F404076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 182 | 317 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100022818|Ga0068856_1000228185 |
| Length | 69 |
| Sequence | MTYVPVVDPDECSAHGDCVEVAPEVFRLDDDVAVVIGTGPFEKVLEAAESCPAVAISVVDEEKGETVFP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 101 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 156 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 177 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 181 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 182 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.95 |
| Nodule | 0 |
| Rhizoplane | 8.2 |
| Rhizosphere | 88.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000314 | 3300001979 | Bacteria | 20684 |
| 2 | JGI24751J29686_10076443 | 3300002459 | Bacteria | 692 |
| 3 | JGI25406J46586_10083529 | 3300003203 | Bacteria | 975 |
| 4 | Ga0070683_100014460 | 3300005329 | Bacteria | 6903 |
| 5 | Ga0070680_100927542 | 3300005336 | Unclassified | 751 |
| 6 | Ga0070682_100000045 | 3300005337 | Bacteria | 131960 |
| 7 | Ga0070682_101604311 | 3300005337 | Unclassified | 562 |
| 8 | Ga0070689_100291845 | 3300005340 | Unclassified | 1355 |
| 9 | Ga0070661_100000023 | 3300005344 | Bacteria | 123104 |
| 10 | Ga0070668_100849303 | 3300005347 | Bacteria | 813 |
| 11 | Ga0070688_100010011 | 3300005365 | Bacteria | 5209 |
| 12 | Ga0070659_100007823 | 3300005366 | Bacteria | 7778 |
| 13 | Ga0070667_100063530 | 3300005367 | Bacteria | 3129 |
| 14 | Ga0070703_10081228 | 3300005406 | Unclassified | 1104 |
| 15 | Ga0070714_100232723 | 3300005435 | Bacteria | 1698 |
| 16 | Ga0070713_100185876 | 3300005436 | Bacteria | 1870 |
| 17 | Ga0070711_100017653 | 3300005439 | Bacteria | 4546 |
| 18 | Ga0070711_100196179 | 3300005439 | Bacteria | 1555 |
| 19 | Ga0070663_100713456 | 3300005455 | Unclassified | 853 |
| 20 | Ga0070678_100119920 | 3300005456 | Bacteria | 2073 |
| 21 | Ga0070681_11884560 | 3300005458 | Unclassified | 525 |
| 22 | Ga0068867_100000556 | 3300005459 | Bacteria | 24623 |
| 23 | Ga0070685_10045967 | 3300005466 | Bacteria | 2505 |
| 24 | Ga0070684_100018798 | 3300005535 | Bacteria | 5701 |
| 25 | Ga0070684_100310094 | 3300005535 | Unclassified | 1449 |
| 26 | Ga0068853_100453804 | 3300005539 | Bacteria | 1206 |
| 27 | Ga0070696_100706655 | 3300005546 | Unclassified | 822 |
| 28 | Ga0070693_100258512 | 3300005547 | Unclassified | 1157 |
| 29 | Ga0070665_100108520 | 3300005548 | Bacteria | 2778 |
| 30 | Ga0070665_100131709 | 3300005548 | Bacteria | 2503 |
| 31 | Ga0070665_100854742 | 3300005548 | Bacteria | 923 |
| 32 | Ga0068855_100503127 | 3300005563 | Bacteria | 1316 |
| 33 | Ga0070664_101599699 | 3300005564 | Bacteria | 617 |
| 34 | Ga0070664_101930875 | 3300005564 | Unclassified | 560 |
| 35 | Ga0068854_100000031 | 3300005578 | Bacteria | 107298 |
| 36 | Ga0068856_100001194 | 3300005614 | Bacteria | 27371 |
| 37 | Ga0068856_100022818 | 3300005614 | Bacteria | 6087 |
| 38 | Ga0068856_100051634 | 3300005614 | Bacteria | 4054 |
| 39 | Ga0068851_10000959 | 3300005834 | Bacteria | 12486 |
| 40 | Ga0068858_100093496 | 3300005842 | Bacteria | 2799 |
| 41 | Ga0068858_100427025 | 3300005842 | Bacteria | 1275 |
| 42 | Ga0068860_100062176 | 3300005843 | Bacteria | 3548 |
| 43 | Ga0068862_100003429 | 3300005844 | Bacteria | 13641 |
| 44 | Ga0081539_10003607 | 3300005985 | Bacteria | 18723 |
| 45 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 46 | Ga0070715_10214217 | 3300006163 | Unclassified | 986 |
| 47 | Ga0070712_100000861 | 3300006175 | Bacteria | 18065 |
| 48 | Ga0097621_100359705 | 3300006237 | Unclassified | 1296 |
| 49 | Ga0075430_100250135 | 3300006846 | Bacteria | 1469 |
| 50 | Ga0068865_100000104 | 3300006881 | Bacteria | 43423 |
| 51 | Ga0105245_10000545 | 3300009098 | Bacteria | 34359 |
| 52 | Ga0105245_10003994 | 3300009098 | Bacteria | 13105 |
| 53 | Ga0105245_12865057 | 3300009098 | Unclassified | 535 |
| 54 | Ga0105247_10000322 | 3300009101 | Bacteria | 42918 |
| 55 | Ga0105247_10581652 | 3300009101 | Bacteria | 828 |
| 56 | Ga0105241_12540201 | 3300009174 | Unclassified | 513 |
| 57 | Ga0105248_10000118 | 3300009177 | Bacteria | 90018 |
| 58 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 59 | Ga0105238_12414710 | 3300009551 | Bacteria | 561 |
| 60 | Ga0105249_10028269 | 3300009553 | Bacteria | 5062 |
| 61 | Ga0105249_11963926 | 3300009553 | Bacteria | 658 |
| 62 | Ga0105249_12245386 | 3300009553 | Bacteria | 618 |
| 63 | Ga0105239_10219646 | 3300010375 | Bacteria | 2131 |
| 64 | Ga0105239_10802858 | 3300010375 | Bacteria | 1078 |
| 65 | Ga0105246_10549327 | 3300011119 | Bacteria | 990 |
| 66 | Ga0157371_10022809 | 3300013102 | Bacteria | 4579 |
| 67 | Ga0157370_10182501 | 3300013104 | Unclassified | 1950 |
| 68 | Ga0157370_10457562 | 3300013104 | Bacteria | 1173 |
| 69 | Ga0157369_10001239 | 3300013105 | Bacteria | 31838 |
| 70 | Ga0157378_10013050 | 3300013297 | Bacteria | 7267 |
| 71 | Ga0163162_12015959 | 3300013306 | Bacteria | 661 |
| 72 | Ga0157372_10000409 | 3300013307 | Bacteria | 47021 |
| 73 | Ga0157375_12909823 | 3300013308 | Unclassified | 572 |
| 74 | Ga0163163_10158004 | 3300014325 | Unclassified | 2312 |
| 75 | Ga0157379_10045738 | 3300014968 | Bacteria | 3907 |
| 76 | Ga0157379_10308085 | 3300014968 | Bacteria | 1444 |
| 77 | Ga0206356_10513908 | 3300020070 | Bacteria | 3568 |
| 78 | Ga0206353_11679996 | 3300020082 | Bacteria | 823 |
| 79 | Ga0207656_10000116 | 3300025321 | Bacteria | 30697 |
| 80 | Ga0207653_10068603 | 3300025885 | Unclassified | 1208 |
| 81 | Ga0207710_10000158 | 3300025900 | Bacteria | 72527 |
| 82 | Ga0207685_10000046 | 3300025905 | Bacteria | 46018 |
| 83 | Ga0207685_10340358 | 3300025905 | Bacteria | 753 |
| 84 | Ga0207705_10040116 | 3300025909 | Bacteria | 3357 |
| 85 | Ga0207654_10013399 | 3300025911 | Bacteria | 4218 |
| 86 | Ga0207707_11158665 | 3300025912 | Unclassified | 627 |
| 87 | Ga0207693_10001956 | 3300025915 | Bacteria | 18065 |
| 88 | Ga0207693_10458989 | 3300025915 | Unclassified | 995 |
| 89 | Ga0207693_10869535 | 3300025915 | Bacteria | 693 |
| 90 | Ga0207663_10086968 | 3300025916 | Bacteria | 2063 |
| 91 | Ga0207663_10158230 | 3300025916 | Bacteria | 1596 |
| 92 | Ga0207649_10000063 | 3300025920 | Bacteria | 96360 |
| 93 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 94 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 95 | Ga0207687_10000691 | 3300025927 | Bacteria | 22768 |
| 96 | Ga0207687_10007579 | 3300025927 | Bacteria | 7136 |
| 97 | Ga0207700_10543127 | 3300025928 | Bacteria | 1031 |
| 98 | Ga0207664_10080276 | 3300025929 | Bacteria | 2651 |
| 99 | Ga0207690_10003697 | 3300025932 | Bacteria | 9103 |
| 100 | Ga0207670_10173012 | 3300025936 | Unclassified | 1621 |
| 101 | Ga0207704_10000146 | 3300025938 | Bacteria | 37894 |
| 102 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 103 | Ga0207661_10009431 | 3300025944 | Bacteria | 7001 |
| 104 | Ga0207679_11625947 | 3300025945 | Unclassified | 592 |
| 105 | Ga0207667_11088675 | 3300025949 | Unclassified | 783 |
| 106 | Ga0207712_10007769 | 3300025961 | Bacteria | 6781 |
| 107 | Ga0207712_11651252 | 3300025961 | Bacteria | 574 |
| 108 | Ga0207668_10270350 | 3300025972 | Bacteria | 1389 |
| 109 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 110 | Ga0207658_10009541 | 3300025986 | Bacteria | 6588 |
| 111 | Ga0207703_10184745 | 3300026035 | Bacteria | 1842 |
| 112 | Ga0207703_10509798 | 3300026035 | Bacteria | 1130 |
| 113 | Ga0207639_10158244 | 3300026041 | Bacteria | 1906 |
| 114 | Ga0207678_10771978 | 3300026067 | Unclassified | 848 |
| 115 | Ga0207702_10000607 | 3300026078 | Bacteria | 39638 |
| 116 | Ga0207702_10003776 | 3300026078 | Bacteria | 13676 |
| 117 | Ga0207702_10113527 | 3300026078 | Bacteria | 2413 |
| 118 | Ga0207641_10188348 | 3300026088 | Bacteria | 1895 |
| 119 | Ga0207641_11021294 | 3300026088 | Bacteria | 824 |
| 120 | Ga0207648_10001621 | 3300026089 | Bacteria | 24664 |
| 121 | Ga0207683_10095380 | 3300026121 | Bacteria | 2652 |
| 122 | Ga0268266_10165523 | 3300028379 | Bacteria | 2003 |
| 123 | Ga0268266_10292065 | 3300028379 | Bacteria | 1518 |
| 124 | Ga0268266_11264531 | 3300028379 | Unclassified | 713 |
| 125 | Ga0268265_10008322 | 3300028380 | Bacteria | 7004 |
| 126 | Ga0265319_1000079 | 3300028563 | Bacteria | 75683 |
| 127 | Ga0265322_10073248 | 3300028654 | Bacteria | 972 |
| 128 | Ga0265338_10496119 | 3300028800 | Unclassified | 860 |
| 129 | Ga0373956_0528071 | 3300035119 | Bacteria | 563 |
| 130 | Ga0373933_0424676 | 3300035724 | Unclassified | 868 |
| 131 | Ga0373937_0010181 | 3300036401 | Bacteria | 8202 |
| 132 | Ga0373937_0682816 | 3300036401 | Bacteria | 973 |
| 133 | Ga0373937_0778219 | 3300036401 | Bacteria | 905 |
| 134 | Ga0316582_0586420 | 3300036647 | Bacteria | 768 |
| 135 | Ga0495592_0005904 | 3300046454 | Bacteria | 9090 |
| 136 | Ga0495592_0102551 | 3300046454 | Bacteria | 2037 |
| 137 | Ga0495592_0198423 | 3300046454 | Bacteria | 1356 |
| 138 | Ga0495592_0440571 | 3300046454 | Unclassified | 818 |
| 139 | Ga0495603_0006970 | 3300046455 | Bacteria | 6781 |
| 140 | Ga0495603_0007849 | 3300046455 | Bacteria | 6434 |
| 141 | Ga0495629_0253675 | 3300046459 | Bacteria | 1210 |
| 142 | Ga0495629_0279733 | 3300046459 | Bacteria | 1145 |
| 143 | Ga0495641_0489318 | 3300046461 | Bacteria | 561 |
| 144 | Ga0495651_0131772 | 3300046462 | Unclassified | 1824 |
| 145 | Ga0495653_0019388 | 3300046463 | Bacteria | 5517 |
| 146 | Ga0495653_0046031 | 3300046463 | Bacteria | 3378 |
| 147 | Ga0495653_0111120 | 3300046463 | Bacteria | 1969 |
| 148 | Ga0495653_0129175 | 3300046463 | Bacteria | 1791 |
| 149 | Ga0495653_0404274 | 3300046463 | Bacteria | 867 |
| 150 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 151 | Ga0495662_0000167 | 3300046476 | Bacteria | 25884 |
| 152 | Ga0495662_0001475 | 3300046476 | Bacteria | 11641 |
| 153 | Ga0495662_0315347 | 3300046476 | Bacteria | 769 |
| 154 | Ga0495662_0359329 | 3300046476 | Bacteria | 716 |
| 155 | Ga0495664_0261281 | 3300046477 | Bacteria | 1047 |
| 156 | Ga0495584_0444533 | 3300046491 | Unclassified | 659 |
| 157 | Ga0495608_0000122 | 3300046511 | Bacteria | 55708 |
| 158 | Ga0495608_0000189 | 3300046511 | Bacteria | 43800 |
| 159 | Ga0495608_0225960 | 3300046511 | Bacteria | 1173 |
| 160 | Ga0495608_0319342 | 3300046511 | Unclassified | 960 |
| 161 | Ga0495618_0000026 | 3300046514 | Bacteria | 113266 |
| 162 | Ga0495618_0493612 | 3300046514 | Unclassified | 739 |
| 163 | Ga0495628_0000144 | 3300046516 | Bacteria | 61254 |
| 164 | Ga0495628_0005318 | 3300046516 | Bacteria | 11293 |
| 165 | Ga0495628_0024110 | 3300046516 | Bacteria | 4984 |
| 166 | Ga0495628_0039005 | 3300046516 | Bacteria | 3801 |
| 167 | Ga0495628_0301908 | 3300046516 | Unclassified | 1185 |
| 168 | Ga0495628_0634525 | 3300046516 | Unclassified | 760 |
| 169 | Ga0495630_0000862 | 3300046517 | Bacteria | 21408 |
| 170 | Ga0495630_0002718 | 3300046517 | Bacteria | 12266 |
| 171 | Ga0495630_0009081 | 3300046517 | Bacteria | 7145 |
| 172 | Ga0495630_0757249 | 3300046517 | Bacteria | 742 |
| 173 | Ga0495652_0000019 | 3300046529 | Bacteria | 190248 |
| 174 | Ga0495652_0018825 | 3300046529 | Bacteria | 6153 |
| 175 | Ga0495652_0286798 | 3300046529 | Bacteria | 1203 |
| 176 | Ga0495640_0048390 | 3300046533 | Bacteria | 2938 |
| 177 | Ga0495586_0001432 | 3300046535 | Bacteria | 13200 |
| 178 | Ga0495587_0004675 | 3300046536 | Bacteria | 8993 |
| 179 | Ga0495587_0267084 | 3300046536 | Bacteria | 960 |
| 180 | Ga0495645_0003745 | 3300046543 | Bacteria | 10334 |
| 181 | Ga0495645_0007267 | 3300046543 | Bacteria | 7706 |
| 182 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 183 | Ga0495634_0000962 | 3300046642 | Bacteria | 27234 |
| 184 | Ga0495634_0061478 | 3300046642 | Bacteria | 2497 |
| 185 | Ga0495634_0340395 | 3300046642 | Bacteria | 900 |
| 186 | Ga0495634_0408579 | 3300046642 | Bacteria | 805 |
| 187 | Ga0495625_0000405 | 3300046660 | Bacteria | 65434 |
| 188 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 189 | Ga0495635_0347099 | 3300046663 | Bacteria | 990 |
| 190 | Ga0495635_0603692 | 3300046663 | Bacteria | 716 |
| 191 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 192 | Ga0495657_0062167 | 3300046675 | Bacteria | 2468 |
| 193 | Ga0495657_0180691 | 3300046675 | Bacteria | 1295 |
| 194 | Ga0495599_0262613 | 3300046678 | Bacteria | 1049 |
| 195 | Ga0495599_0470064 | 3300046678 | Bacteria | 743 |
| 196 | Ga0495623_0409722 | 3300046679 | Bacteria | 728 |
| 197 | Ga0495646_0507620 | 3300046680 | Unclassified | 619 |
| 198 | Ga0495647_0000004 | 3300046681 | Bacteria | 140700 |
| 199 | Ga0495647_0001032 | 3300046681 | Bacteria | 8495 |
| 200 | Ga0495647_0153341 | 3300046681 | Bacteria | 989 |
| 201 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 202 | Ga0495658_0020830 | 3300046683 | Bacteria | 3448 |
| 203 | Ga0495658_0340804 | 3300046683 | Unclassified | 952 |
| 204 | Ga0495613_0000021 | 3300046689 | Bacteria | 159188 |
| 205 | Ga0495613_0000370 | 3300046689 | Bacteria | 38906 |
| 206 | Ga0495624_0063469 | 3300046690 | Bacteria | 2309 |
| 207 | Ga0495624_0938578 | 3300046690 | Unclassified | 508 |
| 208 | Ga0495600_0002209 | 3300046809 | Bacteria | 11062 |
| 209 | Ga0495600_0003663 | 3300046809 | Bacteria | 9071 |
| 210 | Ga0495600_0080126 | 3300046809 | Unclassified | 2132 |
| 211 | Ga0495600_0404279 | 3300046809 | Bacteria | 849 |
| 212 | Ga0495600_0635442 | 3300046809 | Bacteria | 646 |
| 213 | Ga0495600_0807407 | 3300046809 | Unclassified | 558 |
| 214 | Ga0495581_0339810 | 3300047315 | Bacteria | 877 |
| 215 | Ga0495604_0000089 | 3300047317 | Bacteria | 77741 |
| 216 | Ga0495604_0001362 | 3300047317 | Bacteria | 19995 |
| 217 | Ga0495604_0110412 | 3300047317 | Bacteria | 2006 |
| 218 | Ga0495676_0755010 | 3300047321 | Bacteria | 628 |
| 219 | Ga0495680_0000007 | 3300047322 | Bacteria | 152053 |
| 220 | Ga0495680_0001062 | 3300047322 | Bacteria | 30410 |
| 221 | Ga0495680_0039230 | 3300047322 | Bacteria | 3779 |
| 222 | Ga0495680_0054461 | 3300047322 | Bacteria | 3106 |
| 223 | Ga0495675_0001341 | 3300047444 | Bacteria | 14909 |
| 224 | Ga0495685_008517 | 3300047447 | Bacteria | 3409 |
| 225 | Ga0495684_0290491 | 3300047471 | Unclassified | 1177 |
| 226 | Ga0495686_0401387 | 3300047472 | Bacteria | 736 |
| 227 | Ga0495593_0064325 | 3300047673 | Bacteria | 1915 |
| 228 | Ga0495602_0000021 | 3300048088 | Bacteria | 168585 |
| 229 | Ga0495602_0015275 | 3300048088 | Bacteria | 7755 |
| 230 | Ga0495602_0324996 | 3300048088 | Bacteria | 1118 |
| 231 | Ga0495602_0418301 | 3300048088 | Bacteria | 952 |
| 232 | Ga0495602_1095996 | 3300048088 | Bacteria | 522 |
| 233 | Ga0496102_0013393 | 3300048905 | Bacteria | 7104 |
| 234 | Ga0496102_0206412 | 3300048905 | Bacteria | 1852 |
| 235 | Ga0496103_0104656 | 3300048906 | Bacteria | 1794 |
| 236 | Ga0496103_0194813 | 3300048906 | Bacteria | 1303 |
| 237 | Ga0496103_0402291 | 3300048906 | Bacteria | 879 |
| 238 | Ga0496105_0417761 | 3300048908 | Bacteria | 1062 |
| 239 | Ga0496105_0790747 | 3300048908 | Unclassified | 722 |
| 240 | Ga0496106_0838221 | 3300048909 | Unclassified | 728 |
| 241 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 242 | Ga0496108_0536353 | 3300048911 | Unclassified | 1021 |
| 243 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 244 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 245 | Ga0496109_0728796 | 3300048912 | Unclassified | 929 |
| 246 | Ga0496109_0833744 | 3300048912 | Bacteria | 860 |
| 247 | Ga0496109_1099969 | 3300048912 | Bacteria | 732 |
| 248 | Ga0496110_0000492 | 3300048913 | Bacteria | 26887 |
| 249 | Ga0496110_0167691 | 3300048913 | Bacteria | 1992 |
| 250 | Ga0496111_0004430 | 3300048914 | Bacteria | 8875 |
| 251 | Ga0496111_0017629 | 3300048914 | Bacteria | 4937 |
| 252 | Ga0496111_0451585 | 3300048914 | Bacteria | 948 |
| 253 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 254 | Ga0496112_0003984 | 3300048915 | Bacteria | 12374 |
| 255 | Ga0496113_0000029 | 3300048916 | Bacteria | 61873 |
| 256 | Ga0496113_0015692 | 3300048916 | Bacteria | 5216 |
| 257 | Ga0496113_0041499 | 3300048916 | Bacteria | 3396 |
| 258 | Ga0496113_0200772 | 3300048916 | Bacteria | 1585 |
| 259 | Ga0496117_0018730 | 3300048920 | Bacteria | 5718 |
| 260 | Ga0496118_0000174 | 3300048921 | Bacteria | 115950 |
| 261 | Ga0496119_0030722 | 3300048922 | Bacteria | 3617 |
| 262 | Ga0496120_0012344 | 3300048923 | Bacteria | 5821 |
| 263 | Ga0496121_0010179 | 3300048924 | Bacteria | 10648 |
| 264 | Ga0496121_0053660 | 3300048924 | Bacteria | 3375 |
| 265 | Ga0496121_0131276 | 3300048924 | Bacteria | 1874 |
| 266 | Ga0501034_0110154 | 3300049571 | Bacteria | 2745 |
| 267 | Ga0501040_0424754 | 3300049576 | Bacteria | 955 |
| 268 | Ga0501043_0390355 | 3300049579 | Bacteria | 1053 |
| 269 | Ga0501047_0119868 | 3300049581 | Bacteria | 2513 |
| 270 | Ga0501047_0292939 | 3300049581 | Bacteria | 1471 |
| 271 | Ga0501048_0432385 | 3300049582 | Bacteria | 942 |
| 272 | Ga0501068_0056488 | 3300049584 | Bacteria | 2380 |
| 273 | Ga0501069_0509362 | 3300049585 | Unclassified | 718 |
| 274 | Ga0501070_0015320 | 3300049586 | Bacteria | 6450 |
| 275 | Ga0501070_0018473 | 3300049586 | Bacteria | 5850 |
| 276 | Ga0501070_0245279 | 3300049586 | Unclassified | 1466 |
| 277 | Ga0501070_1116964 | 3300049586 | Unclassified | 607 |
| 278 | Ga0501071_0048308 | 3300049587 | Bacteria | 3060 |
| 279 | Ga0501074_0010231 | 3300049590 | Bacteria | 6806 |
| 280 | Ga0501074_0123889 | 3300049590 | Bacteria | 1848 |
| 281 | Ga0501079_0003195 | 3300049741 | Bacteria | 12004 |
| 282 | Ga0501080_0120280 | 3300049742 | Bacteria | 2434 |
| 283 | Ga0501080_0172516 | 3300049742 | Bacteria | 1994 |
| 284 | Ga0501080_1288745 | 3300049742 | Bacteria | 626 |
| 285 | Ga0501081_0012739 | 3300049743 | Bacteria | 5531 |
| 286 | Ga0501083_0027899 | 3300049744 | Bacteria | 3893 |
| 287 | Ga0501035_0359993 | 3300049822 | Bacteria | 1216 |
| 288 | Ga0501044_0006622 | 3300049823 | Bacteria | 12779 |
| 289 | Ga0501044_0119083 | 3300049823 | Bacteria | 2643 |
| 290 | Ga0501044_1047081 | 3300049823 | Unclassified | 687 |
| 291 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 292 | Ga0495601_0000035 | 3300053077 | Bacteria | 92903 |
| 293 | Ga0495601_0002976 | 3300053077 | Bacteria | 9645 |
| 294 | Ga0495601_0021096 | 3300053077 | Bacteria | 3986 |
| 295 | Ga0495601_0030443 | 3300053077 | Bacteria | 3351 |
| 296 | Ga0495601_0202876 | 3300053077 | Unclassified | 1295 |
| 297 | Ga0495601_0248004 | 3300053077 | Bacteria | 1163 |
| 298 | Ga0495601_0463670 | 3300053077 | Bacteria | 819 |
| 299 | Ga0495612_0000073 | 3300053078 | Bacteria | 45639 |
| 300 | Ga0495612_0066853 | 3300053078 | Bacteria | 1494 |
| 301 | Ga0495612_0557093 | 3300053078 | Bacteria | 528 |
| 302 | Ga0500635_0235086 | 3300053080 | Bacteria | 717 |
| 303 | Ga0495655_0000606 | 3300053083 | Bacteria | 5851 |
| 304 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 305 | Ga0495595_0000072 | 3300053084 | Bacteria | 49973 |
| 306 | Ga0495595_0707784 | 3300053084 | Bacteria | 516 |
| 307 | Ga0495619_0000055 | 3300053085 | Bacteria | 95570 |
| 308 | Ga0495619_0001468 | 3300053085 | Bacteria | 15538 |
| 309 | Ga0495619_0006453 | 3300053085 | Bacteria | 7426 |
| 310 | Ga0495619_0020317 | 3300053085 | Bacteria | 4228 |
| 311 | Ga0495619_0051935 | 3300053085 | Unclassified | 2710 |
| 312 | Ga0495619_0353049 | 3300053085 | Bacteria | 1017 |
| 313 | Ga0495619_0464640 | 3300053085 | Unclassified | 872 |
| 314 | Ga0495619_0617438 | 3300053085 | Bacteria | 741 |
| 315 | Ga0500595_018669 | 3300053119 | Bacteria | 2532 |
| 316 | Ga0500568_0226808 | 3300053139 | Bacteria | 682 |
| 317 | Ga0501082_2017566 | 3300060353 | Unclassified | 503 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053119 | Ga0500595_018669 | Ga0500595_018669_1957_2148 | 63 |
| 2 | 3300046529 | Ga0495652_0018825 | Ga0495652_0018825_3828_4031 | 67 |
| 3 | 3300001979 | JGI24740J21852_10000314 | JGI24740J21852_100003142 | 68 |
| 4 | 3300002459 | JGI24751J29686_10076443 | JGI24751J29686_100764432 | 68 |
| 5 | 3300003203 | JGI25406J46586_10083529 | JGI25406J46586_100835292 | 68 |
| 6 | 3300005329 | Ga0070683_100014460 | Ga0070683_1000144604 | 68 |
| 7 | 3300005336 | Ga0070680_100927542 | Ga0070680_1009275422 | 68 |
| 8 | 3300005337 | Ga0070682_100000045 | Ga0070682_10000004540 | 68 |
| 9 | 3300005337 | Ga0070682_101604311 | Ga0070682_1016043111 | 68 |
| 10 | 3300005340 | Ga0070689_100291845 | Ga0070689_1002918451 | 68 |
| 11 | 3300005344 | Ga0070661_100000023 | Ga0070661_100000023119 | 68 |
| 12 | 3300005347 | Ga0070668_100849303 | Ga0070668_1008493032 | 68 |
| 13 | 3300005365 | Ga0070688_100010011 | Ga0070688_1000100115 | 68 |
| 14 | 3300005366 | Ga0070659_100007823 | Ga0070659_1000078239 | 68 |
| 15 | 3300005367 | Ga0070667_100063530 | Ga0070667_1000635304 | 68 |
| 16 | 3300005406 | Ga0070703_10081228 | Ga0070703_100812282 | 68 |
| 17 | 3300005435 | Ga0070714_100232723 | Ga0070714_1002327233 | 68 |
| 18 | 3300005436 | Ga0070713_100185876 | Ga0070713_1001858762 | 68 |
| 19 | 3300005439 | Ga0070711_100017653 | Ga0070711_1000176532 | 68 |
| 20 | 3300005439 | Ga0070711_100196179 | Ga0070711_1001961792 | 68 |
| 21 | 3300005455 | Ga0070663_100713456 | Ga0070663_1007134562 | 68 |
| 22 | 3300005456 | Ga0070678_100119920 | Ga0070678_1001199202 | 68 |
| 23 | 3300005458 | Ga0070681_11884560 | Ga0070681_118845601 | 68 |
| 24 | 3300005459 | Ga0068867_100000556 | Ga0068867_1000005568 | 68 |
| 25 | 3300005466 | Ga0070685_10045967 | Ga0070685_100459672 | 68 |
| 26 | 3300005535 | Ga0070684_100018798 | Ga0070684_1000187987 | 68 |
| 27 | 3300005535 | Ga0070684_100310094 | Ga0070684_1003100942 | 68 |
| 28 | 3300005539 | Ga0068853_100453804 | Ga0068853_1004538042 | 68 |
| 29 | 3300005546 | Ga0070696_100706655 | Ga0070696_1007066552 | 68 |
| 30 | 3300005547 | Ga0070693_100258512 | Ga0070693_1002585122 | 68 |
| 31 | 3300005548 | Ga0070665_100108520 | Ga0070665_1001085203 | 68 |
| 32 | 3300005548 | Ga0070665_100131709 | Ga0070665_1001317094 | 68 |
| 33 | 3300005548 | Ga0070665_100854742 | Ga0070665_1008547422 | 68 |
| 34 | 3300005563 | Ga0068855_100503127 | Ga0068855_1005031272 | 68 |
| 35 | 3300005564 | Ga0070664_101599699 | Ga0070664_1015996991 | 68 |
| 36 | 3300005564 | Ga0070664_101930875 | Ga0070664_1019308751 | 68 |
| 37 | 3300005578 | Ga0068854_100000031 | Ga0068854_100000031106 | 68 |
| 38 | 3300005614 | Ga0068856_100001194 | Ga0068856_10000119413 | 68 |
| 39 | 3300005614 | Ga0068856_100022818 | Ga0068856_1000228185 | 68 |
| 40 | 3300005614 | Ga0068856_100051634 | Ga0068856_1000516343 | 68 |
| 41 | 3300005834 | Ga0068851_10000959 | Ga0068851_100009594 | 68 |
| 42 | 3300005842 | Ga0068858_100093496 | Ga0068858_1000934962 | 68 |
| 43 | 3300005842 | Ga0068858_100427025 | Ga0068858_1004270252 | 68 |
| 44 | 3300005843 | Ga0068860_100062176 | Ga0068860_1000621765 | 68 |
| 45 | 3300005844 | Ga0068862_100003429 | Ga0068862_1000034292 | 68 |
| 46 | 3300005985 | Ga0081539_10003607 | Ga0081539_1000360716 | 68 |
| 47 | 3300006163 | Ga0070715_10000014 | Ga0070715_1000001432 | 68 |
| 48 | 3300006163 | Ga0070715_10214217 | Ga0070715_102142173 | 68 |
| 49 | 3300006175 | Ga0070712_100000861 | Ga0070712_10000086112 | 68 |
| 50 | 3300006237 | Ga0097621_100359705 | Ga0097621_1003597053 | 68 |
| 51 | 3300006846 | Ga0075430_100250135 | Ga0075430_1002501352 | 68 |
| 52 | 3300006881 | Ga0068865_100000104 | Ga0068865_10000010428 | 68 |
| 53 | 3300009098 | Ga0105245_10000545 | Ga0105245_1000054538 | 68 |
| 54 | 3300009098 | Ga0105245_10003994 | Ga0105245_100039947 | 68 |
| 55 | 3300009098 | Ga0105245_12865057 | Ga0105245_128650572 | 68 |
| 56 | 3300009101 | Ga0105247_10000322 | Ga0105247_100003221 | 68 |
| 57 | 3300009101 | Ga0105247_10581652 | Ga0105247_105816522 | 68 |
| 58 | 3300009174 | Ga0105241_12540201 | Ga0105241_125402012 | 68 |
| 59 | 3300009177 | Ga0105248_10000118 | Ga0105248_1000011815 | 68 |
| 60 | 3300009551 | Ga0105238_10000033 | Ga0105238_1000003322 | 68 |
| 61 | 3300009551 | Ga0105238_12414710 | Ga0105238_124147102 | 68 |
| 62 | 3300009553 | Ga0105249_10028269 | Ga0105249_100282697 | 68 |
| 63 | 3300009553 | Ga0105249_11963926 | Ga0105249_119639262 | 68 |
| 64 | 3300009553 | Ga0105249_12245386 | Ga0105249_122453862 | 68 |
| 65 | 3300010375 | Ga0105239_10219646 | Ga0105239_102196464 | 68 |
| 66 | 3300010375 | Ga0105239_10802858 | Ga0105239_108028583 | 68 |
| 67 | 3300011119 | Ga0105246_10549327 | Ga0105246_105493272 | 68 |
| 68 | 3300013102 | Ga0157371_10022809 | Ga0157371_100228094 | 68 |
| 69 | 3300013104 | Ga0157370_10182501 | Ga0157370_101825013 | 68 |
| 70 | 3300013104 | Ga0157370_10457562 | Ga0157370_104575622 | 68 |
| 71 | 3300013105 | Ga0157369_10001239 | Ga0157369_1000123928 | 68 |
| 72 | 3300013297 | Ga0157378_10013050 | Ga0157378_100130506 | 68 |
| 73 | 3300013306 | Ga0163162_12015959 | Ga0163162_120159591 | 68 |
| 74 | 3300013307 | Ga0157372_10000409 | Ga0157372_1000040935 | 68 |
| 75 | 3300013308 | Ga0157375_12909823 | Ga0157375_129098232 | 68 |
| 76 | 3300014325 | Ga0163163_10158004 | Ga0163163_101580043 | 68 |
| 77 | 3300014968 | Ga0157379_10045738 | Ga0157379_100457382 | 68 |
| 78 | 3300014968 | Ga0157379_10308085 | Ga0157379_103080852 | 68 |
| 79 | 3300020070 | Ga0206356_10513908 | Ga0206356_105139082 | 68 |
| 80 | 3300020082 | Ga0206353_11679996 | Ga0206353_116799962 | 68 |
| 81 | 3300025321 | Ga0207656_10000116 | Ga0207656_1000011617 | 68 |
| 82 | 3300025885 | Ga0207653_10068603 | Ga0207653_100686032 | 68 |
| 83 | 3300025900 | Ga0207710_10000158 | Ga0207710_1000015821 | 68 |
| 84 | 3300025905 | Ga0207685_10000046 | Ga0207685_1000004631 | 68 |
| 85 | 3300025905 | Ga0207685_10340358 | Ga0207685_103403582 | 68 |
| 86 | 3300025909 | Ga0207705_10040116 | Ga0207705_100401162 | 68 |
| 87 | 3300025911 | Ga0207654_10013399 | Ga0207654_100133996 | 68 |
| 88 | 3300025912 | Ga0207707_11158665 | Ga0207707_111586652 | 68 |
| 89 | 3300025915 | Ga0207693_10001956 | Ga0207693_1000195611 | 68 |
| 90 | 3300025915 | Ga0207693_10458989 | Ga0207693_104589892 | 68 |
| 91 | 3300025915 | Ga0207693_10869535 | Ga0207693_108695352 | 68 |
| 92 | 3300025916 | Ga0207663_10086968 | Ga0207663_100869683 | 68 |
| 93 | 3300025916 | Ga0207663_10158230 | Ga0207663_101582301 | 68 |
| 94 | 3300025920 | Ga0207649_10000063 | Ga0207649_1000006393 | 68 |
| 95 | 3300025924 | Ga0207694_10000012 | Ga0207694_1000001222 | 68 |
| 96 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007276 | 68 |
| 97 | 3300025927 | Ga0207687_10000691 | Ga0207687_1000069123 | 68 |
| 98 | 3300025927 | Ga0207687_10007579 | Ga0207687_100075791 | 68 |
| 99 | 3300025928 | Ga0207700_10543127 | Ga0207700_105431272 | 68 |
| 100 | 3300025929 | Ga0207664_10080276 | Ga0207664_100802765 | 68 |
| 101 | 3300025932 | Ga0207690_10003697 | Ga0207690_100036972 | 68 |
| 102 | 3300025936 | Ga0207670_10173012 | Ga0207670_101730121 | 68 |
| 103 | 3300025938 | Ga0207704_10000146 | Ga0207704_1000014615 | 68 |
| 104 | 3300025941 | Ga0207711_10000020 | Ga0207711_1000002086 | 68 |
| 105 | 3300025944 | Ga0207661_10009431 | Ga0207661_100094314 | 68 |
| 106 | 3300025945 | Ga0207679_11625947 | Ga0207679_116259472 | 68 |
| 107 | 3300025949 | Ga0207667_11088675 | Ga0207667_110886752 | 68 |
| 108 | 3300025961 | Ga0207712_10007769 | Ga0207712_100077699 | 68 |
| 109 | 3300025961 | Ga0207712_11651252 | Ga0207712_116512521 | 68 |
| 110 | 3300025972 | Ga0207668_10270350 | Ga0207668_102703502 | 68 |
| 111 | 3300025981 | Ga0207640_10000015 | Ga0207640_10000015110 | 68 |
| 112 | 3300025986 | Ga0207658_10009541 | Ga0207658_100095412 | 68 |
| 113 | 3300026035 | Ga0207703_10184745 | Ga0207703_101847453 | 68 |
| 114 | 3300026035 | Ga0207703_10509798 | Ga0207703_105097982 | 68 |
| 115 | 3300026041 | Ga0207639_10158244 | Ga0207639_101582443 | 68 |
| 116 | 3300026067 | Ga0207678_10771978 | Ga0207678_107719782 | 68 |
| 117 | 3300026078 | Ga0207702_10000607 | Ga0207702_1000060734 | 68 |
| 118 | 3300026078 | Ga0207702_10003776 | Ga0207702_100037765 | 68 |
| 119 | 3300026078 | Ga0207702_10113527 | Ga0207702_101135273 | 68 |
| 120 | 3300026088 | Ga0207641_10188348 | Ga0207641_101883481 | 68 |
| 121 | 3300026088 | Ga0207641_11021294 | Ga0207641_110212942 | 68 |
| 122 | 3300026089 | Ga0207648_10001621 | Ga0207648_1000162122 | 68 |
| 123 | 3300026121 | Ga0207683_10095380 | Ga0207683_100953803 | 68 |
| 124 | 3300028379 | Ga0268266_10165523 | Ga0268266_101655233 | 68 |
| 125 | 3300028379 | Ga0268266_10292065 | Ga0268266_102920652 | 68 |
| 126 | 3300028379 | Ga0268266_11264531 | Ga0268266_112645312 | 68 |
| 127 | 3300028380 | Ga0268265_10008322 | Ga0268265_100083223 | 68 |
| 128 | 3300028563 | Ga0265319_1000079 | Ga0265319_100007959 | 68 |
| 129 | 3300028654 | Ga0265322_10073248 | Ga0265322_100732481 | 68 |
| 130 | 3300028800 | Ga0265338_10496119 | Ga0265338_104961192 | 68 |
| 131 | 3300035119 | Ga0373956_0528071 | Ga0373956_0528071_227_433 | 68 |
| 132 | 3300035724 | Ga0373933_0424676 | Ga0373933_0424676_397_603 | 68 |
| 133 | 3300036401 | Ga0373937_0010181 | Ga0373937_0010181_2175_2381 | 68 |
| 134 | 3300036401 | Ga0373937_0682816 | Ga0373937_0682816_582_788 | 68 |
| 135 | 3300036401 | Ga0373937_0778219 | Ga0373937_0778219_205_411 | 68 |
| 136 | 3300036647 | Ga0316582_0586420 | Ga0316582_0586420_393_599 | 68 |
| 137 | 3300046454 | Ga0495592_0005904 | Ga0495592_0005904_7130_7336 | 68 |
| 138 | 3300046454 | Ga0495592_0102551 | Ga0495592_0102551_1295_1501 | 68 |
| 139 | 3300046454 | Ga0495592_0198423 | Ga0495592_0198423_1076_1285 | 68 |
| 140 | 3300046454 | Ga0495592_0440571 | Ga0495592_0440571_342_548 | 68 |
| 141 | 3300046455 | Ga0495603_0006970 | Ga0495603_0006970_5309_5515 | 68 |
| 142 | 3300046455 | Ga0495603_0007849 | Ga0495603_0007849_2883_3089 | 68 |
| 143 | 3300046459 | Ga0495629_0253675 | Ga0495629_0253675_271_477 | 68 |
| 144 | 3300046459 | Ga0495629_0279733 | Ga0495629_0279733_54_260 | 68 |
| 145 | 3300046461 | Ga0495641_0489318 | Ga0495641_0489318_11_217 | 68 |
| 146 | 3300046462 | Ga0495651_0131772 | Ga0495651_0131772_1143_1349 | 68 |
| 147 | 3300046463 | Ga0495653_0019388 | Ga0495653_0019388_2150_2356 | 68 |
| 148 | 3300046463 | Ga0495653_0046031 | Ga0495653_0046031_1709_1915 | 68 |
| 149 | 3300046463 | Ga0495653_0111120 | Ga0495653_0111120_1235_1441 | 68 |
| 150 | 3300046463 | Ga0495653_0129175 | Ga0495653_0129175_975_1181 | 68 |
| 151 | 3300046463 | Ga0495653_0404274 | Ga0495653_0404274_470_676 | 68 |
| 152 | 3300046473 | Ga0495582_0000003 | Ga0495582_0000003_95231_95437 | 68 |
| 153 | 3300046476 | Ga0495662_0000167 | Ga0495662_0000167_16061_16267 | 68 |
| 154 | 3300046476 | Ga0495662_0001475 | Ga0495662_0001475_9118_9324 | 68 |
| 155 | 3300046476 | Ga0495662_0315347 | Ga0495662_0315347_292_498 | 68 |
| 156 | 3300046476 | Ga0495662_0359329 | Ga0495662_0359329_409_615 | 68 |
| 157 | 3300046477 | Ga0495664_0261281 | Ga0495664_0261281_544_750 | 68 |
| 158 | 3300046491 | Ga0495584_0444533 | Ga0495584_0444533_100_306 | 68 |
| 159 | 3300046511 | Ga0495608_0000122 | Ga0495608_0000122_27399_27605 | 68 |
| 160 | 3300046511 | Ga0495608_0000189 | Ga0495608_0000189_7017_7223 | 68 |
| 161 | 3300046511 | Ga0495608_0225960 | Ga0495608_0225960_718_924 | 68 |
| 162 | 3300046511 | Ga0495608_0319342 | Ga0495608_0319342_242_448 | 68 |
| 163 | 3300046514 | Ga0495618_0000026 | Ga0495618_0000026_27545_27751 | 68 |
| 164 | 3300046514 | Ga0495618_0493612 | Ga0495618_0493612_414_629 | 68 |
| 165 | 3300046516 | Ga0495628_0000144 | Ga0495628_0000144_17654_17860 | 68 |
| 166 | 3300046516 | Ga0495628_0005318 | Ga0495628_0005318_1126_1332 | 68 |
| 167 | 3300046516 | Ga0495628_0024110 | Ga0495628_0024110_3157_3363 | 68 |
| 168 | 3300046516 | Ga0495628_0039005 | Ga0495628_0039005_710_916 | 68 |
| 169 | 3300046516 | Ga0495628_0301908 | Ga0495628_0301908_483_692 | 68 |
| 170 | 3300046516 | Ga0495628_0634525 | Ga0495628_0634525_196_402 | 68 |
| 171 | 3300046517 | Ga0495630_0000862 | Ga0495630_0000862_11247_11456 | 68 |
| 172 | 3300046517 | Ga0495630_0002718 | Ga0495630_0002718_9132_9338 | 68 |
| 173 | 3300046517 | Ga0495630_0009081 | Ga0495630_0009081_4061_4267 | 68 |
| 174 | 3300046517 | Ga0495630_0757249 | Ga0495630_0757249_246_452 | 68 |
| 175 | 3300046529 | Ga0495652_0000019 | Ga0495652_0000019_95783_95989 | 68 |
| 176 | 3300046529 | Ga0495652_0286798 | Ga0495652_0286798_363_572 | 68 |
| 177 | 3300046533 | Ga0495640_0048390 | Ga0495640_0048390_220_426 | 68 |
| 178 | 3300046535 | Ga0495586_0001432 | Ga0495586_0001432_8299_8505 | 68 |
| 179 | 3300046536 | Ga0495587_0004675 | Ga0495587_0004675_3826_4035 | 68 |
| 180 | 3300046536 | Ga0495587_0267084 | Ga0495587_0267084_126_332 | 68 |
| 181 | 3300046543 | Ga0495645_0003745 | Ga0495645_0003745_274_480 | 68 |
| 182 | 3300046543 | Ga0495645_0007267 | Ga0495645_0007267_2491_2697 | 68 |
| 183 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_81220_81426 | 68 |
| 184 | 3300046642 | Ga0495634_0000962 | Ga0495634_0000962_14041_14247 | 68 |
| 185 | 3300046642 | Ga0495634_0061478 | Ga0495634_0061478_841_1047 | 68 |
| 186 | 3300046642 | Ga0495634_0340395 | Ga0495634_0340395_666_872 | 68 |
| 187 | 3300046642 | Ga0495634_0408579 | Ga0495634_0408579_515_721 | 68 |
| 188 | 3300046660 | Ga0495625_0000405 | Ga0495625_0000405_61668_61874 | 68 |
| 189 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_155095_155301 | 68 |
| 190 | 3300046663 | Ga0495635_0347099 | Ga0495635_0347099_271_477 | 68 |
| 191 | 3300046663 | Ga0495635_0603692 | Ga0495635_0603692_489_695 | 68 |
| 192 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_7017_7223 | 68 |
| 193 | 3300046675 | Ga0495657_0062167 | Ga0495657_0062167_2076_2282 | 68 |
| 194 | 3300046675 | Ga0495657_0180691 | Ga0495657_0180691_817_1026 | 68 |
| 195 | 3300046678 | Ga0495599_0262613 | Ga0495599_0262613_778_984 | 68 |
| 196 | 3300046678 | Ga0495599_0470064 | Ga0495599_0470064_15_221 | 68 |
| 197 | 3300046679 | Ga0495623_0409722 | Ga0495623_0409722_373_579 | 68 |
| 198 | 3300046680 | Ga0495646_0507620 | Ga0495646_0507620_106_312 | 68 |
| 199 | 3300046681 | Ga0495647_0000004 | Ga0495647_0000004_46360_46566 | 68 |
| 200 | 3300046681 | Ga0495647_0001032 | Ga0495647_0001032_3162_3368 | 68 |
| 201 | 3300046681 | Ga0495647_0153341 | Ga0495647_0153341_123_329 | 68 |
| 202 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_76974_77180 | 68 |
| 203 | 3300046683 | Ga0495658_0020830 | Ga0495658_0020830_1107_1313 | 68 |
| 204 | 3300046683 | Ga0495658_0340804 | Ga0495658_0340804_346_552 | 68 |
| 205 | 3300046689 | Ga0495613_0000021 | Ga0495613_0000021_54377_54583 | 68 |
| 206 | 3300046689 | Ga0495613_0000370 | Ga0495613_0000370_23680_23886 | 68 |
| 207 | 3300046690 | Ga0495624_0063469 | Ga0495624_0063469_946_1152 | 68 |
| 208 | 3300046690 | Ga0495624_0938578 | Ga0495624_0938578_118_324 | 68 |
| 209 | 3300046809 | Ga0495600_0002209 | Ga0495600_0002209_7513_7719 | 68 |
| 210 | 3300046809 | Ga0495600_0003663 | Ga0495600_0003663_1157_1363 | 68 |
| 211 | 3300046809 | Ga0495600_0080126 | Ga0495600_0080126_817_1023 | 68 |
| 212 | 3300046809 | Ga0495600_0404279 | Ga0495600_0404279_462_668 | 68 |
| 213 | 3300046809 | Ga0495600_0635442 | Ga0495600_0635442_164_370 | 68 |
| 214 | 3300046809 | Ga0495600_0807407 | Ga0495600_0807407_33_239 | 68 |
| 215 | 3300047315 | Ga0495581_0339810 | Ga0495581_0339810_371_577 | 68 |
| 216 | 3300047317 | Ga0495604_0000089 | Ga0495604_0000089_32643_32849 | 68 |
| 217 | 3300047317 | Ga0495604_0001362 | Ga0495604_0001362_12773_12979 | 68 |
| 218 | 3300047317 | Ga0495604_0110412 | Ga0495604_0110412_1282_1488 | 68 |
| 219 | 3300047321 | Ga0495676_0755010 | Ga0495676_0755010_382_588 | 68 |
| 220 | 3300047322 | Ga0495680_0000007 | Ga0495680_0000007_16166_16372 | 68 |
| 221 | 3300047322 | Ga0495680_0001062 | Ga0495680_0001062_4032_4238 | 68 |
| 222 | 3300047322 | Ga0495680_0039230 | Ga0495680_0039230_1058_1267 | 68 |
| 223 | 3300047322 | Ga0495680_0054461 | Ga0495680_0054461_1233_1439 | 68 |
| 224 | 3300047444 | Ga0495675_0001341 | Ga0495675_0001341_6369_6575 | 68 |
| 225 | 3300047447 | Ga0495685_008517 | Ga0495685_008517_1184_1390 | 68 |
| 226 | 3300047471 | Ga0495684_0290491 | Ga0495684_0290491_938_1144 | 68 |
| 227 | 3300047472 | Ga0495686_0401387 | Ga0495686_0401387_248_454 | 68 |
| 228 | 3300047673 | Ga0495593_0064325 | Ga0495593_0064325_816_1022 | 68 |
| 229 | 3300048088 | Ga0495602_0000021 | Ga0495602_0000021_135007_135213 | 68 |
| 230 | 3300048088 | Ga0495602_0015275 | Ga0495602_0015275_6392_6598 | 68 |
| 231 | 3300048088 | Ga0495602_0324996 | Ga0495602_0324996_690_896 | 68 |
| 232 | 3300048088 | Ga0495602_0418301 | Ga0495602_0418301_287_493 | 68 |
| 233 | 3300048088 | Ga0495602_1095996 | Ga0495602_1095996_53_259 | 68 |
| 234 | 3300048905 | Ga0496102_0013393 | Ga0496102_0013393_2856_3062 | 68 |
| 235 | 3300048905 | Ga0496102_0206412 | Ga0496102_0206412_957_1163 | 68 |
| 236 | 3300048906 | Ga0496103_0104656 | Ga0496103_0104656_855_1061 | 68 |
| 237 | 3300048906 | Ga0496103_0194813 | Ga0496103_0194813_572_778 | 68 |
| 238 | 3300048906 | Ga0496103_0402291 | Ga0496103_0402291_149_355 | 68 |
| 239 | 3300048908 | Ga0496105_0417761 | Ga0496105_0417761_749_958 | 68 |
| 240 | 3300048908 | Ga0496105_0790747 | Ga0496105_0790747_401_607 | 68 |
| 241 | 3300048909 | Ga0496106_0838221 | Ga0496106_0838221_359_565 | 68 |
| 242 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_613994_614200 | 68 |
| 243 | 3300048911 | Ga0496108_0536353 | Ga0496108_0536353_695_934 | 68 |
| 244 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_288540_288746 | 68 |
| 245 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_8409_8615 | 68 |
| 246 | 3300048912 | Ga0496109_0728796 | Ga0496109_0728796_581_787 | 68 |
| 247 | 3300048912 | Ga0496109_0833744 | Ga0496109_0833744_196_402 | 68 |
| 248 | 3300048912 | Ga0496109_1099969 | Ga0496109_1099969_487_693 | 68 |
| 249 | 3300048913 | Ga0496110_0000492 | Ga0496110_0000492_11212_11418 | 68 |
| 250 | 3300048913 | Ga0496110_0167691 | Ga0496110_0167691_547_753 | 68 |
| 251 | 3300048914 | Ga0496111_0004430 | Ga0496111_0004430_6945_7151 | 68 |
| 252 | 3300048914 | Ga0496111_0017629 | Ga0496111_0017629_3152_3358 | 68 |
| 253 | 3300048914 | Ga0496111_0451585 | Ga0496111_0451585_467_673 | 68 |
| 254 | 3300048915 | Ga0496112_0000013 | Ga0496112_0000013_70698_70904 | 68 |
| 255 | 3300048915 | Ga0496112_0003984 | Ga0496112_0003984_2618_2824 | 68 |
| 256 | 3300048916 | Ga0496113_0000029 | Ga0496113_0000029_28791_28997 | 68 |
| 257 | 3300048916 | Ga0496113_0015692 | Ga0496113_0015692_653_859 | 68 |
| 258 | 3300048916 | Ga0496113_0041499 | Ga0496113_0041499_2117_2323 | 68 |
| 259 | 3300048916 | Ga0496113_0200772 | Ga0496113_0200772_655_861 | 68 |
| 260 | 3300048920 | Ga0496117_0018730 | Ga0496117_0018730_143_349 | 68 |
| 261 | 3300048921 | Ga0496118_0000174 | Ga0496118_0000174_2690_2896 | 68 |
| 262 | 3300048922 | Ga0496119_0030722 | Ga0496119_0030722_1174_1380 | 68 |
| 263 | 3300048923 | Ga0496120_0012344 | Ga0496120_0012344_5419_5625 | 68 |
| 264 | 3300048924 | Ga0496121_0010179 | Ga0496121_0010179_4014_4220 | 68 |
| 265 | 3300048924 | Ga0496121_0053660 | Ga0496121_0053660_712_921 | 68 |
| 266 | 3300048924 | Ga0496121_0131276 | Ga0496121_0131276_1313_1519 | 68 |
| 267 | 3300049571 | Ga0501034_0110154 | Ga0501034_0110154_1897_2103 | 68 |
| 268 | 3300049576 | Ga0501040_0424754 | Ga0501040_0424754_127_333 | 68 |
| 269 | 3300049579 | Ga0501043_0390355 | Ga0501043_0390355_481_687 | 68 |
| 270 | 3300049581 | Ga0501047_0119868 | Ga0501047_0119868_738_944 | 68 |
| 271 | 3300049581 | Ga0501047_0292939 | Ga0501047_0292939_1059_1265 | 68 |
| 272 | 3300049582 | Ga0501048_0432385 | Ga0501048_0432385_207_413 | 68 |
| 273 | 3300049584 | Ga0501068_0056488 | Ga0501068_0056488_160_366 | 68 |
| 274 | 3300049585 | Ga0501069_0509362 | Ga0501069_0509362_327_533 | 68 |
| 275 | 3300049586 | Ga0501070_0015320 | Ga0501070_0015320_1789_1995 | 68 |
| 276 | 3300049586 | Ga0501070_0018473 | Ga0501070_0018473_1802_2008 | 68 |
| 277 | 3300049586 | Ga0501070_0245279 | Ga0501070_0245279_438_644 | 68 |
| 278 | 3300049586 | Ga0501070_1116964 | Ga0501070_1116964_118_324 | 68 |
| 279 | 3300049587 | Ga0501071_0048308 | Ga0501071_0048308_2447_2653 | 68 |
| 280 | 3300049590 | Ga0501074_0010231 | Ga0501074_0010231_871_1077 | 68 |
| 281 | 3300049590 | Ga0501074_0123889 | Ga0501074_0123889_1584_1790 | 68 |
| 282 | 3300049741 | Ga0501079_0003195 | Ga0501079_0003195_2462_2668 | 68 |
| 283 | 3300049742 | Ga0501080_0120280 | Ga0501080_0120280_2109_2315 | 68 |
| 284 | 3300049742 | Ga0501080_0172516 | Ga0501080_0172516_905_1111 | 68 |
| 285 | 3300049742 | Ga0501080_1288745 | Ga0501080_1288745_255_461 | 68 |
| 286 | 3300049743 | Ga0501081_0012739 | Ga0501081_0012739_4922_5128 | 68 |
| 287 | 3300049744 | Ga0501083_0027899 | Ga0501083_0027899_749_955 | 68 |
| 288 | 3300049822 | Ga0501035_0359993 | Ga0501035_0359993_458_664 | 68 |
| 289 | 3300049823 | Ga0501044_0006622 | Ga0501044_0006622_9546_9752 | 68 |
| 290 | 3300049823 | Ga0501044_0119083 | Ga0501044_0119083_1432_1638 | 68 |
| 291 | 3300049823 | Ga0501044_1047081 | Ga0501044_1047081_376_582 | 68 |
| 292 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_211258_211464 | 68 |
| 293 | 3300053077 | Ga0495601_0000035 | Ga0495601_0000035_54232_54438 | 68 |
| 294 | 3300053077 | Ga0495601_0002976 | Ga0495601_0002976_5586_5795 | 68 |
| 295 | 3300053077 | Ga0495601_0021096 | Ga0495601_0021096_2923_3129 | 68 |
| 296 | 3300053077 | Ga0495601_0030443 | Ga0495601_0030443_1346_1555 | 68 |
| 297 | 3300053077 | Ga0495601_0202876 | Ga0495601_0202876_823_1032 | 68 |
| 298 | 3300053077 | Ga0495601_0248004 | Ga0495601_0248004_495_701 | 68 |
| 299 | 3300053077 | Ga0495601_0463670 | Ga0495601_0463670_534_740 | 68 |
| 300 | 3300053078 | Ga0495612_0000073 | Ga0495612_0000073_35208_35414 | 68 |
| 301 | 3300053078 | Ga0495612_0066853 | Ga0495612_0066853_419_625 | 68 |
| 302 | 3300053078 | Ga0495612_0557093 | Ga0495612_0557093_15_221 | 68 |
| 303 | 3300053080 | Ga0500635_0235086 | Ga0500635_0235086_32_238 | 68 |
| 304 | 3300053083 | Ga0495655_0000606 | Ga0495655_0000606_5219_5425 | 68 |
| 305 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_7017_7223 | 68 |
| 306 | 3300053084 | Ga0495595_0000072 | Ga0495595_0000072_44807_45013 | 68 |
| 307 | 3300053084 | Ga0495595_0707784 | Ga0495595_0707784_28_234 | 68 |
| 308 | 3300053085 | Ga0495619_0000055 | Ga0495619_0000055_38636_38842 | 68 |
| 309 | 3300053085 | Ga0495619_0001468 | Ga0495619_0001468_7017_7223 | 68 |
| 310 | 3300053085 | Ga0495619_0006453 | Ga0495619_0006453_6490_6696 | 68 |
| 311 | 3300053085 | Ga0495619_0020317 | Ga0495619_0020317_2802_3008 | 68 |
| 312 | 3300053085 | Ga0495619_0051935 | Ga0495619_0051935_2392_2598 | 68 |
| 313 | 3300053085 | Ga0495619_0353049 | Ga0495619_0353049_143_349 | 68 |
| 314 | 3300053085 | Ga0495619_0464640 | Ga0495619_0464640_274_480 | 68 |
| 315 | 3300053085 | Ga0495619_0617438 | Ga0495619_0617438_503_709 | 68 |
| 316 | 3300053139 | Ga0500568_0226808 | Ga0500568_0226808_297_503 | 68 |
| 317 | 3300060353 | Ga0501082_2017566 | Ga0501082_2017566_152_358 | 68 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fxr-assembly1.cif.gz_B | crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution | 0.9018 | 2 | 60 |
| 1vjw-assembly1.cif.gz_A | structure of oxidoreductase (nadp+(a),ferredoxin(a)) | 0.8999 | 5 | 56 |
| 1siz-assembly1.cif.gz_C | crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus | 0.899 | 2 | 59 |
| 4id8-assembly1.cif.gz_A | the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 | 0.8974 | 5 | 60 |
| 8amp-assembly1.cif.gz_A | crystal structure of m.tuberculosis ferredoxin fdx | 0.8662 | 2 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_X1WD81_432_596_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.9686 | 55 | 67 | 2.40.128.630 |
| af_Q54J80_58_125_2.20.110.10 | Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain | 0.9589 | 55 | 66 | 2.20.110.10 |
| af_Q5JNF3_161_221_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9406 | 5 | 55 | 3.30.70.20 |
| af_A4I292_309_574_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.9386 | 54 | 67 | 2.130.10.10 |
| af_I6X7H4_1_61_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9096 | 4 | 56 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B8U277-F1-model_v4 | Ferredoxin | 0.9659 | 1 | 68 |
GO:0005506
GO:0009055 GO:0051536 |
| AF-A0A7J9YLU0-F1-model_v4 | Ferredoxin | 0.9642 | 1 | 60 |
GO:0005506
GO:0009055 GO:0051538 |
| AF-A0A7C5AM86-F1-model_v4 | Ferredoxin | 0.9613 | 2 | 57 |
GO:0005506
GO:0009055 GO:0051539 |
| AF-A0A535GEE9-F1-model_v4 | Ferredoxin | 0.9598 | 3 | 57 |
GO:0005506
GO:0009055 GO:0051536 |
| AF-A0A660LD62-F1-model_v4 | Ferredoxin | 0.9577 | 1 | 68 |
GO:0005506
GO:0009055 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar