 | Ga0163161_10091702 | Ga0163161_100917023 | 195 |
| 100 | 3300021361 | Ga0213872_10193397 | Ga0213872_101933971 | 195 |
| 101 | 3300021388 | Ga0213875_10034770 | Ga0213875_100347702 | 195 |
| 102 | 3300025906 | Ga0207699_10357734 | Ga0207699_103577342 | 195 |
| 103 | 3300025910 | Ga0207684_10253501 | Ga0207684_102535011 | 195 |
| 104 | 3300025912 | Ga0207707_10005763 | Ga0207707_100057637 | 195 |
| 105 | 3300025915 | Ga0207693_10084925 | Ga0207693_100849252 | 195 |
| 106 | 3300025921 | Ga0207652_10219512 | Ga0207652_102195122 | 195 |
| 107 | 3300025922 | Ga0207646_10004860 | Ga0207646_100048608 | 195 |
| 108 | 3300025924 | Ga0207694_10068151 | Ga0207694_100681513 | 195 |
| 109 | 3300025924 | Ga0207694_10068700 | Ga0207694_100687002 | 195 |
| 110 | 3300025928 | Ga0207700_10301575 | Ga0207700_103015751 | 195 |
| 111 | 3300025936 | Ga0207670_10227893 | Ga0207670_102278932 | 195 |
| 112 | 3300025939 | Ga0207665_10490477 | Ga0207665_104904772 | 195 |
| 113 | 3300025941 | Ga0207711_10059553 | Ga0207711_100595534 | 195 |
| 114 | 3300025949 | Ga0207667_10009414 | Ga0207667_1000941410 | 195 |
| 115 | 3300026035 | Ga0207703_10000737 | Ga0207703_1000073721 | 195 |
| 116 | 3300026035 | Ga0207703_10350638 | Ga0207703_103506382 | 195 |
| 117 | 3300026035 | Ga0207703_11389087 | Ga0207703_113890871 | 195 |
| 118 | 3300026142 | Ga0207698_10110392 | Ga0207698_101103923 | 195 |
| 119 | 3300026142 | Ga0207698_10520727 | Ga0207698_105207271 | 195 |
| 120 | 3300028800 | Ga0265338_10161650 | Ga0265338_101616501 | 195 |
| 121 | 3300030521 | Ga0307511_10031383 | Ga0307511_100313834 | 195 |
| 122 | 3300031090 | Ga0265760_10076245 | Ga0265760_100762451 | 195 |
| 123 | 3300031239 | Ga0265328_10145845 | Ga0265328_101458451 | 195 |
| 124 | 3300031249 | Ga0265339_10004753 | Ga0265339_100047536 | 195 |
| 125 | 3300031249 | Ga0265339_10067416 | Ga0265339_100674161 | 195 |
| 126 | 3300031251 | Ga0265327_10016605 | Ga0265327_100166053 | 195 |
| 127 | 3300031616 | Ga0307508_10011619 | Ga0307508_100116196 | 195 |
| 128 | 3300031711 | Ga0265314_10008536 | Ga0265314_100085366 | 195 |
| 129 | 3300031711 | Ga0265314_10128014 | Ga0265314_101280142 | 195 |
| 130 | 3300035725 | Ga0373947_0535819 | Ga0373947_0535819_33_674 | 195 |
| 131 | 3300037312 | Ga0395899_0072708 | Ga0395899_0072708_490_1131 | 195 |
| 132 | 3300037853 | Ga0436364_1400663 | Ga0436364_1400663_2327_2971 | 195 |
| 133 | 3300038443 | Ga0395901_0073703 | Ga0395901_0073703_225_866 | 195 |
| 134 | 3300039437 | Ga0436365_1063831 | Ga0436365_1063831_801_1433 | 195 |
| 135 | 3300039438 | Ga0436360_0084123 | Ga0436360_0084123_316_957 | 195 |
| 136 | 3300041492 | Ga0451835_1085803 | Ga0451835_1085803_21_662 | 195 |
| 137 | 3300041505 | Ga0451849_0079886 | Ga0451849_0079886_427_1068 | 195 |
| 138 | 3300041509 | Ga0451843_0616296 | Ga0451843_0616296_363_1004 | 195 |
| 139 | 3300041511 | Ga0451855_1598589 | Ga0451855_1598589_787_1428 | 195 |
| 140 | 3300046452 | Ga0495617_000785 | Ga0495617_000785_7869_8501 | 195 |
| 141 | 3300046460 | Ga0495638_0001285 | Ga0495638_0001285_15378_16010 | 195 |
| 142 | 3300046471 | Ga0495650_0079681 | Ga0495650_0079681_470_1111 | 195 |
| 143 | 3300046492 | Ga0495585_0000063 | Ga0495585_0000063_87955_88587 | 195 |
| 144 | 3300046501 | Ga0495607_0000029 | Ga0495607_0000029_37890_38522 | 195 |
| 145 | 3300046506 | Ga0495583_0027370 | Ga0495583_0027370_1917_2549 | 195 |
| 146 | 3300046507 | Ga0495606_0254004 | Ga0495606_0254004_190_831 | 195 |
| 147 | 3300046513 | Ga0495616_0050414 | Ga0495616_0050414_1278_1910 | 195 |
| 148 | 3300046513 | Ga0495616_0179253 | Ga0495616_0179253_172_804 | 195 |
| 149 | 3300046518 | Ga0495631_0002304 | Ga0495631_0002304_9964_10596 | 195 |
| 150 | 3300046520 | Ga0495637_0011110 | Ga0495637_0011110_3636_4268 | 195 |
| 151 | 3300046538 | Ga0495609_0055386 | Ga0495609_0055386_60_692 | 195 |
| 152 | 3300046648 | Ga0495611_0000003 | Ga0495611_0000003_76753_77385 | 195 |
| 153 | 3300046660 | Ga0495625_0000019 | Ga0495625_0000019_229265_229897 | 195 |
| 154 | 3300046665 | Ga0495661_0000703 | Ga0495661_0000703_20995_21627 | 195 |
| 155 | 3300046691 | Ga0495670_0004940 | Ga0495670_0004940_5578_6210 | 195 |
| 156 | 3300046692 | Ga0495671_0000549 | Ga0495671_0000549_25059_25691 | 195 |
| 157 | 3300046794 | Ga0495589_0000018 | Ga0495589_0000018_166323_166955 | 195 |
| 158 | 3300046810 | Ga0495660_0000122 | Ga0495660_0000122_67226_67858 | 195 |
| 159 | 3300047446 | Ga0495679_000017 | Ga0495679_000017_185828_186460 | 195 |
| 160 | 3300047469 | Ga0495673_0004051 | Ga0495673_0004051_2159_2791 | 195 |
| 161 | 3300048903 | Ga0496100_0000324 | Ga0496100_0000324_19473_20105 | 195 |
| 162 | 3300048903 | Ga0496100_0201096 | Ga0496100_0201096_496_1137 | 195 |
| 163 | 3300048904 | Ga0496101_0001179 | Ga0496101_0001179_11461_12093 | 195 |
| 164 | 3300048904 | Ga0496101_0296359 | Ga0496101_0296359_26_667 | 195 |
| 165 | 3300048905 | Ga0496102_0012797 | Ga0496102_0012797_862_1494 | 195 |
| 166 | 3300048909 | Ga0496106_0314966 | Ga0496106_0314966_529_1170 | 195 |
| 167 | 3300048918 | Ga0496115_0047569 | Ga0496115_0047569_69_701 | 195 |
| 168 | 3300048919 | Ga0496116_0008351 | Ga0496116_0008351_3208_3840 | 195 |
| 169 | 3300048920 | Ga0496117_0000035 | Ga0496117_0000035_188472_189104 | 195 |
| 170 | 3300048921 | Ga0496118_0000054 | Ga0496118_0000054_33957_34589 | 195 |
| 171 | 3300048921 | Ga0496118_0155312 | Ga0496118_0155312_138_779 | 195 |
| 172 | 3300048922 | Ga0496119_0005770 | Ga0496119_0005770_434_1066 | 195 |
| 173 | 3300048923 | Ga0496120_0007388 | Ga0496120_0007388_5956_6588 | 195 |
| 174 | 3300048928 | Ga0496125_0046520 | Ga0496125_0046520_583_1215 | 195 |
| 175 | 3300048929 | Ga0496126_0034701 | Ga0496126_0034701_3801_4433 | 195 |
| 176 | 3300048929 | Ga0496126_0063283 | Ga0496126_0063283_303_935 | 195 |
| 177 | 3300049459 | Ga0495678_000210 | Ga0495678_000210_37900_38532 | 195 |
| 178 | 3300049460 | Ga0495682_0057728 | Ga0495682_0057728_227_859 | 195 |
| 179 | 3300049574 | Ga0501038_0258281 | Ga0501038_0258281_73_714 | 195 |
| 180 | 3300049581 | Ga0501047_0141046 | Ga0501047_0141046_1582_2223 | 195 |
| 181 | 3300049823 | Ga0501044_0100032 | Ga0501044_0100032_1748_2398 | 195 |
| 182 | 3300049823 | Ga0501044_0551124 | Ga0501044_0551124_34_675 | 195 |
| 183 | 3300053087 | Ga0500643_000029 | Ga0500643_000029_76676_77308 | 195 |
| 184 | 3300053103 | Ga0500555_000067 | Ga0500555_000067_26376_27008 | 195 |
| 185 | 3300053138 | Ga0500564_212070 | Ga0500564_212070_101_733 | 195 |
| 186 | 3300005344 | Ga0070661_100232235 | Ga0070661_1002322353 | 196 |
| 187 | 3300005435 | Ga0070714_100007408 | Ga0070714_1000074089 | 196 |
| 188 | 3300005436 | Ga0070713_100065490 | Ga0070713_1000654901 | 196 |
| 189 | 3300005436 | Ga0070713_100343662 | Ga0070713_1003436622 | 196 |
| 190 | 3300005437 | Ga0070710_10399694 | Ga0070710_103996941 | 196 |
| 191 | 3300005468 | Ga0070707_100633006 | Ga0070707_1006330061 | 196 |
| 192 | 3300005539 | Ga0068853_100005841 | Ga0068853_1000058414 | 196 |
| 193 | 3300005578 | Ga0068854_100028297 | Ga0068854_1000282973 | 196 |
| 194 | 3300005614 | Ga0068856_100038601 | Ga0068856_1000386016 | 196 |
| 195 | 3300005719 | Ga0068861_100000375 | Ga0068861_1000003752 | 196 |
| 196 | 3300006028 | Ga0070717_10026242 | Ga0070717_100262422 | 196 |
| 197 | 3300006028 | Ga0070717_10095322 | Ga0070717_100953222 | 196 |
| 198 | 3300009093 | Ga0105240_10057758 | Ga0105240_100577587 | 196 |
| 199 | 3300009174 | Ga0105241_10015359 | Ga0105241_100153595 | 196 |
| 200 | 3300009545 | Ga0105237_10208662 | Ga0105237_102086623 | 196 |
| 201 | 3300009545 | Ga0105237_10326261 | Ga0105237_103262612 | 196 |
| 202 | 3300009551 | Ga0105238_10083356 | Ga0105238_100833563 | 196 |
| 203 | 3300010375 | Ga0105239_10011216 | Ga0105239_100112163 | 196 |
| 204 | 3300013104 | Ga0157370_10187652 | Ga0157370_101876523 | 196 |
| 205 | 3300013105 | Ga0157369_10021543 | Ga0157369_100215437 | 196 |
| 206 | 3300013105 | Ga0157369_10349747 | Ga0157369_103497472 | 196 |
| 207 | 3300013307 | Ga0157372_10012081 | Ga0157372_100120812 | 196 |
| 208 | 3300013307 | Ga0157372_10086827 | Ga0157372_100868274 | 196 |
| 209 | 3300013307 | Ga0157372_10115264 | Ga0157372_101152642 | 196 |
| 210 | 3300020078 | Ga0206352_10166636 | Ga0206352_101666362 | 196 |
| 211 | 3300021358 | Ga0213873_10004958 | Ga0213873_100049582 | 196 |
| 212 | 3300021441 | Ga0213871_10125922 | Ga0213871_101259221 | 196 |
| 213 | 3300025906 | Ga0207699_10399857 | Ga0207699_103998571 | 196 |
| 214 | 3300025911 | Ga0207654_10017149 | Ga0207654_100171492 | 196 |
| 215 | 3300025912 | Ga0207707_10100098 | Ga0207707_101000982 | 196 |
| 216 | 3300025913 | Ga0207695_10001998 | Ga0207695_1000199818 | 196 |
| 217 | 3300025913 | Ga0207695_10009334 | Ga0207695_100093343 | 196 |
| 218 | 3300025914 | Ga0207671_10067018 | Ga0207671_100670184 | 196 |
| 219 | 3300025924 | Ga0207694_10000157 | Ga0207694_1000015715 | 196 |
| 220 | 3300025929 | Ga0207664_10000737 | Ga0207664_1000073716 | 196 |
| 221 | 3300025939 | Ga0207665_10753503 | Ga0207665_107535031 | 196 |
| 222 | 3300025949 | Ga0207667_10011520 | Ga0207667_100115203 | 196 |
| 223 | 3300026023 | Ga0207677_10557320 | Ga0207677_105573202 | 196 |
| 224 | 3300026041 | Ga0207639_10014940 | Ga0207639_100149401 | 196 |
| 225 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002271 | 196 |
| 226 | 3300026118 | Ga0207675_100000019 | Ga0207675_10000001976 | 196 |
| 227 | 3300026142 | Ga0207698_10063363 | Ga0207698_100633632 | 196 |
| 228 | 3300026142 | Ga0207698_10109072 | Ga0207698_101090722 | 196 |
| 229 | 3300030879 | Ga0265765_1018296 | Ga0265765_10182961 | 196 |
| 230 | 3300035086 | Ga0373934_0064343 | Ga0373934_0064343_23_679 | 196 |
| 231 | 3300035111 | Ga0373923_0064313 | Ga0373923_0064313_812_1492 | 196 |
| 232 | 3300035118 | Ga0373954_0081906 | Ga0373954_0081906_266_922 | 196 |
| 233 | 3300035172 | Ga0373955_0106772 | Ga0373955_0106772_299_955 | 196 |
| 234 | 3300035692 | Ga0373935_0205977 | Ga0373935_0205977_497_1153 | 196 |
| 235 | 3300035724 | Ga0373933_0204374 | Ga0373933_0204374_318_974 | 196 |
| 236 | 3300037068 | Ga0373925_0196568 | Ga0373925_0196568_97_753 | 196 |
| 237 | 3300044901 | Ga0466960_0197319 | Ga0466960_0197319_96_719 | 196 |
| 238 | 3300046472 | Ga0495580_0253219 | Ga0495580_0253219_288_968 | 196 |
| 239 | 3300046477 | Ga0495664_0224032 | Ga0495664_0224032_201_881 | 196 |
| 240 | 3300046506 | Ga0495583_0148551 | Ga0495583_0148551_222_869 | 196 |
| 241 | 3300046511 | Ga0495608_0257875 | Ga0495608_0257875_176_832 | 196 |
| 242 | 3300046515 | Ga0495620_0159165 | Ga0495620_0159165_80_703 | 196 |
| 243 | 3300046536 | Ga0495587_0322848 | Ga0495587_0322848_108_764 | 196 |
| 244 | 3300046692 | Ga0495671_0027578 | Ga0495671_0027578_857_1504 | 196 |
| 245 | 3300046794 | Ga0495589_0209415 | Ga0495589_0209415_59_706 | 196 |
| 246 | 3300047472 | Ga0495686_0050315 | Ga0495686_0050315_1099_1746 | 196 |
| 247 | 3300048088 | Ga0495602_0280410 | Ga0495602_0280410_560_1216 | 196 |
| 248 | 3300048089 | Ga0495614_0202319 | Ga0495614_0202319_34_690 | 196 |
| 249 | 3300048907 | Ga0496104_0004300 | Ga0496104_0004300_3583_4263 | 196 |
| 250 | 3300048908 | Ga0496105_0064430 | Ga0496105_0064430_546_1226 | 196 |
| 251 | 3300048912 | Ga0496109_0180108 | Ga0496109_0180108_396_1043 | 196 |
| 252 | 3300048913 | Ga0496110_0073199 | Ga0496110_0073199_16_696 | 196 |
| 253 | 3300048913 | Ga0496110_0400241 | Ga0496110_0400241_194_808 | 196 |
| 254 | 3300048914 | Ga0496111_0044735 | Ga0496111_0044735_2100_2747 | 196 |
| 255 | 3300048915 | Ga0496112_0810685 | Ga0496112_0810685_226_840 | 196 |
| 256 | 3300048920 | Ga0496117_0037920 | Ga0496117_0037920_1150_1794 | 196 |
| 257 | 3300048921 | Ga0496118_0000423 | Ga0496118_0000423_9025_9669 | 196 |
| 258 | 3300049460 | Ga0495682_0004086 | Ga0495682_0004086_1634_2281 | 196 |
| 259 | 3300049570 | Ga0501033_0211001 | Ga0501033_0211001_206_853 | 196 |
| 260 | 3300049573 | Ga0501037_0077229 | Ga0501037_0077229_604_1251 | 196 |
| 261 | 3300049574 | Ga0501038_0480890 | Ga0501038_0480890_41_688 | 196 |
| 262 | 3300049586 | Ga0501070_0235296 | Ga0501070_0235296_763_1410 | 196 |
| 263 | 3300049822 | Ga0501035_0107786 | Ga0501035_0107786_643_1290 | 196 |
| 264 | 3300049823 | Ga0501044_0168563 | Ga0501044_0168563_237_884 | 196 |
| 265 | 3300053077 | Ga0495601_0301078 | Ga0495601_0301078_57_713 | 196 |
| 266 | 3300053084 | Ga0495595_0093142 | Ga0495595_0093142_484_1140 | 196 |
| 267 | 3300053087 | Ga0500643_002857 | Ga0500643_002857_618_1268 | 196 |
| 268 | 3300005355 | Ga0070671_100948516 | Ga0070671_1009485161 | 197 |
| 269 | 3300005578 | Ga0068854_100479966 | Ga0068854_1004799662 | 197 |
| 270 | 3300006847 | Ga0075431_100001598 | Ga0075431_10000159827 | 197 |
| 271 | 3300009094 | Ga0111539_10252587 | Ga0111539_102525873 | 197 |
| 272 | 3300013250 | Ga0171462_1004 | Ga0171462_1004477 | 197 |
| 273 | 3300017792 | Ga0163161_10822458 | Ga0163161_108224581 | 197 |
| 274 | 3300025933 | Ga0207706_10064402 | Ga0207706_100644025 | 197 |
| 275 | 3300026078 | Ga0207702_10057323 | Ga0207702_100573231 | 197 |
| 276 | 3300044683 | Ga0466965_0025688 | Ga0466965_0025688_112_744 | 197 |
| 277 | 3300044735 | Ga0466968_0018501 | Ga0466968_0018501_1815_2447 | 197 |
| 278 | 3300044765 | Ga0466970_0142324 | Ga0466970_0142324_471_1103 | 197 |
| 279 | 3300044901 | Ga0466960_0047813 | Ga0466960_0047813_1382_2014 | 197 |
| 280 | 3300048927 | Ga0496124_0120737 | Ga0496124_0120737_358_981 | 197 |
| 281 | 3300049568 | Ga0501031_0007813 | Ga0501031_0007813_4806_5486 | 197 |
| 282 | 3300049569 | Ga0501032_0000767 | Ga0501032_0000767_20260_20940 | 197 |
| 283 | 3300049570 | Ga0501033_0035725 | Ga0501033_0035725_1628_2308 | 197 |
| 284 | 3300049571 | Ga0501034_0054740 | Ga0501034_0054740_2923_3603 | 197 |
| 285 | 3300049572 | Ga0501036_0007805 | Ga0501036_0007805_7657_8337 | 197 |
| 286 | 3300049573 | Ga0501037_0003426 | Ga0501037_0003426_8472_9152 | 197 |
| 287 | 3300049574 | Ga0501038_0037231 | Ga0501038_0037231_1240_1920 | 197 |
| 288 | 3300049575 | Ga0501039_0052551 | Ga0501039_0052551_541_1221 | 197 |
| 289 | 3300049579 | Ga0501043_0002085 | Ga0501043_0002085_15851_16531 | 197 |
| 290 | 3300049580 | Ga0501046_0003083 | Ga0501046_0003083_5707_6387 | 197 |
| 291 | 3300049581 | Ga0501047_0026148 | Ga0501047_0026148_1973_2653 | 197 |
| 292 | 3300049582 | Ga0501048_0217959 | Ga0501048_0217959_512_1192 | 197 |
| 293 | 3300049583 | Ga0501067_0000653 | Ga0501067_0000653_4103_4783 | 197 |
| 294 | 3300049584 | Ga0501068_0007420 | Ga0501068_0007420_2125_2805 | 197 |
| 295 | 3300049585 | Ga0501069_0006325 | Ga0501069_0006325_5462_6142 | 197 |
| 296 | 3300049586 | Ga0501070_0004405 | Ga0501070_0004405_1956_2579 | 197 |
| 297 | 3300049586 | Ga0501070_0034537 | Ga0501070_0034537_945_1625 | 197 |
| 298 | 3300049588 | Ga0501072_0001615 | Ga0501072_0001615_2374_3054 | 197 |
| 299 | 3300049589 | Ga0501073_0001950 | Ga0501073_0001950_14263_14943 | 197 |
| 300 | 3300049590 | Ga0501074_0060812 | Ga0501074_0060812_1628_2308 | 197 |
| 301 | 3300049592 | Ga0501076_0140471 | Ga0501076_0140471_1174_1854 | 197 |
| 302 | 3300049593 | Ga0501077_0003301 | Ga0501077_0003301_1012_1692 | 197 |
| 303 | 3300049741 | Ga0501079_0011766 | Ga0501079_0011766_4466_5146 | 197 |
| 304 | 3300049742 | Ga0501080_0000291 | Ga0501080_0000291_11123_11803 | 197 |
| 305 | 3300049744 | Ga0501083_0034357 | Ga0501083_0034357_2374_3054 | 197 |
| 306 | 3300049822 | Ga0501035_0064008 | Ga0501035_0064008_1172_1852 | 197 |
| 307 | 3300049823 | Ga0501044_0032490 | Ga0501044_0032490_1973_2653 | 197 |
| 308 | 3300049824 | Ga0501045_0449881 | Ga0501045_0449881_267_947 | 197 |
| 309 | 3300050510 | nmdc:mga06r32_599_c1 | nmdc:mga06r32_599_c1_11265_11885 | 197 |
| 310 | 3300054114 | Ga0501084_0002646 | Ga0501084_0002646_5477_6157 | 197 |
| 311 | 3300060353 | Ga0501082_0068063 | Ga0501082_0068063_1973_2653 | 197 |
| 312 | 3300005530 | Ga0070679_100132649 | Ga0070679_1001326494 | 198 |
| 313 | 3300025921 | Ga0207652_10238910 | Ga0207652_102389101 | 198 |
| 314 | 3300046499 | Ga0495594_0398663 | Ga0495594_0398663_71_667 | 198 |
| 315 | 3300005331 | Ga0070670_100691558 | Ga0070670_1006915581 | 199 |
| 316 | 3300031548 | Ga0307408_101087086 | Ga0307408_1010870861 | 199 |
| 317 | 3300031995 | Ga0307409_100307394 | Ga0307409_1003073942 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8499 | 1 | 198 |
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8418 | 1 | 198 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.7817 | 2 | 197 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.7775 | 2 | 197 |
| 2jyb-assembly1.cif.gz_A | binary hvdhfr1:folate complex | 0.7665 | 3 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFV2_139_215_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8729 | 176 | 199 | 3.30.70.260 |
| af_Q19962_62_333_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8615 | 178 | 195 | 1.10.510.10 |
| af_P90895_1_189_3.90.1520.10 | Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain | 0.7797 | 176 | 197 | 3.90.1520.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7721 | 2 | 197 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7519 | 2 | 197 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535DTC7-F1-model_v4 | Dihydrofolate reductase | 0.9892 | 63 | 197 |
GO:0008703
GO:0009231 |
| AF-A0A535MPM6-F1-model_v4 | Dihydrofolate reductase | 0.9882 | 76 | 196 |
GO:0008703
GO:0009231 |
| AF-A0A2W2E8C6-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9827 | 90 | 196 |
GO:0008703
GO:0009231 |
| AF-A0A1H7GZJ2-F1-model_v4 | Dihydrofolate reductase | 0.9824 | 89 | 196 |
GO:0008703
GO:0009231 |
| AF-A0A853AW15-F1-model_v4 | Dihydrofolate reductase | 0.9799 | 1 | 197 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar