F404108

General Info

Members Datasets Scaffolds Average Seq Length
317 160 634 365

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100047750|Ga0075434_1000477503
Length 427
Sequence LESLVLQPYGMSRNPKPETLNPEPLFLMIRYPAFDPPEYVDWKPDHDLVEQFARTSESNPARAAVVRALDATQLLRLYEGLIRNRLHDIALKRWVKQGVISKAWLGLGEEAATIGPVHALDQSIASEGMPSDMVAPMIRNAGACHEMGMSIADMLRGYLGTADSPTHGRDLHIGDFKRGVLAPISHVGDIMAVTAGVAMSFKLRGERRVALTWIGDGSTKSGVFHESLNLAAVQRLPMIVIIQDNKVALGTRLDQHHRGSFLEWPAAYGIEGAAFDGNNVLDAYAATKLAANACREGRGPVLLIADTFRMGGHATHDEREARATFDKTLFEYWGKRDPIGLFETYLIDGTMDLESGRRVKRSDALRERNAXXXXRVESQVIEEIDRAAEEALASSRNNMPEPHSAADGVYAEAEAALEEAVAVNAVS

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 0.32
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100047750 3300006871 Bacteria 4247
2 MBSR1b_contig_2875387 2162886012 Bacteria 1801
3 Ga0065712_10083024 3300005290 Bacteria 2858
4 Ga0065707_10125987 3300005295 Bacteria 2012
5 Ga0070690_100012818 3300005330 Bacteria 4939
6 Ga0068869_100010096 3300005334 Bacteria 6143
7 Ga0070680_100006686 3300005336 Bacteria 8778
8 Ga0070687_100008110 3300005343 Bacteria 4426
9 Ga0070692_10002215 3300005345 Bacteria 7453
10 Ga0070692_10002508 3300005345 Bacteria 7148
11 Ga0070668_100019346 3300005347 Bacteria 5125
12 Ga0070667_100018903 3300005367 Bacteria 5713
13 Ga0070703_10000421 3300005406 Bacteria 17478
14 Ga0070703_10000907 3300005406 Bacteria 9444
15 Ga0070703_10006974 3300005406 Bacteria 3166
16 Ga0070703_10025738 3300005406 Bacteria 1747
17 Ga0070709_10000075 3300005434 Bacteria 75453
18 Ga0070709_10004176 3300005434 Bacteria 7786
19 Ga0070713_100010711 3300005436 Bacteria 6638
20 Ga0070701_10027380 3300005438 Bacteria 2791
21 Ga0070711_100000053 3300005439 Bacteria 72426
22 Ga0070705_100000377 3300005440 Bacteria 26007
23 Ga0070705_100000389 3300005440 Bacteria 25565
24 Ga0070705_100003755 3300005440 Bacteria 7435
25 Ga0070705_100013093 3300005440 Bacteria 4234
26 Ga0070705_100017543 3300005440 Bacteria 3738
27 Ga0070700_100072508 3300005441 Bacteria 2202
28 Ga0070700_100141400 3300005441 Bacteria 1636
29 Ga0070694_100001254 3300005444 Bacteria 14730
30 Ga0070694_100018374 3300005444 Bacteria 4437
31 Ga0070694_100020265 3300005444 Bacteria 4237
32 Ga0070694_100032514 3300005444 Bacteria 3426
33 Ga0070694_100056381 3300005444 Bacteria 2668
34 Ga0070694_100058313 3300005444 Bacteria 2626
35 Ga0070694_100135746 3300005444 Bacteria 1782
36 Ga0070694_100157345 3300005444 Bacteria 1664
37 Ga0070708_100002340 3300005445 Bacteria 14669
38 Ga0070708_100009117 3300005445 Bacteria 8002
39 Ga0070708_100018191 3300005445 Bacteria 5879
40 Ga0070708_100033696 3300005445 Bacteria 4450
41 Ga0070708_100195313 3300005445 Bacteria 1893
42 Ga0070663_100044552 3300005455 Unclassified 3129
43 Ga0070678_100000833 3300005456 Bacteria 15638
44 Ga0070662_100001212 3300005457 Bacteria 15827
45 Ga0068867_100018223 3300005459 Unclassified 4989
46 Ga0070685_10008001 3300005466 Bacteria 5420
47 Ga0070706_100000070 3300005467 Bacteria 118491
48 Ga0070706_100019796 3300005467 Bacteria 6206
49 Ga0070706_100033467 3300005467 Bacteria 4744
50 Ga0070707_100020274 3300005468 Bacteria 6269
51 Ga0070707_100064180 3300005468 Unclassified 3526
52 Ga0070698_100001087 3300005471 Bacteria 29880
53 Ga0070698_100029468 3300005471 Bacteria 5698
54 Ga0070698_100105543 3300005471 Bacteria 2787
55 Ga0070698_100257665 3300005471 Bacteria 1677
56 Ga0070699_100000174 3300005518 Bacteria 61931
57 Ga0070699_100002475 3300005518 Bacteria 16606
58 Ga0070699_100010283 3300005518 Bacteria 8090
59 Ga0070699_100029183 3300005518 Bacteria 4756
60 Ga0070699_100032241 3300005518 Bacteria 4523
61 Ga0070699_100039184 3300005518 Unclassified 4103
62 Ga0070699_100050153 3300005518 Bacteria 3613
63 Ga0070699_100207841 3300005518 Bacteria 1742
64 Ga0070684_100094883 3300005535 Bacteria 2658
65 Ga0070697_100000027 3300005536 Bacteria 126031
66 Ga0070697_100000853 3300005536 Bacteria 22926
67 Ga0070697_100013017 3300005536 Bacteria 6521
68 Ga0070697_100014337 3300005536 Bacteria 6227
69 Ga0070697_100172273 3300005536 Bacteria 1832
70 Ga0070697_100312035 3300005536 Bacteria 1353
71 Ga0070686_100000019 3300005544 Bacteria 139615
72 Ga0070695_100001622 3300005545 Bacteria 12617
73 Ga0070695_100005484 3300005545 Bacteria 7470
74 Ga0070695_100009709 3300005545 Bacteria 5732
75 Ga0070695_100023565 3300005545 Bacteria 3785
76 Ga0070695_100044765 3300005545 Bacteria 2819
77 Ga0070696_100001314 3300005546 Bacteria 16221
78 Ga0070696_100003339 3300005546 Bacteria 10723
79 Ga0070696_100003852 3300005546 Bacteria 10019
80 Ga0070696_100004117 3300005546 Bacteria 9695
81 Ga0070696_100017099 3300005546 Bacteria 4895
82 Ga0070696_100031164 3300005546 Bacteria 3653
83 Ga0070696_100040256 3300005546 Bacteria 3227
84 Ga0070693_100036976 3300005547 Bacteria 2719
85 Ga0070704_100000438 3300005549 Bacteria 19523
86 Ga0070704_100004535 3300005549 Bacteria 8021
87 Ga0070704_100004986 3300005549 Bacteria 7712
88 Ga0070704_100007783 3300005549 Bacteria 6388
89 Ga0070704_100008188 3300005549 Bacteria 6256
90 Ga0070704_100048224 3300005549 Bacteria 2980
91 Ga0068854_100001077 3300005578 Bacteria 16432
92 Ga0068854_100083312 3300005578 Bacteria 2365
93 Ga0068864_100002885 3300005618 Bacteria 14201
94 Ga0068866_10000032 3300005718 Bacteria 56456
95 Ga0068870_10026839 3300005840 Bacteria 2875
96 Ga0068858_100166052 3300005842 Bacteria 2080
97 Ga0068860_100011828 3300005843 Bacteria 8601
98 Ga0068862_100011097 3300005844 Bacteria 7441
99 Ga0070716_100000342 3300006173 Bacteria 18892
100 Ga0075428_100005870 3300006844 Bacteria 13641
101 Ga0075428_100017366 3300006844 Bacteria 7951
102 Ga0075428_100056980 3300006844 Unclassified 4279
103 Ga0075428_100225773 3300006844 Unclassified 2021
104 Ga0075428_100320851 3300006844 Bacteria 1665
105 Ga0075431_100008736 3300006847 Bacteria 10149
106 Ga0075431_100021575 3300006847 Bacteria 6587
107 Ga0075431_100071398 3300006847 Bacteria 3582
108 Ga0075431_100136542 3300006847 Bacteria 2528
109 Ga0075433_10000143 3300006852 Bacteria 37460
110 Ga0075433_10003168 3300006852 Bacteria 12676
111 Ga0075433_10025869 3300006852 Bacteria 4964
112 Ga0075433_10033404 3300006852 Unclassified 4411
113 Ga0075433_10056958 3300006852 Bacteria 3416
114 Ga0075433_10067683 3300006852 Bacteria 3134
115 Ga0075433_10112659 3300006852 Bacteria 2413
116 Ga0075433_10163479 3300006852 Bacteria 1981
117 Ga0075433_10246210 3300006852 Bacteria 1587
118 Ga0075434_100014476 3300006871 Bacteria 7539
119 Ga0075434_100023698 3300006871 Bacteria 5986
120 Ga0075434_100039755 3300006871 Bacteria 4659
121 Ga0075434_100042615 3300006871 Bacteria 4500
122 Ga0075434_100062761 3300006871 Bacteria 3699
123 Ga0075434_100078184 3300006871 Bacteria 3304
124 Ga0075434_100117068 3300006871 Bacteria 2678
125 Ga0075434_100122938 3300006871 Bacteria 2611
126 Ga0075434_100162042 3300006871 Bacteria 2256
127 Ga0075429_100089948 3300006880 Bacteria 2677
128 Ga0068865_100002237 3300006881 Bacteria 11394
129 Ga0068865_100113624 3300006881 Unclassified 2002
130 Ga0075436_100001257 3300006914 Bacteria 17222
131 Ga0075436_100028146 3300006914 Bacteria 3867
132 Ga0075436_100033073 3300006914 Bacteria 3563
133 Ga0075436_100158572 3300006914 Bacteria 1594
134 Ga0075436_100216482 3300006914 Unclassified 1358
135 Ga0075435_100011380 3300007076 Bacteria 6541
136 Ga0075435_100045012 3300007076 Bacteria 3536
137 Ga0075435_100054666 3300007076 Bacteria 3223
138 Ga0099794_10000241 3300007265 Bacteria 19146
139 Ga0105240_10083311 3300009093 Unclassified 3925
140 Ga0111539_10006820 3300009094 Bacteria 14685
141 Ga0111539_10141354 3300009094 Bacteria 2818
142 Ga0111539_10312613 3300009094 Bacteria 1829
143 Ga0114129_10002172 3300009147 Bacteria 27014
144 Ga0114129_10070496 3300009147 Unclassified 4874
145 Ga0114129_10073560 3300009147 Bacteria 4761
146 Ga0114129_10092474 3300009147 Bacteria 4190
147 Ga0114129_10111891 3300009147 Unclassified 3767
148 Ga0114129_10149377 3300009147 Bacteria 3198
149 Ga0114129_10155677 3300009147 Bacteria 3125
150 Ga0114129_10368768 3300009147 Unclassified 1898
151 Ga0105243_10003995 3300009148 Bacteria 11752
152 Ga0105241_10191712 3300009174 Bacteria 1702
153 Ga0105242_10000351 3300009176 Bacteria 36970
154 Ga0105248_10001568 3300009177 Bacteria 25438
155 Ga0105238_10000012 3300009551 Bacteria 258862
156 Ga0105238_10307031 3300009551 Bacteria 1571
157 Ga0105249_10047355 3300009553 Bacteria 3917
158 Ga0105239_10125944 3300010375 Unclassified 2847
159 Ga0105246_10008577 3300011119 Bacteria 6284
160 Ga0157371_10155952 3300013102 Bacteria 1629
161 Ga0157370_10016373 3300013104 Bacteria 7505
162 Ga0157378_10000422 3300013297 Bacteria 41604
163 Ga0163162_10054059 3300013306 Bacteria 4038
164 Ga0157372_10451432 3300013307 Unclassified 1498
165 Ga0157379_10014585 3300014968 Bacteria 6893
166 Ga0163161_10024297 3300017792 Bacteria 4281
167 Ga0207653_10000013 3300025885 Bacteria 159236
168 Ga0207653_10000039 3300025885 Bacteria 98540
169 Ga0207653_10004827 3300025885 Bacteria 4216
170 Ga0207680_10233072 3300025903 Bacteria 1266
171 Ga0207699_10000001 3300025906 Bacteria 695560
172 Ga0207699_10004313 3300025906 Bacteria 6799
173 Ga0207645_10057021 3300025907 Unclassified 2494
174 Ga0207643_10034478 3300025908 Bacteria 2835
175 Ga0207684_10000037 3300025910 Bacteria 284224
176 Ga0207684_10002462 3300025910 Bacteria 18649
177 Ga0207684_10015927 3300025910 Bacteria 6461
178 Ga0207695_10112743 3300025913 Unclassified 2696
179 Ga0207663_10000001 3300025916 Bacteria 591990
180 Ga0207662_10014627 3300025918 Bacteria 4406
181 Ga0207662_10066227 3300025918 Bacteria 2176
182 Ga0207646_10010328 3300025922 Bacteria 9134
183 Ga0207646_10011403 3300025922 Bacteria 8618
184 Ga0207646_10085468 3300025922 Unclassified 2822
185 Ga0207646_10176924 3300025922 Bacteria 1927
186 Ga0207694_10000025 3300025924 Bacteria 258871
187 Ga0207700_10007336 3300025928 Bacteria 6731
188 Ga0207706_10000011 3300025933 Bacteria 196033
189 Ga0207706_10001515 3300025933 Bacteria 23027
190 Ga0207686_10000172 3300025934 Bacteria 49408
191 Ga0207709_10008477 3300025935 Bacteria 5689
192 Ga0207669_10000157 3300025937 Bacteria 32354
193 Ga0207704_10046405 3300025938 Bacteria 2589
194 Ga0207704_10070089 3300025938 Unclassified 2219
195 Ga0207691_10135761 3300025940 Bacteria 2169
196 Ga0207689_10005626 3300025942 Bacteria 11167
197 Ga0207667_10012812 3300025949 Bacteria 9635
198 Ga0207712_10001233 3300025961 Bacteria 17666
199 Ga0207712_10043537 3300025961 Unclassified 3098
200 Ga0207640_10007373 3300025981 Bacteria 6072
201 Ga0207708_10007762 3300026075 Bacteria 7944
202 Ga0207708_10067169 3300026075 Bacteria 2743
203 Ga0207708_10129177 3300026075 Bacteria 1974
204 Ga0207648_10000011 3300026089 Bacteria 182284
205 Ga0207676_10002058 3300026095 Bacteria 14594
206 Ga0207674_10001473 3300026116 Bacteria 30419
207 Ga0207675_100004460 3300026118 Bacteria 13528
208 Ga0207675_100111769 3300026118 Unclassified 2578
209 Ga0207675_100156526 3300026118 Bacteria 2172
210 Ga0207683_10001778 3300026121 Bacteria 19080
211 Ga0209588_1000162 3300027671 Bacteria 19216
212 Ga0209588_1003914 3300027671 Bacteria 4161
213 Ga0207428_10118984 3300027907 Unclassified 2027
214 Ga0268264_10005247 3300028381 Bacteria 10966
215 Ga0316579_10000863 3300031691 Bacteria 10503
216 Ga0316576_10005767 3300031727 Bacteria 7624
217 Ga0316578_10004278 3300031728 Bacteria 6708
218 Ga0307410_10358070 3300031852 Bacteria 1168
219 Ga0307416_100490226 3300032002 Bacteria 1291
220 Ga0316583_10002471 3300032133 Bacteria 6425
221 Ga0316583_10042876 3300032133 Bacteria 1599
222 Ga0373959_0001660 3300034820 Bacteria 3539
223 Ga0373943_0024568 3300035170 Bacteria 2810
224 Ga0316582_0158668 3300036647 Bacteria 1531
225 Ga0436364_1160056 3300037853 Bacteria 3708
226 Ga0395901_0001345 3300038443 Bacteria 25773
227 Ga0451577_0114650 3300042876 Unclassified 2412
228 Ga0453683_0026941 3300044673 Bacteria 3649
229 Ga0453683_0073715 3300044673 Bacteria 2137
230 Ga0466965_0096845 3300044683 Bacteria 1506
231 Ga0466961_0003136 3300044693 Bacteria 10294
232 Ga0451576_0004645 3300045051 Bacteria 17707
233 Ga0451576_0013989 3300045051 Bacteria 8947
234 Ga0451576_0051261 3300045051 Bacteria 4327
235 Ga0451576_0209334 3300045051 Bacteria 2036
236 Ga0451576_0254749 3300045051 Bacteria 1834
237 Ga0495603_0029353 3300046455 Bacteria 3316
238 Ga0495629_0000038 3300046459 Bacteria 117040
239 Ga0495653_0053826 3300046463 Bacteria 3078
240 Ga0495580_0097097 3300046472 Bacteria 2049
241 Ga0495582_0087763 3300046473 Bacteria 1732
242 Ga0495639_0007832 3300046475 Bacteria 4592
243 Ga0495618_0128939 3300046514 Bacteria 1619
244 Ga0495630_0010537 3300046517 Bacteria 6679
245 Ga0495643_0000124 3300046522 Bacteria 124810
246 Ga0495666_0000385 3300046526 Bacteria 19297
247 Ga0495640_0042210 3300046533 Bacteria 3184
248 Ga0495586_0002451 3300046535 Bacteria 10068
249 Ga0495622_0009781 3300046557 Bacteria 4433
250 Ga0495634_0022552 3300046642 Bacteria 4435
251 Ga0495635_0000506 3300046663 Bacteria 24648
252 Ga0495647_0042015 3300046681 Bacteria 1744
253 Ga0495658_0013935 3300046683 Bacteria 4099
254 Ga0495669_0097163 3300046684 Bacteria 1365
255 Ga0495613_0025178 3300046689 Bacteria 4435
256 Ga0495674_0018363 3300047319 Bacteria 6510
257 Ga0495676_0015510 3300047321 Bacteria 6782
258 Ga0495680_0014694 3300047322 Bacteria 6772
259 Ga0495680_0020366 3300047322 Bacteria 5582
260 Ga0495684_0028689 3300047471 Bacteria 4272
261 Ga0496114_0150807 3300048917 Unclassified 2017
262 Ga0501041_0032258 3300049577 Unclassified 3166
263 Ga0501042_0092693 3300049578 Bacteria 2169
264 Ga0501048_0034862 3300049582 Unclassified 3627
265 Ga0501067_0182042 3300049583 Bacteria 1170
266 Ga0501074_0168895 3300049590 Unclassified 1562
267 Ga0501079_0070138 3300049741 Bacteria 2706
268 Ga0501079_0158749 3300049741 Unclassified 1763
269 Ga0501081_0178120 3300049743 Unclassified 1537
270 Ga0501283_003570 3300049779 Bacteria 2064
271 nmdc:mga05p37_123086_c1 3300050507 Bacteria 3186
272 nmdc:mga05p37_18120_c1 3300050507 Bacteria 8507
273 nmdc:mga05p37_362_c1 3300050507 Bacteria 24919
274 nmdc:mga05p37_58465_c1 3300050507 Bacteria 4748
275 nmdc:mga05p37_789627_c1 3300050507 Bacteria 1040
276 nmdc:mga05p37_82358_c1 3300050507 Bacteria 3964
277 nmdc:mga09592_190851_c1 3300050508 Bacteria 1773
278 nmdc:mga09592_98963_c1 3300050508 Bacteria 2497
279 nmdc:mga06r32_177299_c1 3300050510 Bacteria 2116
280 nmdc:mga06r32_75615_c1 3300050510 Bacteria 3269
281 nmdc:mga06r32_87751_c1 3300050510 Unclassified 3036
282 nmdc:mga08y16_246451_c1 3300050511 Bacteria 1846
283 nmdc:mga08y16_4773_c1 3300050511 Bacteria 14141
284 nmdc:mga08y16_75481_c1 3300050511 Bacteria 3514
285 nmdc:mga0n895_102317_c1 3300050512 Bacteria 2875
286 nmdc:mga0n895_14791_c1 3300050512 Bacteria 7100
287 nmdc:mga0n895_16666_c1 3300050512 Bacteria 6749
288 nmdc:mga0n895_17225_c1 3300050512 Bacteria 6657
289 nmdc:mga0n895_202778_c1 3300050512 Bacteria 2014
290 nmdc:mga0n895_365035_c1 3300050512 Bacteria 1462
291 nmdc:mga0n895_4695_c1 3300050512 Bacteria 11272
292 nmdc:mga0n895_53689_c1 3300050512 Unclassified 3960
293 nmdc:mga0n895_75935_c1 3300050512 Bacteria 3341
294 nmdc:mga0n895_8905_c1 3300050512 Bacteria 8743
295 nmdc:mga0n895_95626_c1 3300050512 Bacteria 2976
296 nmdc:mga0rr50_12117_c1 3300050513 Bacteria 5557
297 nmdc:mga0rr50_222355_c1 3300050513 Unclassified 1559
298 nmdc:mga0rr50_29678_c1 3300050513 Bacteria 3861
299 nmdc:mga0rr50_45597_c1 3300050513 Bacteria 3223
300 nmdc:mga08x19_16673_c1 3300050514 Bacteria 4484
301 nmdc:mga08x19_20_c1 3300050514 Bacteria 304974
302 nmdc:mga08x19_34329_c1 3300050514 Unclassified 3205
303 nmdc:mga08x19_38725_c1 3300050514 Unclassified 3029
304 nmdc:mga08x19_77707_c1 3300050514 Unclassified 2174
305 nmdc:mga08x19_80269_c1 3300050514 Bacteria 2141
306 nmdc:mga08x19_9982_c1 3300050514 Bacteria 5692
307 nmdc:mga0a205_156078_c1 3300050515 Bacteria 2180
308 nmdc:mga0a205_221972_c1 3300050515 Unclassified 1775
309 nmdc:mga0a205_28473_c1 3300050515 Bacteria 5342
310 nmdc:mga0a205_50034_c1 3300050515 Bacteria 4035
311 nmdc:mga0a205_6206_c1 3300050515 Bacteria 10788
312 nmdc:mga0a205_62922_c1 3300050515 Bacteria 3585
313 nmdc:mga0a205_68663_c1 3300050515 Bacteria 3423
314 nmdc:mga0a205_99336_c1 3300050515 Bacteria 2809
315 Ga0500566_0108268 3300053094 Unclassified 1514
316 Ga0500628_000225 3300053129 Bacteria 10917
317 Ga0501084_0260678 3300054114 Bacteria 1463
318 Ga0075434_100047750
319 MBSR1b_contig_2875387
320 Ga0065712_10083024
321 Ga0065707_10125987
322 Ga0070690_100012818
323 Ga0068869_100010096
324 Ga0070680_100006686
325 Ga0070687_100008110
326 Ga0070692_10002215
327 Ga0070692_10002508
328 Ga0070668_100019346
329 Ga0070667_100018903
330 Ga0070703_10000421
331 Ga0070703_10000907
332 Ga0070703_10006974
333 Ga0070703_10025738
334 Ga0070709_10000075
335 Ga0070709_10004176
336 Ga0070713_100010711
337 Ga0070701_10027380
338 Ga0070711_100000053
339 Ga0070705_100000377
340 Ga0070705_100000389
341 Ga0070705_100003755
342 Ga0070705_100013093
343 Ga0070705_100017543
344 Ga0070700_100072508
345 Ga0070700_100141400
346 Ga0070694_100001254
347 Ga0070694_100018374
348 Ga0070694_100020265
349 Ga0070694_100032514
350 Ga0070694_100056381
351 Ga0070694_100058313
352 Ga0070694_100135746
353 Ga0070694_100157345
354 Ga0070708_100002340
355 Ga0070708_100009117
356 Ga0070708_100018191
357 Ga0070708_100033696
358 Ga0070708_100195313
359 Ga0070663_100044552
360 Ga0070678_100000833
361 Ga0070662_100001212
362 Ga0068867_100018223
363 Ga0070685_10008001
364 Ga0070706_100000070
365 Ga0070706_100019796
366 Ga0070706_100033467
367 Ga0070707_100020274
368 Ga0070707_100064180
369 Ga0070698_100001087
370 Ga0070698_100029468
371 Ga0070698_100105543
372 Ga0070698_100257665
373 Ga0070699_100000174
374 Ga0070699_100002475
375 Ga0070699_100010283
376 Ga0070699_100029183
377 Ga0070699_100032241
378 Ga0070699_100039184
379 Ga0070699_100050153
380 Ga0070699_100207841
381 Ga0070684_100094883
382 Ga0070697_100000027
383 Ga0070697_100000853
384 Ga0070697_100013017
385 Ga0070697_100014337
386 Ga0070697_100172273
387 Ga0070697_100312035
388 Ga0070686_100000019
389 Ga0070695_100001622
390 Ga0070695_100005484
391 Ga0070695_100009709
392 Ga0070695_100023565
393 Ga0070695_100044765
394 Ga0070696_100001314
395 Ga0070696_100003339
396 Ga0070696_100003852
397 Ga0070696_100004117
398 Ga0070696_100017099
399 Ga0070696_100031164
400 Ga0070696_100040256
401 Ga0070693_100036976
402 Ga0070704_100000438
403 Ga0070704_100004535
404 Ga0070704_100004986
405 Ga0070704_100007783
406 Ga0070704_100008188
407 Ga0070704_100048224
408 Ga0068854_100001077
409 Ga0068854_100083312
410 Ga0068864_100002885
411 Ga0068866_10000032
412 Ga0068870_10026839
413 Ga0068858_100166052
414 Ga0068860_100011828
415 Ga0068862_100011097
416 Ga0070716_100000342
417 Ga0075428_100005870
418 Ga0075428_100017366
419 Ga0075428_100056980
420 Ga0075428_100225773
421 Ga0075428_100320851
422 Ga0075431_100008736
423 Ga0075431_100021575
424 Ga0075431_100071398
425 Ga0075431_100136542
426 Ga0075433_10000143
427 Ga0075433_10003168
428 Ga0075433_10025869
429 Ga0075433_10033404
430 Ga0075433_10056958
431 Ga0075433_10067683
432 Ga0075433_10112659
433 Ga0075433_10163479
434 Ga0075433_10246210
435 Ga0075434_100014476
436 Ga0075434_100023698
437 Ga0075434_100039755
438 Ga0075434_100042615
439 Ga0075434_100062761
440 Ga0075434_100078184
441 Ga0075434_100117068
442 Ga0075434_100122938
443 Ga0075434_100162042
444 Ga0075429_100089948
445 Ga0068865_100002237
446 Ga0068865_100113624
447 Ga0075436_100001257
448 Ga0075436_100028146
449 Ga0075436_100033073
450 Ga0075436_100158572
451 Ga0075436_100216482
452 Ga0075435_100011380
453 Ga0075435_100045012
454 Ga0075435_100054666
455 Ga0099794_10000241
456 Ga0105240_10083311
457 Ga0111539_10006820
458 Ga0111539_10141354
459 Ga0111539_10312613
460 Ga0114129_10002172
461 Ga0114129_10070496
462 Ga0114129_10073560
463 Ga0114129_10092474
464 Ga0114129_10111891
465 Ga0114129_10149377
466 Ga0114129_10155677
467 Ga0114129_10368768
468 Ga0105243_10003995
469 Ga0105241_10191712
470 Ga0105242_10000351
471 Ga0105248_10001568
472 Ga0105238_10000012
473 Ga0105238_10307031
474 Ga0105249_10047355
475 Ga0105239_10125944
476 Ga0105246_10008577
477 Ga0157371_10155952
478 Ga0157370_10016373
479 Ga0157378_10000422
480 Ga0163162_10054059
481 Ga0157372_10451432
482 Ga0157379_10014585
483 Ga0163161_10024297
484 Ga0207653_10000013
485 Ga0207653_10000039
486 Ga0207653_10004827
487 Ga0207680_10233072
488 Ga0207699_10000001
489 Ga0207699_10004313
490 Ga0207645_10057021
491 Ga0207643_10034478
492 Ga0207684_10000037
493 Ga0207684_10002462
494 Ga0207684_10015927
495 Ga0207695_10112743
496 Ga0207663_10000001
497 Ga0207662_10014627
498 Ga0207662_10066227
499 Ga0207646_10010328
500 Ga0207646_10011403
501 Ga0207646_10085468
502 Ga0207646_10176924
503 Ga0207694_10000025
504 Ga0207700_10007336
505 Ga0207706_10000011
506 Ga0207706_10001515
507 Ga0207686_10000172
508 Ga0207709_10008477
509 Ga0207669_10000157
510 Ga0207704_10046405
511 Ga0207704_10070089
512 Ga0207691_10135761
513 Ga0207689_10005626
514 Ga0207667_10012812
515 Ga0207712_10001233
516 Ga0207712_10043537
517 Ga0207640_10007373
518 Ga0207708_10007762
519 Ga0207708_10067169
520 Ga0207708_10129177
521 Ga0207648_10000011
522 Ga0207676_10002058
523 Ga0207674_10001473
524 Ga0207675_100004460
525 Ga0207675_100111769
526 Ga0207675_100156526
527 Ga0207683_10001778
528 Ga0209588_1000162
529 Ga0209588_1003914
530 Ga0207428_10118984
531 Ga0268264_10005247
532 Ga0316579_10000863
533 Ga0316576_10005767
534 Ga0316578_10004278
535 Ga0307410_10358070
536 Ga0307416_100490226
537 Ga0316583_10002471
538 Ga0316583_10042876
539 Ga0373959_0001660
540 Ga0373943_0024568
541 Ga0316582_0158668
542 Ga0436364_1160056
543 Ga0395901_0001345
544 Ga0451577_0114650
545 Ga0453683_0026941
546 Ga0453683_0073715
547 Ga0466965_0096845
548 Ga0466961_0003136
549 Ga0451576_0004645
550 Ga0451576_0013989
551 Ga0451576_0051261
552 Ga0451576_0209334
553 Ga0451576_0254749
554 Ga0495603_0029353
555 Ga0495629_0000038
556 Ga0495653_0053826
557 Ga0495580_0097097
558 Ga0495582_0087763
559 Ga0495639_0007832
560 Ga0495618_0128939
561 Ga0495630_0010537
562 Ga0495643_0000124
563 Ga0495666_0000385
564 Ga0495640_0042210
565 Ga0495586_0002451
566 Ga0495622_0009781
567 Ga0495634_0022552
568 Ga0495635_0000506
569 Ga0495647_0042015
570 Ga0495658_0013935
571 Ga0495669_0097163
572 Ga0495613_0025178
573 Ga0495674_0018363
574 Ga0495676_0015510
575 Ga0495680_0014694
576 Ga0495680_0020366
577 Ga0495684_0028689
578 Ga0496114_0150807
579 Ga0501041_0032258
580 Ga0501042_0092693
581 Ga0501048_0034862
582 Ga0501067_0182042
583 Ga0501074_0168895
584 Ga0501079_0070138
585 Ga0501079_0158749
586 Ga0501081_0178120
587 Ga0501283_003570
588 nmdc:mga05p37_123086_c1
589 nmdc:mga05p37_18120_c1
590 nmdc:mga05p37_362_c1
591 nmdc:mga05p37_58465_c1
592 nmdc:mga05p37_789627_c1
593 nmdc:mga05p37_82358_c1
594 nmdc:mga09592_190851_c1
595 nmdc:mga09592_98963_c1
596 nmdc:mga06r32_177299_c1
597 nmdc:mga06r32_75615_c1
598 nmdc:mga06r32_87751_c1
599 nmdc:mga08y16_246451_c1
600 nmdc:mga08y16_4773_c1
601 nmdc:mga08y16_75481_c1
602 nmdc:mga0n895_102317_c1
603 nmdc:mga0n895_14791_c1
604 nmdc:mga0n895_16666_c1
605 nmdc:mga0n895_17225_c1
606 nmdc:mga0n895_202778_c1
607 nmdc:mga0n895_365035_c1
608 nmdc:mga0n895_4695_c1
609 nmdc:mga0n895_53689_c1
610 nmdc:mga0n895_75935_c1
611 nmdc:mga0n895_8905_c1
612 nmdc:mga0n895_95626_c1
613 nmdc:mga0rr50_12117_c1
614 nmdc:mga0rr50_222355_c1
615 nmdc:mga0rr50_29678_c1
616 nmdc:mga0rr50_45597_c1
617 nmdc:mga08x19_16673_c1
618 nmdc:mga08x19_20_c1
619 nmdc:mga08x19_34329_c1
620 nmdc:mga08x19_38725_c1
621 nmdc:mga08x19_77707_c1
622 nmdc:mga08x19_80269_c1
623 nmdc:mga08x19_9982_c1
624 nmdc:mga0a205_156078_c1
625 nmdc:mga0a205_221972_c1
626 nmdc:mga0a205_28473_c1
627 nmdc:mga0a205_50034_c1
628 nmdc:mga0a205_6206_c1
629 nmdc:mga0a205_62922_c1
630 nmdc:mga0a205_68663_c1
631 nmdc:mga0a205_99336_c1
632 Ga0500566_0108268
633 Ga0500628_000225
634 Ga0501084_0260678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

181

255

0.94

PF00676

E1_dh

Dehydrogenase E1 component

80

397

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1umb-assembly1.cif.gz_C branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form 0.9445 41 360
1um9-assembly1.cif.gz_A branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in apo-form 0.9361 41 359
2bfc-assembly1.cif.gz_A-2 reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 0.9352 42 359
2bfd-assembly1.cif.gz_A-2 reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 0.9328 42 359
1x7x-assembly1.cif.gz_A crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase 0.9327 41 359
ID Description Score Start End Superfamily
1um9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9361 41 359 3.40.50.970
af_Q2FY52_1_330_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9283 42 359 3.40.50.970
af_A0A1D6GTY5_25_137_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9273 154 263 3.40.50.970
af_P12694_46_445_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9255 32 359 3.40.50.970
af_I1KAH2_90_485_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9214 41 359 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A0S8AWK7-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9802 1 360 GO:0003863
GO:0009083
AF-A0A0S8AWK7-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9775 1 360 GO:0003863
GO:0009083
AF-A0A6M1XCA5-F1-model_v4 deleted 0.9669 155 277
AF-A0A2T4S5F3-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9648 149 277 GO:0004739
GO:0009083
AF-A0A3D5YLY8-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9623 42 263 GO:0003863
GO:0009083

Map