F404144

General Info

Members Datasets Scaffolds Average Seq Length
317 226 308 210

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11042406|Ga0105239_110424062
Length 246
Sequence VGGCNVGAERFSLTSCNIKPACEDSTCCSFDQAETSMGKVRVAGFGVSIDGYGAGAEQSLEHPLRKGGKELHNWFYPTRTFRSMIGKDGGVDDRFARTASEGFGAFILGRNMFGPIRGEWPDESWKGWWGDNPPYHAPTFILTHNARAPIVMEGGTTFHFVTDGIEAALAQARAAAGDLDVKIGGGVSTVRQYLLARAIDELHLALSPVFLGHGESLFAGIDLPGLGYRVTEAVPTELATHLVLTR

Samples

Sample ID Description Type Environment
1 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
2 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
3 2818991435 Caulobacter henricii 536 Isolate Unclassified
4 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
5 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
6 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
7 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
8 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
9 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
224 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 1.89
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 1.26
Rhizoplane 8.2
Rhizosphere 80.44
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100691558 3300005331 Bacteria 917
2 Ga0070680_100014676 3300005336 Bacteria 6126
3 Ga0068868_100127284 3300005338 Bacteria 2082
4 Ga0070661_100232235 3300005344 Bacteria 1418
5 Ga0070671_100948516 3300005355 Bacteria 753
6 Ga0070714_100007408 3300005435 Bacteria 8539
7 Ga0070713_100065490 3300005436 Bacteria 3052
8 Ga0070713_100313642 3300005436 Bacteria 1447
9 Ga0070713_100343662 3300005436 Bacteria 1383
10 Ga0070710_10399694 3300005437 Bacteria 921
11 Ga0070705_100085570 3300005440 Bacteria 1949
12 Ga0070708_100246218 3300005445 Bacteria 1679
13 Ga0070663_100354004 3300005455 Bacteria 1189
14 Ga0070681_10022680 3300005458 Bacteria 6307
15 Ga0070681_10233519 3300005458 Bacteria 1753
16 Ga0070706_100320935 3300005467 Bacteria 1444
17 Ga0070707_100007568 3300005468 Bacteria 10085
18 Ga0070707_100633006 3300005468 Bacteria 1032
19 Ga0070699_100102317 3300005518 Bacteria 2512
20 Ga0070679_100132649 3300005530 Bacteria 2472
21 Ga0070679_100382248 3300005530 Bacteria 1355
22 Ga0070684_100039454 3300005535 Bacteria 4061
23 Ga0070697_100194190 3300005536 Bacteria 1724
24 Ga0068853_100005841 3300005539 Bacteria 9693
25 Ga0070686_100126985 3300005544 Bacteria 1759
26 Ga0070695_100208038 3300005545 Bacteria 1402
27 Ga0068855_100063026 3300005563 Bacteria 4327
28 Ga0068855_100108954 3300005563 Bacteria 3181
29 Ga0068854_100028297 3300005578 Bacteria 3871
30 Ga0068854_100204514 3300005578 Bacteria 1554
31 Ga0068854_100479966 3300005578 Bacteria 1044
32 Ga0068856_100038601 3300005614 Bacteria 4688
33 Ga0068861_100000375 3300005719 Bacteria 25742
34 Ga0068858_100000092 3300005842 Bacteria 93550
35 Ga0068858_100373347 3300005842 Bacteria 1368
36 Ga0070717_10026242 3300006028 Bacteria 4646
37 Ga0070717_10074535 3300006028 Bacteria 2837
38 Ga0070717_10095322 3300006028 Bacteria 2519
39 Ga0070717_10172218 3300006028 Bacteria 1883
40 Ga0070716_100726012 3300006173 Bacteria 762
41 Ga0070712_100094297 3300006175 Bacteria 2199
42 Ga0075431_100001598 3300006847 Bacteria 21116
43 Ga0075433_10841565 3300006852 Bacteria 801
44 Ga0075434_100008352 3300006871 Bacteria 9623
45 Ga0075436_100020333 3300006914 Bacteria 4557
46 Ga0075435_100004144 3300007076 Bacteria 9936
47 Ga0105240_10022811 3300009093 Bacteria 8293
48 Ga0105240_10057758 3300009093 Bacteria 4845
49 Ga0105240_10124766 3300009093 Bacteria 3096
50 Ga0105240_10695827 3300009093 Bacteria 1110
51 Ga0111539_10252587 3300009094 Bacteria 2053
52 Ga0105245_10209351 3300009098 Bacteria 1876
53 Ga0105245_10571218 3300009098 Bacteria 1154
54 Ga0105241_10015359 3300009174 Bacteria 5608
55 Ga0105248_10025939 3300009177 Bacteria 6518
56 Ga0105237_10208662 3300009545 Bacteria 1954
57 Ga0105237_10316768 3300009545 Bacteria 1563
58 Ga0105237_10326261 3300009545 Bacteria 1539
59 Ga0105238_10026170 3300009551 Bacteria 5945
60 Ga0105238_10066442 3300009551 Bacteria 3608
61 Ga0105238_10083356 3300009551 Bacteria 3186
62 Ga0105238_10233817 3300009551 Bacteria 1815
63 Ga0099796_10062968 3300010159 Bacteria 1320
64 Ga0105239_10011216 3300010375 Bacteria 10001
65 Ga0105239_11042406 3300010375 Bacteria 941
66 Ga0157370_10187652 3300013104 Bacteria 1919
67 Ga0157369_10021543 3300013105 Bacteria 7209
68 Ga0157369_10023673 3300013105 Bacteria 6840
69 Ga0157369_10028297 3300013105 Bacteria 6205
70 Ga0157369_10349747 3300013105 Bacteria 1535
71 Ga0171462_1004 3300013250 Bacteria 678877
72 Ga0157374_10418564 3300013296 Bacteria 1338
73 Ga0157372_10012081 3300013307 Bacteria 9199
74 Ga0157372_10086827 3300013307 Bacteria 3549
75 Ga0157372_10115264 3300013307 Bacteria 3081
76 Ga0163163_10253303 3300014325 Bacteria 1811
77 Ga0157379_10051262 3300014968 Bacteria 3686
78 Ga0163161_10091702 3300017792 Bacteria 2249
79 Ga0163161_10822458 3300017792 Bacteria 782
80 Ga0206356_11221166 3300020070 Bacteria 1220
81 Ga0206352_10166636 3300020078 Bacteria 1021
82 Ga0206354_11078640 3300020081 Bacteria 924
83 Ga0213873_10004958 3300021358 Bacteria 2519
84 Ga0213872_10193397 3300021361 Bacteria 875
85 Ga0213875_10034770 3300021388 Bacteria 2379
86 Ga0213871_10125922 3300021441 Bacteria 766
87 Ga0224712_10007156 3300022467 Bacteria 3230
88 Ga0207699_10357734 3300025906 Bacteria 1032
89 Ga0207699_10399857 3300025906 Bacteria 978
90 Ga0207684_10253501 3300025910 Bacteria 1518
91 Ga0207654_10017149 3300025911 Bacteria 3782
92 Ga0207707_10005763 3300025912 Bacteria 10830
93 Ga0207707_10100098 3300025912 Bacteria 2533
94 Ga0207695_10001998 3300025913 Bacteria 31500
95 Ga0207695_10009334 3300025913 Bacteria 12136
96 Ga0207671_10067018 3300025914 Bacteria 2673
97 Ga0207671_10305089 3300025914 Bacteria 1258
98 Ga0207693_10084925 3300025915 Bacteria 2480
99 Ga0207660_10278290 3300025917 Bacteria 1327
100 Ga0207652_10219512 3300025921 Bacteria 1713
101 Ga0207652_10238910 3300025921 Bacteria 1637
102 Ga0207646_10004860 3300025922 Bacteria 14396
103 Ga0207694_10000157 3300025924 Bacteria 70076
104 Ga0207694_10068151 3300025924 Bacteria 2778
105 Ga0207694_10068700 3300025924 Bacteria 2767
106 Ga0207700_10301575 3300025928 Bacteria 1384
107 Ga0207664_10000737 3300025929 Bacteria 22232
108 Ga0207664_10086649 3300025929 Bacteria 2559
109 Ga0207690_10164060 3300025932 Bacteria 1659
110 Ga0207706_10064402 3300025933 Bacteria 3227
111 Ga0207670_10227893 3300025936 Bacteria 1430
112 Ga0207665_10490477 3300025939 Bacteria 948
113 Ga0207665_10753503 3300025939 Bacteria 768
114 Ga0207711_10059553 3300025941 Bacteria 3288
115 Ga0207679_10037399 3300025945 Bacteria 3450
116 Ga0207667_10009414 3300025949 Bacteria 11508
117 Ga0207667_10011520 3300025949 Bacteria 10275
118 Ga0207667_10442617 3300025949 Bacteria 1321
119 Ga0207677_10557320 3300026023 Bacteria 1000
120 Ga0207703_10000737 3300026035 Bacteria 32201
121 Ga0207703_10350638 3300026035 Bacteria 1359
122 Ga0207703_11389087 3300026035 Bacteria 675
123 Ga0207639_10014940 3300026041 Bacteria 5470
124 Ga0207678_10311829 3300026067 Bacteria 1353
125 Ga0207702_10000002 3300026078 Bacteria 491507
126 Ga0207702_10057323 3300026078 Bacteria 3311
127 Ga0207702_10573827 3300026078 Bacteria 1105
128 Ga0207675_100000019 3300026118 Bacteria 122642
129 Ga0207698_10063363 3300026142 Bacteria 2893
130 Ga0207698_10109072 3300026142 Bacteria 2315
131 Ga0207698_10110392 3300026142 Bacteria 2304
132 Ga0207698_10520727 3300026142 Bacteria 1160
133 Ga0307517_10039490 3300028786 Bacteria 5181
134 Ga0265338_10161650 3300028800 Bacteria 1729
135 Ga0307511_10031383 3300030521 Bacteria 4748
136 Ga0265765_1018296 3300030879 Bacteria 832
137 Ga0265760_10076245 3300031090 Bacteria 1034
138 Ga0265328_10145845 3300031239 Bacteria 889
139 Ga0265339_10004753 3300031249 Bacteria 9207
140 Ga0265339_10067416 3300031249 Bacteria 1914
141 Ga0265327_10016605 3300031251 Bacteria 4664
142 Ga0307408_101087086 3300031548 Bacteria 741
143 Ga0307508_10011619 3300031616 Bacteria 8047
144 Ga0265314_10008536 3300031711 Bacteria 8758
145 Ga0265314_10128014 3300031711 Bacteria 1588
146 Ga0307409_100307394 3300031995 Bacteria 1478
147 Ga0373934_0064343 3300035086 Bacteria 1464
148 Ga0373923_0064313 3300035111 Bacteria 1564
149 Ga0373954_0081906 3300035118 Bacteria 1542
150 Ga0373955_0106772 3300035172 Bacteria 1614
151 Ga0373924_0235629 3300035410 Bacteria 809
152 Ga0373935_0205977 3300035692 Bacteria 1361
153 Ga0373933_0204374 3300035724 Bacteria 1264
154 Ga0373947_0535819 3300035725 Bacteria 797
155 Ga0373925_0196568 3300037068 Bacteria 1602
156 Ga0395899_0072708 3300037312 Bacteria 2516
157 Ga0436364_1400663 3300037853 Bacteria 3285
158 Ga0395901_0073703 3300038443 Bacteria 3561
159 Ga0395901_0788373 3300038443 Bacteria 940
160 Ga0436365_0670285 3300039437 Bacteria 836
161 Ga0436365_1063831 3300039437 Bacteria 1881
162 Ga0436360_0084123 3300039438 Bacteria 1018
163 Ga0436363_0083618 3300039450 Bacteria 929
164 Ga0451835_1085803 3300041492 Bacteria 3315
165 Ga0451839_0090435 3300041496 Bacteria 968
166 Ga0451849_0079886 3300041505 Bacteria 2637
167 Ga0451843_0616296 3300041509 Bacteria 1264
168 Ga0451855_1598589 3300041511 Bacteria 1807
169 Ga0466965_0025688 3300044683 Bacteria 2852
170 Ga0466968_0018501 3300044735 Bacteria 2795
171 Ga0466968_0080652 3300044735 Bacteria 1429
172 Ga0466970_0142324 3300044765 Bacteria 1321
173 Ga0466960_0047813 3300044901 Bacteria 2053
174 Ga0466960_0197319 3300044901 Bacteria 1098
175 Ga0466960_0287575 3300044901 Bacteria 923
176 Ga0466967_0004778 3300045976 Bacteria 9225
177 Ga0466967_0136745 3300045976 Bacteria 2279
178 Ga0495617_000785 3300046452 Bacteria 15390
179 Ga0495638_0001285 3300046460 Bacteria 23401
180 Ga0495650_0079681 3300046471 Bacteria 1266
181 Ga0495580_0253219 3300046472 Bacteria 1205
182 Ga0495664_0224032 3300046477 Bacteria 1138
183 Ga0495585_0000063 3300046492 Bacteria 109530
184 Ga0495594_0398663 3300046499 Bacteria 783
185 Ga0495607_0000029 3300046501 Bacteria 155005
186 Ga0495583_0027370 3300046506 Bacteria 2813
187 Ga0495583_0148551 3300046506 Bacteria 972
188 Ga0495606_0254004 3300046507 Bacteria 974
189 Ga0495608_0257875 3300046511 Bacteria 1086
190 Ga0495616_0050414 3300046513 Bacteria 2081
191 Ga0495616_0179253 3300046513 Bacteria 942
192 Ga0495620_0159165 3300046515 Bacteria 878
193 Ga0495631_0002304 3300046518 Bacteria 10891
194 Ga0495637_0011110 3300046520 Bacteria 4335
195 Ga0495640_0078320 3300046533 Bacteria 2202
196 Ga0495587_0322848 3300046536 Bacteria 862
197 Ga0495609_0055386 3300046538 Bacteria 1759
198 Ga0495611_0000003 3300046648 Bacteria 395679
199 Ga0495625_0000019 3300046660 Bacteria 298330
200 Ga0495661_0000703 3300046665 Bacteria 33156
201 Ga0495670_0004940 3300046691 Bacteria 6549
202 Ga0495671_0000549 3300046692 Bacteria 28132
203 Ga0495671_0027578 3300046692 Bacteria 2932
204 Ga0495589_0000018 3300046794 Bacteria 204851
205 Ga0495589_0209415 3300046794 Bacteria 918
206 Ga0495660_0000122 3300046810 Bacteria 85116
207 Ga0495680_0123022 3300047322 Bacteria 1914
208 Ga0495679_000017 3300047446 Bacteria 263230
209 Ga0495673_0004051 3300047469 Bacteria 9338
210 Ga0495686_0050315 3300047472 Bacteria 2619
211 Ga0495602_0280410 3300048088 Bacteria 1228
212 Ga0495614_0202319 3300048089 Bacteria 899
213 Ga0496100_0000324 3300048903 Bacteria 23608
214 Ga0496100_0029409 3300048903 Bacteria 3398
215 Ga0496100_0201096 3300048903 Bacteria 1452
216 Ga0496101_0001179 3300048904 Bacteria 15667
217 Ga0496101_0096416 3300048904 Bacteria 2207
218 Ga0496101_0296359 3300048904 Bacteria 1266
219 Ga0496102_0012797 3300048905 Bacteria 7264
220 Ga0496102_0015042 3300048905 Bacteria 6735
221 Ga0496102_0202002 3300048905 Bacteria 1874
222 Ga0496104_0004300 3300048907 Bacteria 12380
223 Ga0496104_0118634 3300048907 Bacteria 2540
224 Ga0496105_0063215 3300048908 Bacteria 3054
225 Ga0496105_0064430 3300048908 Bacteria 3024
226 Ga0496106_0040064 3300048909 Bacteria 3507
227 Ga0496106_0314966 3300048909 Bacteria 1256
228 Ga0496107_0059655 3300048910 Bacteria 2761
229 Ga0496109_0180108 3300048912 Bacteria 1984
230 Ga0496110_0073199 3300048913 Bacteria 3041
231 Ga0496110_0400241 3300048913 Bacteria 1252
232 Ga0496111_0044735 3300048914 Bacteria 3183
233 Ga0496112_0810685 3300048915 Bacteria 861
234 Ga0496114_0096708 3300048917 Bacteria 2514
235 Ga0496114_0202905 3300048917 Bacteria 1737
236 Ga0496115_0047569 3300048918 Bacteria 3431
237 Ga0496115_0158449 3300048918 Bacteria 1870
238 Ga0496115_0421182 3300048918 Bacteria 1082
239 Ga0496116_0008351 3300048919 Bacteria 8997
240 Ga0496117_0000035 3300048920 Bacteria 326449
241 Ga0496117_0037920 3300048920 Bacteria 3583
242 Ga0496118_0000054 3300048921 Bacteria 233617
243 Ga0496118_0000423 3300048921 Bacteria 70256
244 Ga0496118_0155312 3300048921 Bacteria 1425
245 Ga0496119_0005770 3300048922 Bacteria 11726
246 Ga0496120_0007388 3300048923 Bacteria 8187
247 Ga0496124_0120737 3300048927 Bacteria 2095
248 Ga0496125_0046520 3300048928 Bacteria 3639
249 Ga0496126_0034701 3300048929 Bacteria 4735
250 Ga0496126_0063283 3300048929 Bacteria 3316
251 Ga0495678_000210 3300049459 Bacteria 68186
252 Ga0495682_0004086 3300049460 Bacteria 6342
253 Ga0495682_0057728 3300049460 Bacteria 1404
254 Ga0501031_0007813 3300049568 Bacteria 6962
255 Ga0501032_0000767 3300049569 Bacteria 26035
256 Ga0501033_0035725 3300049570 Bacteria 3725
257 Ga0501033_0211001 3300049570 Bacteria 1385
258 Ga0501034_0054740 3300049571 Bacteria 4016
259 Ga0501036_0007805 3300049572 Bacteria 8750
260 Ga0501037_0003426 3300049573 Bacteria 11526
261 Ga0501037_0077229 3300049573 Bacteria 2417
262 Ga0501038_0037231 3300049574 Bacteria 4266
263 Ga0501038_0258281 3300049574 Bacteria 1378
264 Ga0501038_0480890 3300049574 Bacteria 952
265 Ga0501039_0052551 3300049575 Bacteria 3152
266 Ga0501043_0002085 3300049579 Bacteria 17072
267 Ga0501046_0003083 3300049580 Bacteria 15390
268 Ga0501047_0026148 3300049581 Bacteria 5614
269 Ga0501047_0141046 3300049581 Bacteria 2288
270 Ga0501048_0217959 3300049582 Bacteria 1353
271 Ga0501067_0000653 3300049583 Bacteria 18676
272 Ga0501067_0008290 3300049583 Bacteria 5770
273 Ga0501068_0007420 3300049584 Bacteria 6071
274 Ga0501069_0006325 3300049585 Bacteria 6191
275 Ga0501069_0372167 3300049585 Bacteria 843
276 Ga0501070_0004405 3300049586 Bacteria 12086
277 Ga0501070_0034537 3300049586 Bacteria 4227
278 Ga0501070_0235296 3300049586 Bacteria 1500
279 Ga0501072_0001615 3300049588 Bacteria 16849
280 Ga0501073_0001950 3300049589 Bacteria 15373
281 Ga0501074_0060812 3300049590 Bacteria 2721
282 Ga0501076_0140471 3300049592 Bacteria 1962
283 Ga0501077_0003301 3300049593 Bacteria 9710
284 Ga0501079_0011766 3300049741 Bacteria 6683
285 Ga0501080_0000291 3300049742 Bacteria 38072
286 Ga0501083_0034357 3300049744 Bacteria 3467
287 Ga0501035_0064008 3300049822 Bacteria 3269
288 Ga0501035_0107786 3300049822 Bacteria 2442
289 Ga0501044_0032490 3300049823 Bacteria 5486
290 Ga0501044_0100032 3300049823 Bacteria 2918
291 Ga0501044_0168563 3300049823 Bacteria 2162
292 Ga0501044_0551124 3300049823 Bacteria 1050
293 Ga0501045_0449881 3300049824 Bacteria 957
294 nmdc:mga05p37_686342_c1 3300050507 Bacteria 1140
295 nmdc:mga06r32_599_c1 3300050510 Bacteria 31400
296 nmdc:mga0n895_45041_c1 3300050512 Bacteria 4304
297 nmdc:mga0rr50_13931_c1 3300050513 Bacteria 5254
298 nmdc:mga08x19_589134_c1 3300050514 Bacteria 788
299 nmdc:mga08x19_9922_c1 3300050514 Bacteria 5706
300 nmdc:mga0a205_380674_c1 3300050515 Bacteria 1276
301 Ga0495601_0301078 3300053077 Bacteria 1044
302 Ga0495595_0093142 3300053084 Bacteria 1447
303 Ga0500643_000029 3300053087 Bacteria 211149
304 Ga0500643_002857 3300053087 Bacteria 8606
305 Ga0500555_000067 3300053103 Bacteria 52543
306 Ga0500564_212070 3300053138 Bacteria 789
307 Ga0501084_0002646 3300054114 Bacteria 14436
308 Ga0501082_0068063 3300060353 Bacteria 3066

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_589134_c1 nmdc:mga08x19_589134_c1_217_738 165
2 3300005535 Ga0070684_100039454 Ga0070684_1000394547 177
3 3300006852 Ga0075433_10841565 Ga0075433_108415652 177
4 3300006871 Ga0075434_100008352 Ga0075434_10000835210 177
5 3300006914 Ga0075436_100020333 Ga0075436_1000203336 177
6 3300007076 Ga0075435_100004144 Ga0075435_10000414410 177
7 3300025914 Ga0207671_10305089 Ga0207671_103050892 177
8 3300025932 Ga0207690_10164060 Ga0207690_101640601 177
9 3300025945 Ga0207679_10037399 Ga0207679_100373994 177
10 3300039450 Ga0436363_0083618 Ga0436363_0083618_93_701 182
11 3300005544 Ga0070686_100126985 Ga0070686_1001269855 184
12 3300009098 Ga0105245_10209351 Ga0105245_102093512 184
13 3300009545 Ga0105237_10316768 Ga0105237_103167682 184
14 3300009551 Ga0105238_10026170 Ga0105238_100261706 184
15 3300013105 Ga0157369_10023673 Ga0157369_100236735 184
16 3300020081 Ga0206354_11078640 Ga0206354_110786401 184
17 3300026078 Ga0207702_10573827 Ga0207702_105738271 184
18 3300041496 Ga0451839_0090435 Ga0451839_0090435_339_944 184
19 3300044901 Ga0466960_0287575 Ga0466960_0287575_155_757 184
20 3300048903 Ga0496100_0029409 Ga0496100_0029409_1603_2214 184
21 3300048904 Ga0496101_0096416 Ga0496101_0096416_599_1210 184
22 3300048905 Ga0496102_0015042 Ga0496102_0015042_5538_6149 184
23 3300048907 Ga0496104_0118634 Ga0496104_0118634_1153_1764 184
24 3300048908 Ga0496105_0063215 Ga0496105_0063215_824_1435 184
25 3300048909 Ga0496106_0040064 Ga0496106_0040064_2129_2740 184
26 3300048910 Ga0496107_0059655 Ga0496107_0059655_381_992 184
27 3300048917 Ga0496114_0096708 Ga0496114_0096708_663_1274 184
28 3300048917 Ga0496114_0202905 Ga0496114_0202905_28_720 184
29 3300048918 Ga0496115_0158449 Ga0496115_0158449_568_1179 184
30 3300049583 Ga0501067_0008290 Ga0501067_0008290_2750_3364 184
31 3300049585 Ga0501069_0372167 Ga0501069_0372167_44_658 184
32 3300050512 nmdc:mga0n895_45041_c1 nmdc:mga0n895_45041_c1_1026_1640 184
33 3300050513 nmdc:mga0rr50_13931_c1 nmdc:mga0rr50_13931_c1_2000_2614 184
34 3300050514 nmdc:mga08x19_9922_c1 nmdc:mga08x19_9922_c1_2207_2821 184
35 3300050515 nmdc:mga0a205_380674_c1 nmdc:mga0a205_380674_c1_371_985 184
36 3300010159 Ga0099796_10062968 Ga0099796_100629681 185
37 3300005545 Ga0070695_100208038 Ga0070695_1002080382 187
38 3300005563 Ga0068855_100108954 Ga0068855_1001089544 187
39 3300006028 Ga0070717_10074535 Ga0070717_100745352 187
40 3300020070 Ga0206356_11221166 Ga0206356_112211662 187
41 3300022467 Ga0224712_10007156 Ga0224712_100071563 187
42 3300025917 Ga0207660_10278290 Ga0207660_102782902 187
43 3300025929 Ga0207664_10086649 Ga0207664_100866493 187
44 3300025949 Ga0207667_10442617 Ga0207667_104426172 187
45 3300035410 Ga0373924_0235629 Ga0373924_0235629_12_635 187
46 3300046533 Ga0495640_0078320 Ga0495640_0078320_1191_1814 187
47 3300026067 Ga0207678_10311829 Ga0207678_103118292 188
48 3300005336 Ga0070680_100014676 Ga0070680_1000146763 189
49 3300005338 Ga0068868_100127284 Ga0068868_1001272841 189
50 3300005458 Ga0070681_10022680 Ga0070681_100226808 189
51 3300009093 Ga0105240_10124766 Ga0105240_101247663 189
52 3300028786 Ga0307517_10039490 Ga0307517_100394903 189
53 3300038443 Ga0395901_0788373 Ga0395901_0788373_134_712 189
54 3300044735 Ga0466968_0080652 Ga0466968_0080652_682_1269 189
55 3300045976 Ga0466967_0004778 Ga0466967_0004778_45_626 189
56 3300045976 Ga0466967_0136745 Ga0466967_0136745_848_1441 189
57 3300047322 Ga0495680_0123022 Ga0495680_0123022_39_632 189
58 3300048905 Ga0496102_0202002 Ga0496102_0202002_1242_1835 189
59 3300048918 Ga0496115_0421182 Ga0496115_0421182_473_1066 189
60 3300039437 Ga0436365_0670285 Ga0436365_0670285_22_696 190
61 iso_pu_bacteria 2517287029 2517407072 191
62 iso_pu_bacteria 2818991435 2819540462 191
63 iso_pu_bacteria 2818991454 2819649422 191
64 3300050507 nmdc:mga05p37_686342_c1 nmdc:mga05p37_686342_c1_232_834 192
65 iso_pu_bacteria 2884338543 2884338895 192
66 iso_pu_bacteria 2885305155 2885310844 192
67 iso_pu_bacteria 2885326080 2885331077 192
68 iso_pu_bacteria 2965062239 2965069948 192
69 iso_pu_bacteria 2968128360 2968132983 192
70 iso_pu_bacteria 2811994872 2812324196 193
71 3300005436 Ga0070713_100313642 Ga0070713_1003136422 195
72 3300005440 Ga0070705_100085570 Ga0070705_1000855702 195
73 3300005445 Ga0070708_100246218 Ga0070708_1002462182 195
74 3300005455 Ga0070663_100354004 Ga0070663_1003540042 195
75 3300005458 Ga0070681_10233519 Ga0070681_102335192 195
76 3300005467 Ga0070706_100320935 Ga0070706_1003209352 195
77 3300005468 Ga0070707_100007568 Ga0070707_1000075682 195
78 3300005518 Ga0070699_100102317 Ga0070699_1001023174 195
79 3300005530 Ga0070679_100382248 Ga0070679_1003822481 195
80 3300005536 Ga0070697_100194190 Ga0070697_1001941902 195
81 3300005563 Ga0068855_100063026 Ga0068855_1000630263 195
82 3300005578 Ga0068854_100204514 Ga0068854_1002045143 195
83 3300005842 Ga0068858_100000092 Ga0068858_10000009256 195
84 3300005842 Ga0068858_100373347 Ga0068858_1003733472 195
85 3300006028 Ga0070717_10172218 Ga0070717_101722182 195
86 3300006173 Ga0070716_100726012 Ga0070716_1007260121 195
87 3300006175 Ga0070712_100094297 Ga0070712_1000942971 195
88 3300009093 Ga0105240_10022811 Ga0105240_100228112 195
89 3300009093 Ga0105240_10695827 Ga0105240_106958272 195
90 3300009098 Ga0105245_10571218 Ga0105245_105712181 195
91 3300009177 Ga0105248_10025939 Ga0105248_100259392 195
92 3300009551 Ga0105238_10066442 Ga0105238_100664423 195
93 3300009551 Ga0105238_10233817 Ga0105238_102338174 195
94 3300010375 Ga0105239_11042406 Ga0105239_110424062 195
95 3300013105 Ga0157369_10028297 Ga0157369_100282976 195
96 3300013296 Ga0157374_10418564 Ga0157374_104185641 195
97 3300014325 Ga0163163_10253303 Ga0163163_102533032 195
98 3300014968 Ga0157379_10051262 Ga0157379_100512625 195
99 3300017792 Ga0163161_10091702 Ga0163161_100917023 195
100 3300021361 Ga0213872_10193397 Ga0213872_101933971 195
101 3300021388 Ga0213875_10034770 Ga0213875_100347702 195
102 3300025906 Ga0207699_10357734 Ga0207699_103577342 195
103 3300025910 Ga0207684_10253501 Ga0207684_102535011 195
104 3300025912 Ga0207707_10005763 Ga0207707_100057637 195
105 3300025915 Ga0207693_10084925 Ga0207693_100849252 195
106 3300025921 Ga0207652_10219512 Ga0207652_102195122 195
107 3300025922 Ga0207646_10004860 Ga0207646_100048608 195
108 3300025924 Ga0207694_10068151 Ga0207694_100681513 195
109 3300025924 Ga0207694_10068700 Ga0207694_100687002 195
110 3300025928 Ga0207700_10301575 Ga0207700_103015751 195
111 3300025936 Ga0207670_10227893 Ga0207670_102278932 195
112 3300025939 Ga0207665_10490477 Ga0207665_104904772 195
113 3300025941 Ga0207711_10059553 Ga0207711_100595534 195
114 3300025949 Ga0207667_10009414 Ga0207667_1000941410 195
115 3300026035 Ga0207703_10000737 Ga0207703_1000073721 195
116 3300026035 Ga0207703_10350638 Ga0207703_103506382 195
117 3300026035 Ga0207703_11389087 Ga0207703_113890871 195
118 3300026142 Ga0207698_10110392 Ga0207698_101103923 195
119 3300026142 Ga0207698_10520727 Ga0207698_105207271 195
120 3300028800 Ga0265338_10161650 Ga0265338_101616501 195
121 3300030521 Ga0307511_10031383 Ga0307511_100313834 195
122 3300031090 Ga0265760_10076245 Ga0265760_100762451 195
123 3300031239 Ga0265328_10145845 Ga0265328_101458451 195
124 3300031249 Ga0265339_10004753 Ga0265339_100047536 195
125 3300031249 Ga0265339_10067416 Ga0265339_100674161 195
126 3300031251 Ga0265327_10016605 Ga0265327_100166053 195
127 3300031616 Ga0307508_10011619 Ga0307508_100116196 195
128 3300031711 Ga0265314_10008536 Ga0265314_100085366 195
129 3300031711 Ga0265314_10128014 Ga0265314_101280142 195
130 3300035725 Ga0373947_0535819 Ga0373947_0535819_33_674 195
131 3300037312 Ga0395899_0072708 Ga0395899_0072708_490_1131 195
132 3300037853 Ga0436364_1400663 Ga0436364_1400663_2327_2971 195
133 3300038443 Ga0395901_0073703 Ga0395901_0073703_225_866 195
134 3300039437 Ga0436365_1063831 Ga0436365_1063831_801_1433 195
135 3300039438 Ga0436360_0084123 Ga0436360_0084123_316_957 195
136 3300041492 Ga0451835_1085803 Ga0451835_1085803_21_662 195
137 3300041505 Ga0451849_0079886 Ga0451849_0079886_427_1068 195
138 3300041509 Ga0451843_0616296 Ga0451843_0616296_363_1004 195
139 3300041511 Ga0451855_1598589 Ga0451855_1598589_787_1428 195
140 3300046452 Ga0495617_000785 Ga0495617_000785_7869_8501 195
141 3300046460 Ga0495638_0001285 Ga0495638_0001285_15378_16010 195
142 3300046471 Ga0495650_0079681 Ga0495650_0079681_470_1111 195
143 3300046492 Ga0495585_0000063 Ga0495585_0000063_87955_88587 195
144 3300046501 Ga0495607_0000029 Ga0495607_0000029_37890_38522 195
145 3300046506 Ga0495583_0027370 Ga0495583_0027370_1917_2549 195
146 3300046507 Ga0495606_0254004 Ga0495606_0254004_190_831 195
147 3300046513 Ga0495616_0050414 Ga0495616_0050414_1278_1910 195
148 3300046513 Ga0495616_0179253 Ga0495616_0179253_172_804 195
149 3300046518 Ga0495631_0002304 Ga0495631_0002304_9964_10596 195
150 3300046520 Ga0495637_0011110 Ga0495637_0011110_3636_4268 195
151 3300046538 Ga0495609_0055386 Ga0495609_0055386_60_692 195
152 3300046648 Ga0495611_0000003 Ga0495611_0000003_76753_77385 195
153 3300046660 Ga0495625_0000019 Ga0495625_0000019_229265_229897 195
154 3300046665 Ga0495661_0000703 Ga0495661_0000703_20995_21627 195
155 3300046691 Ga0495670_0004940 Ga0495670_0004940_5578_6210 195
156 3300046692 Ga0495671_0000549 Ga0495671_0000549_25059_25691 195
157 3300046794 Ga0495589_0000018 Ga0495589_0000018_166323_166955 195
158 3300046810 Ga0495660_0000122 Ga0495660_0000122_67226_67858 195
159 3300047446 Ga0495679_000017 Ga0495679_000017_185828_186460 195
160 3300047469 Ga0495673_0004051 Ga0495673_0004051_2159_2791 195
161 3300048903 Ga0496100_0000324 Ga0496100_0000324_19473_20105 195
162 3300048903 Ga0496100_0201096 Ga0496100_0201096_496_1137 195
163 3300048904 Ga0496101_0001179 Ga0496101_0001179_11461_12093 195
164 3300048904 Ga0496101_0296359 Ga0496101_0296359_26_667 195
165 3300048905 Ga0496102_0012797 Ga0496102_0012797_862_1494 195
166 3300048909 Ga0496106_0314966 Ga0496106_0314966_529_1170 195
167 3300048918 Ga0496115_0047569 Ga0496115_0047569_69_701 195
168 3300048919 Ga0496116_0008351 Ga0496116_0008351_3208_3840 195
169 3300048920 Ga0496117_0000035 Ga0496117_0000035_188472_189104 195
170 3300048921 Ga0496118_0000054 Ga0496118_0000054_33957_34589 195
171 3300048921 Ga0496118_0155312 Ga0496118_0155312_138_779 195
172 3300048922 Ga0496119_0005770 Ga0496119_0005770_434_1066 195
173 3300048923 Ga0496120_0007388 Ga0496120_0007388_5956_6588 195
174 3300048928 Ga0496125_0046520 Ga0496125_0046520_583_1215 195
175 3300048929 Ga0496126_0034701 Ga0496126_0034701_3801_4433 195
176 3300048929 Ga0496126_0063283 Ga0496126_0063283_303_935 195
177 3300049459 Ga0495678_000210 Ga0495678_000210_37900_38532 195
178 3300049460 Ga0495682_0057728 Ga0495682_0057728_227_859 195
179 3300049574 Ga0501038_0258281 Ga0501038_0258281_73_714 195
180 3300049581 Ga0501047_0141046 Ga0501047_0141046_1582_2223 195
181 3300049823 Ga0501044_0100032 Ga0501044_0100032_1748_2398 195
182 3300049823 Ga0501044_0551124 Ga0501044_0551124_34_675 195
183 3300053087 Ga0500643_000029 Ga0500643_000029_76676_77308 195
184 3300053103 Ga0500555_000067 Ga0500555_000067_26376_27008 195
185 3300053138 Ga0500564_212070 Ga0500564_212070_101_733 195
186 3300005344 Ga0070661_100232235 Ga0070661_1002322353 196
187 3300005435 Ga0070714_100007408 Ga0070714_1000074089 196
188 3300005436 Ga0070713_100065490 Ga0070713_1000654901 196
189 3300005436 Ga0070713_100343662 Ga0070713_1003436622 196
190 3300005437 Ga0070710_10399694 Ga0070710_103996941 196
191 3300005468 Ga0070707_100633006 Ga0070707_1006330061 196
192 3300005539 Ga0068853_100005841 Ga0068853_1000058414 196
193 3300005578 Ga0068854_100028297 Ga0068854_1000282973 196
194 3300005614 Ga0068856_100038601 Ga0068856_1000386016 196
195 3300005719 Ga0068861_100000375 Ga0068861_1000003752 196
196 3300006028 Ga0070717_10026242 Ga0070717_100262422 196
197 3300006028 Ga0070717_10095322 Ga0070717_100953222 196
198 3300009093 Ga0105240_10057758 Ga0105240_100577587 196
199 3300009174 Ga0105241_10015359 Ga0105241_100153595 196
200 3300009545 Ga0105237_10208662 Ga0105237_102086623 196
201 3300009545 Ga0105237_10326261 Ga0105237_103262612 196
202 3300009551 Ga0105238_10083356 Ga0105238_100833563 196
203 3300010375 Ga0105239_10011216 Ga0105239_100112163 196
204 3300013104 Ga0157370_10187652 Ga0157370_101876523 196
205 3300013105 Ga0157369_10021543 Ga0157369_100215437 196
206 3300013105 Ga0157369_10349747 Ga0157369_103497472 196
207 3300013307 Ga0157372_10012081 Ga0157372_100120812 196
208 3300013307 Ga0157372_10086827 Ga0157372_100868274 196
209 3300013307 Ga0157372_10115264 Ga0157372_101152642 196
210 3300020078 Ga0206352_10166636 Ga0206352_101666362 196
211 3300021358 Ga0213873_10004958 Ga0213873_100049582 196
212 3300021441 Ga0213871_10125922 Ga0213871_101259221 196
213 3300025906 Ga0207699_10399857 Ga0207699_103998571 196
214 3300025911 Ga0207654_10017149 Ga0207654_100171492 196
215 3300025912 Ga0207707_10100098 Ga0207707_101000982 196
216 3300025913 Ga0207695_10001998 Ga0207695_1000199818 196
217 3300025913 Ga0207695_10009334 Ga0207695_100093343 196
218 3300025914 Ga0207671_10067018 Ga0207671_100670184 196
219 3300025924 Ga0207694_10000157 Ga0207694_1000015715 196
220 3300025929 Ga0207664_10000737 Ga0207664_1000073716 196
221 3300025939 Ga0207665_10753503 Ga0207665_107535031 196
222 3300025949 Ga0207667_10011520 Ga0207667_100115203 196
223 3300026023 Ga0207677_10557320 Ga0207677_105573202 196
224 3300026041 Ga0207639_10014940 Ga0207639_100149401 196
225 3300026078 Ga0207702_10000002 Ga0207702_10000002271 196
226 3300026118 Ga0207675_100000019 Ga0207675_10000001976 196
227 3300026142 Ga0207698_10063363 Ga0207698_100633632 196
228 3300026142 Ga0207698_10109072 Ga0207698_101090722 196
229 3300030879 Ga0265765_1018296 Ga0265765_10182961 196
230 3300035086 Ga0373934_0064343 Ga0373934_0064343_23_679 196
231 3300035111 Ga0373923_0064313 Ga0373923_0064313_812_1492 196
232 3300035118 Ga0373954_0081906 Ga0373954_0081906_266_922 196
233 3300035172 Ga0373955_0106772 Ga0373955_0106772_299_955 196
234 3300035692 Ga0373935_0205977 Ga0373935_0205977_497_1153 196
235 3300035724 Ga0373933_0204374 Ga0373933_0204374_318_974 196
236 3300037068 Ga0373925_0196568 Ga0373925_0196568_97_753 196
237 3300044901 Ga0466960_0197319 Ga0466960_0197319_96_719 196
238 3300046472 Ga0495580_0253219 Ga0495580_0253219_288_968 196
239 3300046477 Ga0495664_0224032 Ga0495664_0224032_201_881 196
240 3300046506 Ga0495583_0148551 Ga0495583_0148551_222_869 196
241 3300046511 Ga0495608_0257875 Ga0495608_0257875_176_832 196
242 3300046515 Ga0495620_0159165 Ga0495620_0159165_80_703 196
243 3300046536 Ga0495587_0322848 Ga0495587_0322848_108_764 196
244 3300046692 Ga0495671_0027578 Ga0495671_0027578_857_1504 196
245 3300046794 Ga0495589_0209415 Ga0495589_0209415_59_706 196
246 3300047472 Ga0495686_0050315 Ga0495686_0050315_1099_1746 196
247 3300048088 Ga0495602_0280410 Ga0495602_0280410_560_1216 196
248 3300048089 Ga0495614_0202319 Ga0495614_0202319_34_690 196
249 3300048907 Ga0496104_0004300 Ga0496104_0004300_3583_4263 196
250 3300048908 Ga0496105_0064430 Ga0496105_0064430_546_1226 196
251 3300048912 Ga0496109_0180108 Ga0496109_0180108_396_1043 196
252 3300048913 Ga0496110_0073199 Ga0496110_0073199_16_696 196
253 3300048913 Ga0496110_0400241 Ga0496110_0400241_194_808 196
254 3300048914 Ga0496111_0044735 Ga0496111_0044735_2100_2747 196
255 3300048915 Ga0496112_0810685 Ga0496112_0810685_226_840 196
256 3300048920 Ga0496117_0037920 Ga0496117_0037920_1150_1794 196
257 3300048921 Ga0496118_0000423 Ga0496118_0000423_9025_9669 196
258 3300049460 Ga0495682_0004086 Ga0495682_0004086_1634_2281 196
259 3300049570 Ga0501033_0211001 Ga0501033_0211001_206_853 196
260 3300049573 Ga0501037_0077229 Ga0501037_0077229_604_1251 196
261 3300049574 Ga0501038_0480890 Ga0501038_0480890_41_688 196
262 3300049586 Ga0501070_0235296 Ga0501070_0235296_763_1410 196
263 3300049822 Ga0501035_0107786 Ga0501035_0107786_643_1290 196
264 3300049823 Ga0501044_0168563 Ga0501044_0168563_237_884 196
265 3300053077 Ga0495601_0301078 Ga0495601_0301078_57_713 196
266 3300053084 Ga0495595_0093142 Ga0495595_0093142_484_1140 196
267 3300053087 Ga0500643_002857 Ga0500643_002857_618_1268 196
268 3300005355 Ga0070671_100948516 Ga0070671_1009485161 197
269 3300005578 Ga0068854_100479966 Ga0068854_1004799662 197
270 3300006847 Ga0075431_100001598 Ga0075431_10000159827 197
271 3300009094 Ga0111539_10252587 Ga0111539_102525873 197
272 3300013250 Ga0171462_1004 Ga0171462_1004477 197
273 3300017792 Ga0163161_10822458 Ga0163161_108224581 197
274 3300025933 Ga0207706_10064402 Ga0207706_100644025 197
275 3300026078 Ga0207702_10057323 Ga0207702_100573231 197
276 3300044683 Ga0466965_0025688 Ga0466965_0025688_112_744 197
277 3300044735 Ga0466968_0018501 Ga0466968_0018501_1815_2447 197
278 3300044765 Ga0466970_0142324 Ga0466970_0142324_471_1103 197
279 3300044901 Ga0466960_0047813 Ga0466960_0047813_1382_2014 197
280 3300048927 Ga0496124_0120737 Ga0496124_0120737_358_981 197
281 3300049568 Ga0501031_0007813 Ga0501031_0007813_4806_5486 197
282 3300049569 Ga0501032_0000767 Ga0501032_0000767_20260_20940 197
283 3300049570 Ga0501033_0035725 Ga0501033_0035725_1628_2308 197
284 3300049571 Ga0501034_0054740 Ga0501034_0054740_2923_3603 197
285 3300049572 Ga0501036_0007805 Ga0501036_0007805_7657_8337 197
286 3300049573 Ga0501037_0003426 Ga0501037_0003426_8472_9152 197
287 3300049574 Ga0501038_0037231 Ga0501038_0037231_1240_1920 197
288 3300049575 Ga0501039_0052551 Ga0501039_0052551_541_1221 197
289 3300049579 Ga0501043_0002085 Ga0501043_0002085_15851_16531 197
290 3300049580 Ga0501046_0003083 Ga0501046_0003083_5707_6387 197
291 3300049581 Ga0501047_0026148 Ga0501047_0026148_1973_2653 197
292 3300049582 Ga0501048_0217959 Ga0501048_0217959_512_1192 197
293 3300049583 Ga0501067_0000653 Ga0501067_0000653_4103_4783 197
294 3300049584 Ga0501068_0007420 Ga0501068_0007420_2125_2805 197
295 3300049585 Ga0501069_0006325 Ga0501069_0006325_5462_6142 197
296 3300049586 Ga0501070_0004405 Ga0501070_0004405_1956_2579 197
297 3300049586 Ga0501070_0034537 Ga0501070_0034537_945_1625 197
298 3300049588 Ga0501072_0001615 Ga0501072_0001615_2374_3054 197
299 3300049589 Ga0501073_0001950 Ga0501073_0001950_14263_14943 197
300 3300049590 Ga0501074_0060812 Ga0501074_0060812_1628_2308 197
301 3300049592 Ga0501076_0140471 Ga0501076_0140471_1174_1854 197
302 3300049593 Ga0501077_0003301 Ga0501077_0003301_1012_1692 197
303 3300049741 Ga0501079_0011766 Ga0501079_0011766_4466_5146 197
304 3300049742 Ga0501080_0000291 Ga0501080_0000291_11123_11803 197
305 3300049744 Ga0501083_0034357 Ga0501083_0034357_2374_3054 197
306 3300049822 Ga0501035_0064008 Ga0501035_0064008_1172_1852 197
307 3300049823 Ga0501044_0032490 Ga0501044_0032490_1973_2653 197
308 3300049824 Ga0501045_0449881 Ga0501045_0449881_267_947 197
309 3300050510 nmdc:mga06r32_599_c1 nmdc:mga06r32_599_c1_11265_11885 197
310 3300054114 Ga0501084_0002646 Ga0501084_0002646_5477_6157 197
311 3300060353 Ga0501082_0068063 Ga0501082_0068063_1973_2653 197
312 3300005530 Ga0070679_100132649 Ga0070679_1001326494 198
313 3300025921 Ga0207652_10238910 Ga0207652_102389101 198
314 3300046499 Ga0495594_0398663 Ga0495594_0398663_71_667 198
315 3300005331 Ga0070670_100691558 Ga0070670_1006915581 199
316 3300031548 Ga0307408_101087086 Ga0307408_1010870861 199
317 3300031995 Ga0307409_100307394 Ga0307409_1003073942 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

40

243

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8499 1 198
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8418 1 198
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7817 2 197
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7775 2 197
2jyb-assembly1.cif.gz_A binary hvdhfr1:folate complex 0.7665 3 195
ID Description Score Start End Superfamily
af_P0AFV2_139_215_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8729 176 199 3.30.70.260
af_Q19962_62_333_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8615 178 195 1.10.510.10
af_P90895_1_189_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.7797 176 197 3.90.1520.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7721 2 197 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7519 2 197 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A535DTC7-F1-model_v4 Dihydrofolate reductase 0.9892 63 197 GO:0008703
GO:0009231
AF-A0A535MPM6-F1-model_v4 Dihydrofolate reductase 0.9882 76 196 GO:0008703
GO:0009231
AF-A0A2W2E8C6-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9827 90 196 GO:0008703
GO:0009231
AF-A0A1H7GZJ2-F1-model_v4 Dihydrofolate reductase 0.9824 89 196 GO:0008703
GO:0009231
AF-A0A853AW15-F1-model_v4 Dihydrofolate reductase 0.9799 1 197 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
92.48 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map