F404076

General Info

Members Datasets Scaffolds Average Seq Length
317 182 317 68

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100022818|Ga0068856_1000228185
Length 69
Sequence MTYVPVVDPDECSAHGDCVEVAPEVFRLDDDVAVVIGTGPFEKVLEAAESCPAVAISVVDEEKGETVFP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
177 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 8.2
Rhizosphere 88.64
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000314 3300001979 Bacteria 20684
2 JGI24751J29686_10076443 3300002459 Bacteria 692
3 JGI25406J46586_10083529 3300003203 Bacteria 975
4 Ga0070683_100014460 3300005329 Bacteria 6903
5 Ga0070680_100927542 3300005336 Unclassified 751
6 Ga0070682_100000045 3300005337 Bacteria 131960
7 Ga0070682_101604311 3300005337 Unclassified 562
8 Ga0070689_100291845 3300005340 Unclassified 1355
9 Ga0070661_100000023 3300005344 Bacteria 123104
10 Ga0070668_100849303 3300005347 Bacteria 813
11 Ga0070688_100010011 3300005365 Bacteria 5209
12 Ga0070659_100007823 3300005366 Bacteria 7778
13 Ga0070667_100063530 3300005367 Bacteria 3129
14 Ga0070703_10081228 3300005406 Unclassified 1104
15 Ga0070714_100232723 3300005435 Bacteria 1698
16 Ga0070713_100185876 3300005436 Bacteria 1870
17 Ga0070711_100017653 3300005439 Bacteria 4546
18 Ga0070711_100196179 3300005439 Bacteria 1555
19 Ga0070663_100713456 3300005455 Unclassified 853
20 Ga0070678_100119920 3300005456 Bacteria 2073
21 Ga0070681_11884560 3300005458 Unclassified 525
22 Ga0068867_100000556 3300005459 Bacteria 24623
23 Ga0070685_10045967 3300005466 Bacteria 2505
24 Ga0070684_100018798 3300005535 Bacteria 5701
25 Ga0070684_100310094 3300005535 Unclassified 1449
26 Ga0068853_100453804 3300005539 Bacteria 1206
27 Ga0070696_100706655 3300005546 Unclassified 822
28 Ga0070693_100258512 3300005547 Unclassified 1157
29 Ga0070665_100108520 3300005548 Bacteria 2778
30 Ga0070665_100131709 3300005548 Bacteria 2503
31 Ga0070665_100854742 3300005548 Bacteria 923
32 Ga0068855_100503127 3300005563 Bacteria 1316
33 Ga0070664_101599699 3300005564 Bacteria 617
34 Ga0070664_101930875 3300005564 Unclassified 560
35 Ga0068854_100000031 3300005578 Bacteria 107298
36 Ga0068856_100001194 3300005614 Bacteria 27371
37 Ga0068856_100022818 3300005614 Bacteria 6087
38 Ga0068856_100051634 3300005614 Bacteria 4054
39 Ga0068851_10000959 3300005834 Bacteria 12486
40 Ga0068858_100093496 3300005842 Bacteria 2799
41 Ga0068858_100427025 3300005842 Bacteria 1275
42 Ga0068860_100062176 3300005843 Bacteria 3548
43 Ga0068862_100003429 3300005844 Bacteria 13641
44 Ga0081539_10003607 3300005985 Bacteria 18723
45 Ga0070715_10000014 3300006163 Bacteria 154272
46 Ga0070715_10214217 3300006163 Unclassified 986
47 Ga0070712_100000861 3300006175 Bacteria 18065
48 Ga0097621_100359705 3300006237 Unclassified 1296
49 Ga0075430_100250135 3300006846 Bacteria 1469
50 Ga0068865_100000104 3300006881 Bacteria 43423
51 Ga0105245_10000545 3300009098 Bacteria 34359
52 Ga0105245_10003994 3300009098 Bacteria 13105
53 Ga0105245_12865057 3300009098 Unclassified 535
54 Ga0105247_10000322 3300009101 Bacteria 42918
55 Ga0105247_10581652 3300009101 Bacteria 828
56 Ga0105241_12540201 3300009174 Unclassified 513
57 Ga0105248_10000118 3300009177 Bacteria 90018
58 Ga0105238_10000033 3300009551 Bacteria 172981
59 Ga0105238_12414710 3300009551 Bacteria 561
60 Ga0105249_10028269 3300009553 Bacteria 5062
61 Ga0105249_11963926 3300009553 Bacteria 658
62 Ga0105249_12245386 3300009553 Bacteria 618
63 Ga0105239_10219646 3300010375 Bacteria 2131
64 Ga0105239_10802858 3300010375 Bacteria 1078
65 Ga0105246_10549327 3300011119 Bacteria 990
66 Ga0157371_10022809 3300013102 Bacteria 4579
67 Ga0157370_10182501 3300013104 Unclassified 1950
68 Ga0157370_10457562 3300013104 Bacteria 1173
69 Ga0157369_10001239 3300013105 Bacteria 31838
70 Ga0157378_10013050 3300013297 Bacteria 7267
71 Ga0163162_12015959 3300013306 Bacteria 661
72 Ga0157372_10000409 3300013307 Bacteria 47021
73 Ga0157375_12909823 3300013308 Unclassified 572
74 Ga0163163_10158004 3300014325 Unclassified 2312
75 Ga0157379_10045738 3300014968 Bacteria 3907
76 Ga0157379_10308085 3300014968 Bacteria 1444
77 Ga0206356_10513908 3300020070 Bacteria 3568
78 Ga0206353_11679996 3300020082 Bacteria 823
79 Ga0207656_10000116 3300025321 Bacteria 30697
80 Ga0207653_10068603 3300025885 Unclassified 1208
81 Ga0207710_10000158 3300025900 Bacteria 72527
82 Ga0207685_10000046 3300025905 Bacteria 46018
83 Ga0207685_10340358 3300025905 Bacteria 753
84 Ga0207705_10040116 3300025909 Bacteria 3357
85 Ga0207654_10013399 3300025911 Bacteria 4218
86 Ga0207707_11158665 3300025912 Unclassified 627
87 Ga0207693_10001956 3300025915 Bacteria 18065
88 Ga0207693_10458989 3300025915 Unclassified 995
89 Ga0207693_10869535 3300025915 Bacteria 693
90 Ga0207663_10086968 3300025916 Bacteria 2063
91 Ga0207663_10158230 3300025916 Bacteria 1596
92 Ga0207649_10000063 3300025920 Bacteria 96360
93 Ga0207694_10000012 3300025924 Bacteria 411218
94 Ga0207687_10000007 3300025927 Bacteria 604185
95 Ga0207687_10000691 3300025927 Bacteria 22768
96 Ga0207687_10007579 3300025927 Bacteria 7136
97 Ga0207700_10543127 3300025928 Bacteria 1031
98 Ga0207664_10080276 3300025929 Bacteria 2651
99 Ga0207690_10003697 3300025932 Bacteria 9103
100 Ga0207670_10173012 3300025936 Unclassified 1621
101 Ga0207704_10000146 3300025938 Bacteria 37894
102 Ga0207711_10000020 3300025941 Bacteria 363325
103 Ga0207661_10009431 3300025944 Bacteria 7001
104 Ga0207679_11625947 3300025945 Unclassified 592
105 Ga0207667_11088675 3300025949 Unclassified 783
106 Ga0207712_10007769 3300025961 Bacteria 6781
107 Ga0207712_11651252 3300025961 Bacteria 574
108 Ga0207668_10270350 3300025972 Bacteria 1389
109 Ga0207640_10000015 3300025981 Bacteria 215411
110 Ga0207658_10009541 3300025986 Bacteria 6588
111 Ga0207703_10184745 3300026035 Bacteria 1842
112 Ga0207703_10509798 3300026035 Bacteria 1130
113 Ga0207639_10158244 3300026041 Bacteria 1906
114 Ga0207678_10771978 3300026067 Unclassified 848
115 Ga0207702_10000607 3300026078 Bacteria 39638
116 Ga0207702_10003776 3300026078 Bacteria 13676
117 Ga0207702_10113527 3300026078 Bacteria 2413
118 Ga0207641_10188348 3300026088 Bacteria 1895
119 Ga0207641_11021294 3300026088 Bacteria 824
120 Ga0207648_10001621 3300026089 Bacteria 24664
121 Ga0207683_10095380 3300026121 Bacteria 2652
122 Ga0268266_10165523 3300028379 Bacteria 2003
123 Ga0268266_10292065 3300028379 Bacteria 1518
124 Ga0268266_11264531 3300028379 Unclassified 713
125 Ga0268265_10008322 3300028380 Bacteria 7004
126 Ga0265319_1000079 3300028563 Bacteria 75683
127 Ga0265322_10073248 3300028654 Bacteria 972
128 Ga0265338_10496119 3300028800 Unclassified 860
129 Ga0373956_0528071 3300035119 Bacteria 563
130 Ga0373933_0424676 3300035724 Unclassified 868
131 Ga0373937_0010181 3300036401 Bacteria 8202
132 Ga0373937_0682816 3300036401 Bacteria 973
133 Ga0373937_0778219 3300036401 Bacteria 905
134 Ga0316582_0586420 3300036647 Bacteria 768
135 Ga0495592_0005904 3300046454 Bacteria 9090
136 Ga0495592_0102551 3300046454 Bacteria 2037
137 Ga0495592_0198423 3300046454 Bacteria 1356
138 Ga0495592_0440571 3300046454 Unclassified 818
139 Ga0495603_0006970 3300046455 Bacteria 6781
140 Ga0495603_0007849 3300046455 Bacteria 6434
141 Ga0495629_0253675 3300046459 Bacteria 1210
142 Ga0495629_0279733 3300046459 Bacteria 1145
143 Ga0495641_0489318 3300046461 Bacteria 561
144 Ga0495651_0131772 3300046462 Unclassified 1824
145 Ga0495653_0019388 3300046463 Bacteria 5517
146 Ga0495653_0046031 3300046463 Bacteria 3378
147 Ga0495653_0111120 3300046463 Bacteria 1969
148 Ga0495653_0129175 3300046463 Bacteria 1791
149 Ga0495653_0404274 3300046463 Bacteria 867
150 Ga0495582_0000003 3300046473 Bacteria 168880
151 Ga0495662_0000167 3300046476 Bacteria 25884
152 Ga0495662_0001475 3300046476 Bacteria 11641
153 Ga0495662_0315347 3300046476 Bacteria 769
154 Ga0495662_0359329 3300046476 Bacteria 716
155 Ga0495664_0261281 3300046477 Bacteria 1047
156 Ga0495584_0444533 3300046491 Unclassified 659
157 Ga0495608_0000122 3300046511 Bacteria 55708
158 Ga0495608_0000189 3300046511 Bacteria 43800
159 Ga0495608_0225960 3300046511 Bacteria 1173
160 Ga0495608_0319342 3300046511 Unclassified 960
161 Ga0495618_0000026 3300046514 Bacteria 113266
162 Ga0495618_0493612 3300046514 Unclassified 739
163 Ga0495628_0000144 3300046516 Bacteria 61254
164 Ga0495628_0005318 3300046516 Bacteria 11293
165 Ga0495628_0024110 3300046516 Bacteria 4984
166 Ga0495628_0039005 3300046516 Bacteria 3801
167 Ga0495628_0301908 3300046516 Unclassified 1185
168 Ga0495628_0634525 3300046516 Unclassified 760
169 Ga0495630_0000862 3300046517 Bacteria 21408
170 Ga0495630_0002718 3300046517 Bacteria 12266
171 Ga0495630_0009081 3300046517 Bacteria 7145
172 Ga0495630_0757249 3300046517 Bacteria 742
173 Ga0495652_0000019 3300046529 Bacteria 190248
174 Ga0495652_0018825 3300046529 Bacteria 6153
175 Ga0495652_0286798 3300046529 Bacteria 1203
176 Ga0495640_0048390 3300046533 Bacteria 2938
177 Ga0495586_0001432 3300046535 Bacteria 13200
178 Ga0495587_0004675 3300046536 Bacteria 8993
179 Ga0495587_0267084 3300046536 Bacteria 960
180 Ga0495645_0003745 3300046543 Bacteria 10334
181 Ga0495645_0007267 3300046543 Bacteria 7706
182 Ga0495667_0000015 3300046559 Bacteria 200377
183 Ga0495634_0000962 3300046642 Bacteria 27234
184 Ga0495634_0061478 3300046642 Bacteria 2497
185 Ga0495634_0340395 3300046642 Bacteria 900
186 Ga0495634_0408579 3300046642 Bacteria 805
187 Ga0495625_0000405 3300046660 Bacteria 65434
188 Ga0495635_0000005 3300046663 Bacteria 302178
189 Ga0495635_0347099 3300046663 Bacteria 990
190 Ga0495635_0603692 3300046663 Bacteria 716
191 Ga0495657_0000004 3300046675 Bacteria 266465
192 Ga0495657_0062167 3300046675 Bacteria 2468
193 Ga0495657_0180691 3300046675 Bacteria 1295
194 Ga0495599_0262613 3300046678 Bacteria 1049
195 Ga0495599_0470064 3300046678 Bacteria 743
196 Ga0495623_0409722 3300046679 Bacteria 728
197 Ga0495646_0507620 3300046680 Unclassified 619
198 Ga0495647_0000004 3300046681 Bacteria 140700
199 Ga0495647_0001032 3300046681 Bacteria 8495
200 Ga0495647_0153341 3300046681 Bacteria 989
201 Ga0495658_0000001 3300046683 Bacteria 385362
202 Ga0495658_0020830 3300046683 Bacteria 3448
203 Ga0495658_0340804 3300046683 Unclassified 952
204 Ga0495613_0000021 3300046689 Bacteria 159188
205 Ga0495613_0000370 3300046689 Bacteria 38906
206 Ga0495624_0063469 3300046690 Bacteria 2309
207 Ga0495624_0938578 3300046690 Unclassified 508
208 Ga0495600_0002209 3300046809 Bacteria 11062
209 Ga0495600_0003663 3300046809 Bacteria 9071
210 Ga0495600_0080126 3300046809 Unclassified 2132
211 Ga0495600_0404279 3300046809 Bacteria 849
212 Ga0495600_0635442 3300046809 Bacteria 646
213 Ga0495600_0807407 3300046809 Unclassified 558
214 Ga0495581_0339810 3300047315 Bacteria 877
215 Ga0495604_0000089 3300047317 Bacteria 77741
216 Ga0495604_0001362 3300047317 Bacteria 19995
217 Ga0495604_0110412 3300047317 Bacteria 2006
218 Ga0495676_0755010 3300047321 Bacteria 628
219 Ga0495680_0000007 3300047322 Bacteria 152053
220 Ga0495680_0001062 3300047322 Bacteria 30410
221 Ga0495680_0039230 3300047322 Bacteria 3779
222 Ga0495680_0054461 3300047322 Bacteria 3106
223 Ga0495675_0001341 3300047444 Bacteria 14909
224 Ga0495685_008517 3300047447 Bacteria 3409
225 Ga0495684_0290491 3300047471 Unclassified 1177
226 Ga0495686_0401387 3300047472 Bacteria 736
227 Ga0495593_0064325 3300047673 Bacteria 1915
228 Ga0495602_0000021 3300048088 Bacteria 168585
229 Ga0495602_0015275 3300048088 Bacteria 7755
230 Ga0495602_0324996 3300048088 Bacteria 1118
231 Ga0495602_0418301 3300048088 Bacteria 952
232 Ga0495602_1095996 3300048088 Bacteria 522
233 Ga0496102_0013393 3300048905 Bacteria 7104
234 Ga0496102_0206412 3300048905 Bacteria 1852
235 Ga0496103_0104656 3300048906 Bacteria 1794
236 Ga0496103_0194813 3300048906 Bacteria 1303
237 Ga0496103_0402291 3300048906 Bacteria 879
238 Ga0496105_0417761 3300048908 Bacteria 1062
239 Ga0496105_0790747 3300048908 Unclassified 722
240 Ga0496106_0838221 3300048909 Unclassified 728
241 Ga0496108_0000001 3300048911 Bacteria 919044
242 Ga0496108_0536353 3300048911 Unclassified 1021
243 Ga0496109_0000003 3300048912 Bacteria 420862
244 Ga0496109_0000028 3300048912 Bacteria 168138
245 Ga0496109_0728796 3300048912 Unclassified 929
246 Ga0496109_0833744 3300048912 Bacteria 860
247 Ga0496109_1099969 3300048912 Bacteria 732
248 Ga0496110_0000492 3300048913 Bacteria 26887
249 Ga0496110_0167691 3300048913 Bacteria 1992
250 Ga0496111_0004430 3300048914 Bacteria 8875
251 Ga0496111_0017629 3300048914 Bacteria 4937
252 Ga0496111_0451585 3300048914 Bacteria 948
253 Ga0496112_0000013 3300048915 Bacteria 237194
254 Ga0496112_0003984 3300048915 Bacteria 12374
255 Ga0496113_0000029 3300048916 Bacteria 61873
256 Ga0496113_0015692 3300048916 Bacteria 5216
257 Ga0496113_0041499 3300048916 Bacteria 3396
258 Ga0496113_0200772 3300048916 Bacteria 1585
259 Ga0496117_0018730 3300048920 Bacteria 5718
260 Ga0496118_0000174 3300048921 Bacteria 115950
261 Ga0496119_0030722 3300048922 Bacteria 3617
262 Ga0496120_0012344 3300048923 Bacteria 5821
263 Ga0496121_0010179 3300048924 Bacteria 10648
264 Ga0496121_0053660 3300048924 Bacteria 3375
265 Ga0496121_0131276 3300048924 Bacteria 1874
266 Ga0501034_0110154 3300049571 Bacteria 2745
267 Ga0501040_0424754 3300049576 Bacteria 955
268 Ga0501043_0390355 3300049579 Bacteria 1053
269 Ga0501047_0119868 3300049581 Bacteria 2513
270 Ga0501047_0292939 3300049581 Bacteria 1471
271 Ga0501048_0432385 3300049582 Bacteria 942
272 Ga0501068_0056488 3300049584 Bacteria 2380
273 Ga0501069_0509362 3300049585 Unclassified 718
274 Ga0501070_0015320 3300049586 Bacteria 6450
275 Ga0501070_0018473 3300049586 Bacteria 5850
276 Ga0501070_0245279 3300049586 Unclassified 1466
277 Ga0501070_1116964 3300049586 Unclassified 607
278 Ga0501071_0048308 3300049587 Bacteria 3060
279 Ga0501074_0010231 3300049590 Bacteria 6806
280 Ga0501074_0123889 3300049590 Bacteria 1848
281 Ga0501079_0003195 3300049741 Bacteria 12004
282 Ga0501080_0120280 3300049742 Bacteria 2434
283 Ga0501080_0172516 3300049742 Bacteria 1994
284 Ga0501080_1288745 3300049742 Bacteria 626
285 Ga0501081_0012739 3300049743 Bacteria 5531
286 Ga0501083_0027899 3300049744 Bacteria 3893
287 Ga0501035_0359993 3300049822 Bacteria 1216
288 Ga0501044_0006622 3300049823 Bacteria 12779
289 Ga0501044_0119083 3300049823 Bacteria 2643
290 Ga0501044_1047081 3300049823 Unclassified 687
291 Ga0495601_0000013 3300053077 Bacteria 226476
292 Ga0495601_0000035 3300053077 Bacteria 92903
293 Ga0495601_0002976 3300053077 Bacteria 9645
294 Ga0495601_0021096 3300053077 Bacteria 3986
295 Ga0495601_0030443 3300053077 Bacteria 3351
296 Ga0495601_0202876 3300053077 Unclassified 1295
297 Ga0495601_0248004 3300053077 Bacteria 1163
298 Ga0495601_0463670 3300053077 Bacteria 819
299 Ga0495612_0000073 3300053078 Bacteria 45639
300 Ga0495612_0066853 3300053078 Bacteria 1494
301 Ga0495612_0557093 3300053078 Bacteria 528
302 Ga0500635_0235086 3300053080 Bacteria 717
303 Ga0495655_0000606 3300053083 Bacteria 5851
304 Ga0495595_0000003 3300053084 Bacteria 266465
305 Ga0495595_0000072 3300053084 Bacteria 49973
306 Ga0495595_0707784 3300053084 Bacteria 516
307 Ga0495619_0000055 3300053085 Bacteria 95570
308 Ga0495619_0001468 3300053085 Bacteria 15538
309 Ga0495619_0006453 3300053085 Bacteria 7426
310 Ga0495619_0020317 3300053085 Bacteria 4228
311 Ga0495619_0051935 3300053085 Unclassified 2710
312 Ga0495619_0353049 3300053085 Bacteria 1017
313 Ga0495619_0464640 3300053085 Unclassified 872
314 Ga0495619_0617438 3300053085 Bacteria 741
315 Ga0500595_018669 3300053119 Bacteria 2532
316 Ga0500568_0226808 3300053139 Bacteria 682
317 Ga0501082_2017566 3300060353 Unclassified 503

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053119 Ga0500595_018669 Ga0500595_018669_1957_2148 63
2 3300046529 Ga0495652_0018825 Ga0495652_0018825_3828_4031 67
3 3300001979 JGI24740J21852_10000314 JGI24740J21852_100003142 68
4 3300002459 JGI24751J29686_10076443 JGI24751J29686_100764432 68
5 3300003203 JGI25406J46586_10083529 JGI25406J46586_100835292 68
6 3300005329 Ga0070683_100014460 Ga0070683_1000144604 68
7 3300005336 Ga0070680_100927542 Ga0070680_1009275422 68
8 3300005337 Ga0070682_100000045 Ga0070682_10000004540 68
9 3300005337 Ga0070682_101604311 Ga0070682_1016043111 68
10 3300005340 Ga0070689_100291845 Ga0070689_1002918451 68
11 3300005344 Ga0070661_100000023 Ga0070661_100000023119 68
12 3300005347 Ga0070668_100849303 Ga0070668_1008493032 68
13 3300005365 Ga0070688_100010011 Ga0070688_1000100115 68
14 3300005366 Ga0070659_100007823 Ga0070659_1000078239 68
15 3300005367 Ga0070667_100063530 Ga0070667_1000635304 68
16 3300005406 Ga0070703_10081228 Ga0070703_100812282 68
17 3300005435 Ga0070714_100232723 Ga0070714_1002327233 68
18 3300005436 Ga0070713_100185876 Ga0070713_1001858762 68
19 3300005439 Ga0070711_100017653 Ga0070711_1000176532 68
20 3300005439 Ga0070711_100196179 Ga0070711_1001961792 68
21 3300005455 Ga0070663_100713456 Ga0070663_1007134562 68
22 3300005456 Ga0070678_100119920 Ga0070678_1001199202 68
23 3300005458 Ga0070681_11884560 Ga0070681_118845601 68
24 3300005459 Ga0068867_100000556 Ga0068867_1000005568 68
25 3300005466 Ga0070685_10045967 Ga0070685_100459672 68
26 3300005535 Ga0070684_100018798 Ga0070684_1000187987 68
27 3300005535 Ga0070684_100310094 Ga0070684_1003100942 68
28 3300005539 Ga0068853_100453804 Ga0068853_1004538042 68
29 3300005546 Ga0070696_100706655 Ga0070696_1007066552 68
30 3300005547 Ga0070693_100258512 Ga0070693_1002585122 68
31 3300005548 Ga0070665_100108520 Ga0070665_1001085203 68
32 3300005548 Ga0070665_100131709 Ga0070665_1001317094 68
33 3300005548 Ga0070665_100854742 Ga0070665_1008547422 68
34 3300005563 Ga0068855_100503127 Ga0068855_1005031272 68
35 3300005564 Ga0070664_101599699 Ga0070664_1015996991 68
36 3300005564 Ga0070664_101930875 Ga0070664_1019308751 68
37 3300005578 Ga0068854_100000031 Ga0068854_100000031106 68
38 3300005614 Ga0068856_100001194 Ga0068856_10000119413 68
39 3300005614 Ga0068856_100022818 Ga0068856_1000228185 68
40 3300005614 Ga0068856_100051634 Ga0068856_1000516343 68
41 3300005834 Ga0068851_10000959 Ga0068851_100009594 68
42 3300005842 Ga0068858_100093496 Ga0068858_1000934962 68
43 3300005842 Ga0068858_100427025 Ga0068858_1004270252 68
44 3300005843 Ga0068860_100062176 Ga0068860_1000621765 68
45 3300005844 Ga0068862_100003429 Ga0068862_1000034292 68
46 3300005985 Ga0081539_10003607 Ga0081539_1000360716 68
47 3300006163 Ga0070715_10000014 Ga0070715_1000001432 68
48 3300006163 Ga0070715_10214217 Ga0070715_102142173 68
49 3300006175 Ga0070712_100000861 Ga0070712_10000086112 68
50 3300006237 Ga0097621_100359705 Ga0097621_1003597053 68
51 3300006846 Ga0075430_100250135 Ga0075430_1002501352 68
52 3300006881 Ga0068865_100000104 Ga0068865_10000010428 68
53 3300009098 Ga0105245_10000545 Ga0105245_1000054538 68
54 3300009098 Ga0105245_10003994 Ga0105245_100039947 68
55 3300009098 Ga0105245_12865057 Ga0105245_128650572 68
56 3300009101 Ga0105247_10000322 Ga0105247_100003221 68
57 3300009101 Ga0105247_10581652 Ga0105247_105816522 68
58 3300009174 Ga0105241_12540201 Ga0105241_125402012 68
59 3300009177 Ga0105248_10000118 Ga0105248_1000011815 68
60 3300009551 Ga0105238_10000033 Ga0105238_1000003322 68
61 3300009551 Ga0105238_12414710 Ga0105238_124147102 68
62 3300009553 Ga0105249_10028269 Ga0105249_100282697 68
63 3300009553 Ga0105249_11963926 Ga0105249_119639262 68
64 3300009553 Ga0105249_12245386 Ga0105249_122453862 68
65 3300010375 Ga0105239_10219646 Ga0105239_102196464 68
66 3300010375 Ga0105239_10802858 Ga0105239_108028583 68
67 3300011119 Ga0105246_10549327 Ga0105246_105493272 68
68 3300013102 Ga0157371_10022809 Ga0157371_100228094 68
69 3300013104 Ga0157370_10182501 Ga0157370_101825013 68
70 3300013104 Ga0157370_10457562 Ga0157370_104575622 68
71 3300013105 Ga0157369_10001239 Ga0157369_1000123928 68
72 3300013297 Ga0157378_10013050 Ga0157378_100130506 68
73 3300013306 Ga0163162_12015959 Ga0163162_120159591 68
74 3300013307 Ga0157372_10000409 Ga0157372_1000040935 68
75 3300013308 Ga0157375_12909823 Ga0157375_129098232 68
76 3300014325 Ga0163163_10158004 Ga0163163_101580043 68
77 3300014968 Ga0157379_10045738 Ga0157379_100457382 68
78 3300014968 Ga0157379_10308085 Ga0157379_103080852 68
79 3300020070 Ga0206356_10513908 Ga0206356_105139082 68
80 3300020082 Ga0206353_11679996 Ga0206353_116799962 68
81 3300025321 Ga0207656_10000116 Ga0207656_1000011617 68
82 3300025885 Ga0207653_10068603 Ga0207653_100686032 68
83 3300025900 Ga0207710_10000158 Ga0207710_1000015821 68
84 3300025905 Ga0207685_10000046 Ga0207685_1000004631 68
85 3300025905 Ga0207685_10340358 Ga0207685_103403582 68
86 3300025909 Ga0207705_10040116 Ga0207705_100401162 68
87 3300025911 Ga0207654_10013399 Ga0207654_100133996 68
88 3300025912 Ga0207707_11158665 Ga0207707_111586652 68
89 3300025915 Ga0207693_10001956 Ga0207693_1000195611 68
90 3300025915 Ga0207693_10458989 Ga0207693_104589892 68
91 3300025915 Ga0207693_10869535 Ga0207693_108695352 68
92 3300025916 Ga0207663_10086968 Ga0207663_100869683 68
93 3300025916 Ga0207663_10158230 Ga0207663_101582301 68
94 3300025920 Ga0207649_10000063 Ga0207649_1000006393 68
95 3300025924 Ga0207694_10000012 Ga0207694_1000001222 68
96 3300025927 Ga0207687_10000007 Ga0207687_10000007276 68
97 3300025927 Ga0207687_10000691 Ga0207687_1000069123 68
98 3300025927 Ga0207687_10007579 Ga0207687_100075791 68
99 3300025928 Ga0207700_10543127 Ga0207700_105431272 68
100 3300025929 Ga0207664_10080276 Ga0207664_100802765 68
101 3300025932 Ga0207690_10003697 Ga0207690_100036972 68
102 3300025936 Ga0207670_10173012 Ga0207670_101730121 68
103 3300025938 Ga0207704_10000146 Ga0207704_1000014615 68
104 3300025941 Ga0207711_10000020 Ga0207711_1000002086 68
105 3300025944 Ga0207661_10009431 Ga0207661_100094314 68
106 3300025945 Ga0207679_11625947 Ga0207679_116259472 68
107 3300025949 Ga0207667_11088675 Ga0207667_110886752 68
108 3300025961 Ga0207712_10007769 Ga0207712_100077699 68
109 3300025961 Ga0207712_11651252 Ga0207712_116512521 68
110 3300025972 Ga0207668_10270350 Ga0207668_102703502 68
111 3300025981 Ga0207640_10000015 Ga0207640_10000015110 68
112 3300025986 Ga0207658_10009541 Ga0207658_100095412 68
113 3300026035 Ga0207703_10184745 Ga0207703_101847453 68
114 3300026035 Ga0207703_10509798 Ga0207703_105097982 68
115 3300026041 Ga0207639_10158244 Ga0207639_101582443 68
116 3300026067 Ga0207678_10771978 Ga0207678_107719782 68
117 3300026078 Ga0207702_10000607 Ga0207702_1000060734 68
118 3300026078 Ga0207702_10003776 Ga0207702_100037765 68
119 3300026078 Ga0207702_10113527 Ga0207702_101135273 68
120 3300026088 Ga0207641_10188348 Ga0207641_101883481 68
121 3300026088 Ga0207641_11021294 Ga0207641_110212942 68
122 3300026089 Ga0207648_10001621 Ga0207648_1000162122 68
123 3300026121 Ga0207683_10095380 Ga0207683_100953803 68
124 3300028379 Ga0268266_10165523 Ga0268266_101655233 68
125 3300028379 Ga0268266_10292065 Ga0268266_102920652 68
126 3300028379 Ga0268266_11264531 Ga0268266_112645312 68
127 3300028380 Ga0268265_10008322 Ga0268265_100083223 68
128 3300028563 Ga0265319_1000079 Ga0265319_100007959 68
129 3300028654 Ga0265322_10073248 Ga0265322_100732481 68
130 3300028800 Ga0265338_10496119 Ga0265338_104961192 68
131 3300035119 Ga0373956_0528071 Ga0373956_0528071_227_433 68
132 3300035724 Ga0373933_0424676 Ga0373933_0424676_397_603 68
133 3300036401 Ga0373937_0010181 Ga0373937_0010181_2175_2381 68
134 3300036401 Ga0373937_0682816 Ga0373937_0682816_582_788 68
135 3300036401 Ga0373937_0778219 Ga0373937_0778219_205_411 68
136 3300036647 Ga0316582_0586420 Ga0316582_0586420_393_599 68
137 3300046454 Ga0495592_0005904 Ga0495592_0005904_7130_7336 68
138 3300046454 Ga0495592_0102551 Ga0495592_0102551_1295_1501 68
139 3300046454 Ga0495592_0198423 Ga0495592_0198423_1076_1285 68
140 3300046454 Ga0495592_0440571 Ga0495592_0440571_342_548 68
141 3300046455 Ga0495603_0006970 Ga0495603_0006970_5309_5515 68
142 3300046455 Ga0495603_0007849 Ga0495603_0007849_2883_3089 68
143 3300046459 Ga0495629_0253675 Ga0495629_0253675_271_477 68
144 3300046459 Ga0495629_0279733 Ga0495629_0279733_54_260 68
145 3300046461 Ga0495641_0489318 Ga0495641_0489318_11_217 68
146 3300046462 Ga0495651_0131772 Ga0495651_0131772_1143_1349 68
147 3300046463 Ga0495653_0019388 Ga0495653_0019388_2150_2356 68
148 3300046463 Ga0495653_0046031 Ga0495653_0046031_1709_1915 68
149 3300046463 Ga0495653_0111120 Ga0495653_0111120_1235_1441 68
150 3300046463 Ga0495653_0129175 Ga0495653_0129175_975_1181 68
151 3300046463 Ga0495653_0404274 Ga0495653_0404274_470_676 68
152 3300046473 Ga0495582_0000003 Ga0495582_0000003_95231_95437 68
153 3300046476 Ga0495662_0000167 Ga0495662_0000167_16061_16267 68
154 3300046476 Ga0495662_0001475 Ga0495662_0001475_9118_9324 68
155 3300046476 Ga0495662_0315347 Ga0495662_0315347_292_498 68
156 3300046476 Ga0495662_0359329 Ga0495662_0359329_409_615 68
157 3300046477 Ga0495664_0261281 Ga0495664_0261281_544_750 68
158 3300046491 Ga0495584_0444533 Ga0495584_0444533_100_306 68
159 3300046511 Ga0495608_0000122 Ga0495608_0000122_27399_27605 68
160 3300046511 Ga0495608_0000189 Ga0495608_0000189_7017_7223 68
161 3300046511 Ga0495608_0225960 Ga0495608_0225960_718_924 68
162 3300046511 Ga0495608_0319342 Ga0495608_0319342_242_448 68
163 3300046514 Ga0495618_0000026 Ga0495618_0000026_27545_27751 68
164 3300046514 Ga0495618_0493612 Ga0495618_0493612_414_629 68
165 3300046516 Ga0495628_0000144 Ga0495628_0000144_17654_17860 68
166 3300046516 Ga0495628_0005318 Ga0495628_0005318_1126_1332 68
167 3300046516 Ga0495628_0024110 Ga0495628_0024110_3157_3363 68
168 3300046516 Ga0495628_0039005 Ga0495628_0039005_710_916 68
169 3300046516 Ga0495628_0301908 Ga0495628_0301908_483_692 68
170 3300046516 Ga0495628_0634525 Ga0495628_0634525_196_402 68
171 3300046517 Ga0495630_0000862 Ga0495630_0000862_11247_11456 68
172 3300046517 Ga0495630_0002718 Ga0495630_0002718_9132_9338 68
173 3300046517 Ga0495630_0009081 Ga0495630_0009081_4061_4267 68
174 3300046517 Ga0495630_0757249 Ga0495630_0757249_246_452 68
175 3300046529 Ga0495652_0000019 Ga0495652_0000019_95783_95989 68
176 3300046529 Ga0495652_0286798 Ga0495652_0286798_363_572 68
177 3300046533 Ga0495640_0048390 Ga0495640_0048390_220_426 68
178 3300046535 Ga0495586_0001432 Ga0495586_0001432_8299_8505 68
179 3300046536 Ga0495587_0004675 Ga0495587_0004675_3826_4035 68
180 3300046536 Ga0495587_0267084 Ga0495587_0267084_126_332 68
181 3300046543 Ga0495645_0003745 Ga0495645_0003745_274_480 68
182 3300046543 Ga0495645_0007267 Ga0495645_0007267_2491_2697 68
183 3300046559 Ga0495667_0000015 Ga0495667_0000015_81220_81426 68
184 3300046642 Ga0495634_0000962 Ga0495634_0000962_14041_14247 68
185 3300046642 Ga0495634_0061478 Ga0495634_0061478_841_1047 68
186 3300046642 Ga0495634_0340395 Ga0495634_0340395_666_872 68
187 3300046642 Ga0495634_0408579 Ga0495634_0408579_515_721 68
188 3300046660 Ga0495625_0000405 Ga0495625_0000405_61668_61874 68
189 3300046663 Ga0495635_0000005 Ga0495635_0000005_155095_155301 68
190 3300046663 Ga0495635_0347099 Ga0495635_0347099_271_477 68
191 3300046663 Ga0495635_0603692 Ga0495635_0603692_489_695 68
192 3300046675 Ga0495657_0000004 Ga0495657_0000004_7017_7223 68
193 3300046675 Ga0495657_0062167 Ga0495657_0062167_2076_2282 68
194 3300046675 Ga0495657_0180691 Ga0495657_0180691_817_1026 68
195 3300046678 Ga0495599_0262613 Ga0495599_0262613_778_984 68
196 3300046678 Ga0495599_0470064 Ga0495599_0470064_15_221 68
197 3300046679 Ga0495623_0409722 Ga0495623_0409722_373_579 68
198 3300046680 Ga0495646_0507620 Ga0495646_0507620_106_312 68
199 3300046681 Ga0495647_0000004 Ga0495647_0000004_46360_46566 68
200 3300046681 Ga0495647_0001032 Ga0495647_0001032_3162_3368 68
201 3300046681 Ga0495647_0153341 Ga0495647_0153341_123_329 68
202 3300046683 Ga0495658_0000001 Ga0495658_0000001_76974_77180 68
203 3300046683 Ga0495658_0020830 Ga0495658_0020830_1107_1313 68
204 3300046683 Ga0495658_0340804 Ga0495658_0340804_346_552 68
205 3300046689 Ga0495613_0000021 Ga0495613_0000021_54377_54583 68
206 3300046689 Ga0495613_0000370 Ga0495613_0000370_23680_23886 68
207 3300046690 Ga0495624_0063469 Ga0495624_0063469_946_1152 68
208 3300046690 Ga0495624_0938578 Ga0495624_0938578_118_324 68
209 3300046809 Ga0495600_0002209 Ga0495600_0002209_7513_7719 68
210 3300046809 Ga0495600_0003663 Ga0495600_0003663_1157_1363 68
211 3300046809 Ga0495600_0080126 Ga0495600_0080126_817_1023 68
212 3300046809 Ga0495600_0404279 Ga0495600_0404279_462_668 68
213 3300046809 Ga0495600_0635442 Ga0495600_0635442_164_370 68
214 3300046809 Ga0495600_0807407 Ga0495600_0807407_33_239 68
215 3300047315 Ga0495581_0339810 Ga0495581_0339810_371_577 68
216 3300047317 Ga0495604_0000089 Ga0495604_0000089_32643_32849 68
217 3300047317 Ga0495604_0001362 Ga0495604_0001362_12773_12979 68
218 3300047317 Ga0495604_0110412 Ga0495604_0110412_1282_1488 68
219 3300047321 Ga0495676_0755010 Ga0495676_0755010_382_588 68
220 3300047322 Ga0495680_0000007 Ga0495680_0000007_16166_16372 68
221 3300047322 Ga0495680_0001062 Ga0495680_0001062_4032_4238 68
222 3300047322 Ga0495680_0039230 Ga0495680_0039230_1058_1267 68
223 3300047322 Ga0495680_0054461 Ga0495680_0054461_1233_1439 68
224 3300047444 Ga0495675_0001341 Ga0495675_0001341_6369_6575 68
225 3300047447 Ga0495685_008517 Ga0495685_008517_1184_1390 68
226 3300047471 Ga0495684_0290491 Ga0495684_0290491_938_1144 68
227 3300047472 Ga0495686_0401387 Ga0495686_0401387_248_454 68
228 3300047673 Ga0495593_0064325 Ga0495593_0064325_816_1022 68
229 3300048088 Ga0495602_0000021 Ga0495602_0000021_135007_135213 68
230 3300048088 Ga0495602_0015275 Ga0495602_0015275_6392_6598 68
231 3300048088 Ga0495602_0324996 Ga0495602_0324996_690_896 68
232 3300048088 Ga0495602_0418301 Ga0495602_0418301_287_493 68
233 3300048088 Ga0495602_1095996 Ga0495602_1095996_53_259 68
234 3300048905 Ga0496102_0013393 Ga0496102_0013393_2856_3062 68
235 3300048905 Ga0496102_0206412 Ga0496102_0206412_957_1163 68
236 3300048906 Ga0496103_0104656 Ga0496103_0104656_855_1061 68
237 3300048906 Ga0496103_0194813 Ga0496103_0194813_572_778 68
238 3300048906 Ga0496103_0402291 Ga0496103_0402291_149_355 68
239 3300048908 Ga0496105_0417761 Ga0496105_0417761_749_958 68
240 3300048908 Ga0496105_0790747 Ga0496105_0790747_401_607 68
241 3300048909 Ga0496106_0838221 Ga0496106_0838221_359_565 68
242 3300048911 Ga0496108_0000001 Ga0496108_0000001_613994_614200 68
243 3300048911 Ga0496108_0536353 Ga0496108_0536353_695_934 68
244 3300048912 Ga0496109_0000003 Ga0496109_0000003_288540_288746 68
245 3300048912 Ga0496109_0000028 Ga0496109_0000028_8409_8615 68
246 3300048912 Ga0496109_0728796 Ga0496109_0728796_581_787 68
247 3300048912 Ga0496109_0833744 Ga0496109_0833744_196_402 68
248 3300048912 Ga0496109_1099969 Ga0496109_1099969_487_693 68
249 3300048913 Ga0496110_0000492 Ga0496110_0000492_11212_11418 68
250 3300048913 Ga0496110_0167691 Ga0496110_0167691_547_753 68
251 3300048914 Ga0496111_0004430 Ga0496111_0004430_6945_7151 68
252 3300048914 Ga0496111_0017629 Ga0496111_0017629_3152_3358 68
253 3300048914 Ga0496111_0451585 Ga0496111_0451585_467_673 68
254 3300048915 Ga0496112_0000013 Ga0496112_0000013_70698_70904 68
255 3300048915 Ga0496112_0003984 Ga0496112_0003984_2618_2824 68
256 3300048916 Ga0496113_0000029 Ga0496113_0000029_28791_28997 68
257 3300048916 Ga0496113_0015692 Ga0496113_0015692_653_859 68
258 3300048916 Ga0496113_0041499 Ga0496113_0041499_2117_2323 68
259 3300048916 Ga0496113_0200772 Ga0496113_0200772_655_861 68
260 3300048920 Ga0496117_0018730 Ga0496117_0018730_143_349 68
261 3300048921 Ga0496118_0000174 Ga0496118_0000174_2690_2896 68
262 3300048922 Ga0496119_0030722 Ga0496119_0030722_1174_1380 68
263 3300048923 Ga0496120_0012344 Ga0496120_0012344_5419_5625 68
264 3300048924 Ga0496121_0010179 Ga0496121_0010179_4014_4220 68
265 3300048924 Ga0496121_0053660 Ga0496121_0053660_712_921 68
266 3300048924 Ga0496121_0131276 Ga0496121_0131276_1313_1519 68
267 3300049571 Ga0501034_0110154 Ga0501034_0110154_1897_2103 68
268 3300049576 Ga0501040_0424754 Ga0501040_0424754_127_333 68
269 3300049579 Ga0501043_0390355 Ga0501043_0390355_481_687 68
270 3300049581 Ga0501047_0119868 Ga0501047_0119868_738_944 68
271 3300049581 Ga0501047_0292939 Ga0501047_0292939_1059_1265 68
272 3300049582 Ga0501048_0432385 Ga0501048_0432385_207_413 68
273 3300049584 Ga0501068_0056488 Ga0501068_0056488_160_366 68
274 3300049585 Ga0501069_0509362 Ga0501069_0509362_327_533 68
275 3300049586 Ga0501070_0015320 Ga0501070_0015320_1789_1995 68
276 3300049586 Ga0501070_0018473 Ga0501070_0018473_1802_2008 68
277 3300049586 Ga0501070_0245279 Ga0501070_0245279_438_644 68
278 3300049586 Ga0501070_1116964 Ga0501070_1116964_118_324 68
279 3300049587 Ga0501071_0048308 Ga0501071_0048308_2447_2653 68
280 3300049590 Ga0501074_0010231 Ga0501074_0010231_871_1077 68
281 3300049590 Ga0501074_0123889 Ga0501074_0123889_1584_1790 68
282 3300049741 Ga0501079_0003195 Ga0501079_0003195_2462_2668 68
283 3300049742 Ga0501080_0120280 Ga0501080_0120280_2109_2315 68
284 3300049742 Ga0501080_0172516 Ga0501080_0172516_905_1111 68
285 3300049742 Ga0501080_1288745 Ga0501080_1288745_255_461 68
286 3300049743 Ga0501081_0012739 Ga0501081_0012739_4922_5128 68
287 3300049744 Ga0501083_0027899 Ga0501083_0027899_749_955 68
288 3300049822 Ga0501035_0359993 Ga0501035_0359993_458_664 68
289 3300049823 Ga0501044_0006622 Ga0501044_0006622_9546_9752 68
290 3300049823 Ga0501044_0119083 Ga0501044_0119083_1432_1638 68
291 3300049823 Ga0501044_1047081 Ga0501044_1047081_376_582 68
292 3300053077 Ga0495601_0000013 Ga0495601_0000013_211258_211464 68
293 3300053077 Ga0495601_0000035 Ga0495601_0000035_54232_54438 68
294 3300053077 Ga0495601_0002976 Ga0495601_0002976_5586_5795 68
295 3300053077 Ga0495601_0021096 Ga0495601_0021096_2923_3129 68
296 3300053077 Ga0495601_0030443 Ga0495601_0030443_1346_1555 68
297 3300053077 Ga0495601_0202876 Ga0495601_0202876_823_1032 68
298 3300053077 Ga0495601_0248004 Ga0495601_0248004_495_701 68
299 3300053077 Ga0495601_0463670 Ga0495601_0463670_534_740 68
300 3300053078 Ga0495612_0000073 Ga0495612_0000073_35208_35414 68
301 3300053078 Ga0495612_0066853 Ga0495612_0066853_419_625 68
302 3300053078 Ga0495612_0557093 Ga0495612_0557093_15_221 68
303 3300053080 Ga0500635_0235086 Ga0500635_0235086_32_238 68
304 3300053083 Ga0495655_0000606 Ga0495655_0000606_5219_5425 68
305 3300053084 Ga0495595_0000003 Ga0495595_0000003_7017_7223 68
306 3300053084 Ga0495595_0000072 Ga0495595_0000072_44807_45013 68
307 3300053084 Ga0495595_0707784 Ga0495595_0707784_28_234 68
308 3300053085 Ga0495619_0000055 Ga0495619_0000055_38636_38842 68
309 3300053085 Ga0495619_0001468 Ga0495619_0001468_7017_7223 68
310 3300053085 Ga0495619_0006453 Ga0495619_0006453_6490_6696 68
311 3300053085 Ga0495619_0020317 Ga0495619_0020317_2802_3008 68
312 3300053085 Ga0495619_0051935 Ga0495619_0051935_2392_2598 68
313 3300053085 Ga0495619_0353049 Ga0495619_0353049_143_349 68
314 3300053085 Ga0495619_0464640 Ga0495619_0464640_274_480 68
315 3300053085 Ga0495619_0617438 Ga0495619_0617438_503_709 68
316 3300053139 Ga0500568_0226808 Ga0500568_0226808_297_503 68
317 3300060353 Ga0501082_2017566 Ga0501082_2017566_152_358 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06902

Fer4_19

Divergent 4Fe-4S mono-cluster

4

61

0.94

PF13459

Fer4_15

4Fe-4S single cluster domain

6

58

0.88

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

7

58

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fxr-assembly1.cif.gz_B crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution 0.9018 2 60
1vjw-assembly1.cif.gz_A structure of oxidoreductase (nadp+(a),ferredoxin(a)) 0.8999 5 56
1siz-assembly1.cif.gz_C crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus 0.899 2 59
4id8-assembly1.cif.gz_A the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 0.8974 5 60
8amp-assembly1.cif.gz_A crystal structure of m.tuberculosis ferredoxin fdx 0.8662 2 59
ID Description Score Start End Superfamily
af_X1WD81_432_596_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9686 55 67 2.40.128.630
af_Q54J80_58_125_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.9589 55 66 2.20.110.10
af_Q5JNF3_161_221_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9406 5 55 3.30.70.20
af_A4I292_309_574_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9386 54 67 2.130.10.10
af_I6X7H4_1_61_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9096 4 56 3.30.70.20

Feature Viewer

pLDDT pTM Quality
96.58 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map