F403888

General Info

Members Datasets Scaffolds Average Seq Length
316 162 632 256

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0200797|Ga0501037_0200797_323_1168
Length 281
Sequence MPAFIDRACRLCEFALGKDGKIVMPEFVTASDGVALAFERLAPQEEMGRAAIMLVHGFGSSRLQNWKSTGWYGGLTAAAFPIVAMDCRGHGDSGKPHDPDSYGHDRMAEDVMTVMETASLSSAFILGYSMGGFIGLRLLAAHPERVIKLAIAGVGETYLKDSITAPEARVALADALLTADPQSLTDPRAKMFRAFADQPGKDRLALAACMRAMSPRLSIETLAHLTRPVLVVAGDKDDTAGRPEPLAATFANGTAVSIPGRDHMSAVGDKHTRQAVIDFFR

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
155 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0
Rhizoplane 0.32
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 15.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0200797 3300049573 Bacteria 1409
2 JGI25165J46597_1000047 3300003214 Bacteria 254601
3 JGI25153J46596_10003327 3300003215 Bacteria 9036
4 rootH2_10061589 3300003320 Bacteria 2183
5 Ga0070658_10004175 3300005327 Bacteria 11814
6 Ga0070658_10040518 3300005327 Bacteria 3758
7 Ga0070683_100169435 3300005329 Bacteria 2073
8 Ga0070690_100016820 3300005330 Bacteria 4391
9 Ga0068869_100125838 3300005334 Unclassified 1965
10 Ga0068869_100732955 3300005334 Unclassified 845
11 Ga0070666_10001952 3300005335 Bacteria 12555
12 Ga0070666_10004617 3300005335 Bacteria 8404
13 Ga0070682_100197680 3300005337 Bacteria 1416
14 Ga0068868_100009135 3300005338 Bacteria 7117
15 Ga0068868_100073870 3300005338 Bacteria 2723
16 Ga0068868_100195365 3300005338 Bacteria 1684
17 Ga0068868_100435904 3300005338 Bacteria 1137
18 Ga0070660_100071301 3300005339 Bacteria 2712
19 Ga0070660_100083609 3300005339 Unclassified 2508
20 Ga0070668_100344833 3300005347 Bacteria 1259
21 Ga0070675_100028672 3300005354 Bacteria 4482
22 Ga0070675_100043469 3300005354 Bacteria 3672
23 Ga0070671_100032420 3300005355 Bacteria 4320
24 Ga0070671_100068035 3300005355 Bacteria 2970
25 Ga0070673_100264730 3300005364 Unclassified 1503
26 Ga0070673_100460354 3300005364 Bacteria 1145
27 Ga0070688_100090808 3300005365 Bacteria 1995
28 Ga0070667_100068476 3300005367 Bacteria 3020
29 Ga0070714_100421296 3300005435 Bacteria 1265
30 Ga0070713_100098962 3300005436 Bacteria 2523
31 Ga0070713_100775732 3300005436 Bacteria 918
32 Ga0070662_100056476 3300005457 Unclassified 2850
33 Ga0070681_10010012 3300005458 Bacteria 9348
34 Ga0070681_10147789 3300005458 Bacteria 2278
35 Ga0068867_100006415 3300005459 Bacteria 8307
36 Ga0068867_100032733 3300005459 Bacteria 3762
37 Ga0070679_100005925 3300005530 Bacteria 11356
38 Ga0070679_100048633 3300005530 Bacteria 4224
39 Ga0070679_100238162 3300005530 Bacteria 1778
40 Ga0070684_100049943 3300005535 Bacteria 3632
41 Ga0068853_100342695 3300005539 Bacteria 1389
42 Ga0070672_100276683 3300005543 Unclassified 1418
43 Ga0070695_100255967 3300005545 Unclassified 1276
44 Ga0070693_100109396 3300005547 Unclassified 1697
45 Ga0070665_100000601 3300005548 Bacteria 49579
46 Ga0070665_100020107 3300005548 Bacteria 6703
47 Ga0070665_100031223 3300005548 Bacteria 5362
48 Ga0070665_100031352 3300005548 Bacteria 5350
49 Ga0070665_100035569 3300005548 Bacteria 5009
50 Ga0070665_100054680 3300005548 Bacteria 4003
51 Ga0070665_100353847 3300005548 Unclassified 1474
52 Ga0068855_100022977 3300005563 Bacteria 7473
53 Ga0068855_100072595 3300005563 Bacteria 4000
54 Ga0068855_100082827 3300005563 Bacteria 3718
55 Ga0068855_100083504 3300005563 Bacteria 3700
56 Ga0068855_100147132 3300005563 Bacteria 2681
57 Ga0070664_100170921 3300005564 Bacteria 1928
58 Ga0068857_100052338 3300005577 Bacteria 3623
59 Ga0068857_100063060 3300005577 Bacteria 3295
60 Ga0068857_100522277 3300005577 Bacteria 1116
61 Ga0068854_100448366 3300005578 Bacteria 1077
62 Ga0068856_100100844 3300005614 Bacteria 2880
63 Ga0068856_100282433 3300005614 Unclassified 1677
64 Ga0068852_100044229 3300005616 Bacteria 3781
65 Ga0068864_100293076 3300005618 Bacteria 1521
66 Ga0068864_100615169 3300005618 Unclassified 1055
67 Ga0068866_10006531 3300005718 Bacteria 4860
68 Ga0068851_10176933 3300005834 Bacteria 1180
69 Ga0068870_10018963 3300005840 Bacteria 3331
70 Ga0068863_100028349 3300005841 Bacteria 5346
71 Ga0068858_100007980 3300005842 Bacteria 10203
72 Ga0068860_100024076 3300005843 Bacteria 5885
73 Ga0068862_100252346 3300005844 Unclassified 1608
74 Ga0070712_100367799 3300006175 Bacteria 1181
75 Ga0070712_100408543 3300006175 Unclassified 1123
76 Ga0097621_100001402 3300006237 Bacteria 16598
77 Ga0097621_100004118 3300006237 Bacteria 10083
78 Ga0097621_100006991 3300006237 Bacteria 8036
79 Ga0068871_100000016 3300006358 Bacteria 92842
80 Ga0068871_100021287 3300006358 Bacteria 4982
81 Ga0068871_100159227 3300006358 Archaea 1930
82 Ga0068871_100187073 3300006358 Unclassified 1782
83 Ga0068865_100001476 3300006881 Bacteria 13685
84 Ga0068865_100089913 3300006881 Bacteria 2225
85 Ga0068865_100553682 3300006881 Bacteria 966
86 Ga0105240_10017840 3300009093 Bacteria 9551
87 Ga0105240_10025897 3300009093 Bacteria 7702
88 Ga0105240_10043486 3300009093 Bacteria 5715
89 Ga0105240_10045184 3300009093 Bacteria 5590
90 Ga0105240_10227654 3300009093 Bacteria 2168
91 Ga0105240_10236124 3300009093 Bacteria 2122
92 Ga0105240_10308567 3300009093 Unclassified 1808
93 Ga0105245_10002612 3300009098 Bacteria 16233
94 Ga0105245_10062033 3300009098 Bacteria 3372
95 Ga0105245_10172967 3300009098 Unclassified 2058
96 Ga0105247_10253069 3300009101 Unclassified 1205
97 Ga0105243_10061978 3300009148 Bacteria 2993
98 Ga0105241_10009128 3300009174 Bacteria 7298
99 Ga0105241_10022781 3300009174 Bacteria 4642
100 Ga0105241_10037049 3300009174 Bacteria 3673
101 Ga0105241_10069328 3300009174 Bacteria 2734
102 Ga0105241_10090053 3300009174 Unclassified 2419
103 Ga0105242_10030946 3300009176 Bacteria 4274
104 Ga0105242_10063380 3300009176 Bacteria 3044
105 Ga0105248_10032244 3300009177 Bacteria 5856
106 Ga0105248_10041153 3300009177 Bacteria 5180
107 Ga0105238_10023117 3300009551 Bacteria 6340
108 Ga0105238_10045321 3300009551 Bacteria 4443
109 Ga0105238_10054398 3300009551 Bacteria 4019
110 Ga0105238_10332983 3300009551 Bacteria 1505
111 Ga0105239_10054014 3300010375 Bacteria 4405
112 Ga0105246_10006093 3300011119 Bacteria 7359
113 Ga0105246_10007281 3300011119 Bacteria 6781
114 Ga0157370_10068801 3300013104 Bacteria 3346
115 Ga0157369_10055442 3300013105 Bacteria 4278
116 Ga0157369_10081305 3300013105 Bacteria 3467
117 Ga0157374_10043241 3300013296 Bacteria 4160
118 Ga0157374_10119768 3300013296 Bacteria 2539
119 Ga0157378_10018102 3300013297 Bacteria 6186
120 Ga0157378_10026483 3300013297 Bacteria 5112
121 Ga0163162_10044425 3300013306 Bacteria 4450
122 Ga0163163_10000205 3300014325 Bacteria 61330
123 Ga0163163_10011431 3300014325 Bacteria 8053
124 Ga0163163_10013373 3300014325 Bacteria 7512
125 Ga0163163_10175240 3300014325 Bacteria 2191
126 Ga0157380_10292709 3300014326 Unclassified 1496
127 Ga0157379_10063241 3300014968 Bacteria 3309
128 Ga0157376_10376446 3300014969 Bacteria 1366
129 Ga0157376_10478206 3300014969 Bacteria 1220
130 Ga0213876_10057003 3300021384 Bacteria 2062
131 Ga0209233_1000045 3300025261 Bacteria 473379
132 Ga0209233_1023961 3300025261 Bacteria 1535
133 Ga0209758_1000008 3300025297 Bacteria 1215263
134 Ga0207680_10011358 3300025903 Bacteria 4499
135 Ga0207680_10130266 3300025903 Bacteria 1657
136 Ga0207643_10023675 3300025908 Bacteria 3387
137 Ga0207643_10026244 3300025908 Bacteria 3224
138 Ga0207705_10094464 3300025909 Unclassified 2193
139 Ga0207654_10002091 3300025911 Bacteria 10229
140 Ga0207654_10019684 3300025911 Bacteria 3567
141 Ga0207707_10019224 3300025912 Bacteria 5962
142 Ga0207707_10193683 3300025912 Bacteria 1773
143 Ga0207695_10033352 3300025913 Bacteria 5617
144 Ga0207695_10066739 3300025913 Bacteria 3693
145 Ga0207695_10216452 3300025913 Unclassified 1824
146 Ga0207695_10231185 3300025913 Unclassified 1753
147 Ga0207695_10276706 3300025913 Unclassified 1573
148 Ga0207693_10117926 3300025915 Bacteria 2084
149 Ga0207657_10011402 3300025919 Bacteria 8824
150 Ga0207657_10193808 3300025919 Bacteria 1638
151 Ga0207649_10116699 3300025920 Bacteria 1793
152 Ga0207652_10035448 3300025921 Bacteria 4211
153 Ga0207652_10191368 3300025921 Unclassified 1840
154 Ga0207694_10013378 3300025924 Bacteria 6179
155 Ga0207694_10027379 3300025924 Bacteria 4341
156 Ga0207694_10041960 3300025924 Bacteria 3527
157 Ga0207650_10072981 3300025925 Bacteria 2584
158 Ga0207650_10292511 3300025925 Bacteria 1328
159 Ga0207659_10020448 3300025926 Bacteria 4377
160 Ga0207687_10051568 3300025927 Unclassified 2868
161 Ga0207687_10086778 3300025927 Bacteria 2273
162 Ga0207687_10228115 3300025927 Bacteria 1470
163 Ga0207700_10540511 3300025928 Bacteria 1033
164 Ga0207706_10030506 3300025933 Bacteria 4809
165 Ga0207686_10437792 3300025934 Unclassified 1003
166 Ga0207709_10008561 3300025935 Bacteria 5656
167 Ga0207670_10175131 3300025936 Bacteria 1612
168 Ga0207704_10015475 3300025938 Bacteria 3888
169 Ga0207704_10233977 3300025938 Bacteria 1368
170 Ga0207704_10293411 3300025938 Unclassified 1242
171 Ga0207704_10316628 3300025938 Bacteria 1202
172 Ga0207711_10003150 3300025941 Bacteria 14383
173 Ga0207711_10030871 3300025941 Bacteria 4520
174 Ga0207661_10620528 3300025944 Unclassified 993
175 Ga0207679_10300307 3300025945 Bacteria 1384
176 Ga0207667_10094785 3300025949 Bacteria 3081
177 Ga0207667_10113108 3300025949 Bacteria 2799
178 Ga0207667_10176590 3300025949 Bacteria 2194
179 Ga0207667_10404864 3300025949 Unclassified 1389
180 Ga0207651_10006800 3300025960 Bacteria 6030
181 Ga0207651_10324578 3300025960 Bacteria 1288
182 Ga0207640_10159916 3300025981 Unclassified 1665
183 Ga0207640_10320573 3300025981 Bacteria 1234
184 Ga0207658_10166464 3300025986 Bacteria 1811
185 Ga0207677_10107763 3300026023 Bacteria 2067
186 Ga0207677_10184480 3300026023 Bacteria 1644
187 Ga0207703_10020807 3300026035 Bacteria 5133
188 Ga0207703_10035553 3300026035 Bacteria 3958
189 Ga0207703_10077467 3300026035 Bacteria 2760
190 Ga0207648_10002474 3300026089 Bacteria 19845
191 Ga0207648_10006280 3300026089 Bacteria 11825
192 Ga0207676_10149258 3300026095 Bacteria 2011
193 Ga0207676_10152431 3300026095 Bacteria 1992
194 Ga0207674_10506909 3300026116 Unclassified 1166
195 Ga0207674_10607342 3300026116 Bacteria 1057
196 Ga0207674_10727490 3300026116 Unclassified 958
197 Ga0207683_10010396 3300026121 Bacteria 7938
198 Ga0207683_10435740 3300026121 Bacteria 1208
199 Ga0268266_10000545 3300028379 Bacteria 52605
200 Ga0268266_10007738 3300028379 Bacteria 9642
201 Ga0268266_10039681 3300028379 Bacteria 4010
202 Ga0268266_10223906 3300028379 Bacteria 1730
203 Ga0268266_10291354 3300028379 Unclassified 1520
204 Ga0268266_10460416 3300028379 Bacteria 1210
205 Ga0268266_10640142 3300028379 Unclassified 1023
206 Ga0268265_10115068 3300028380 Bacteria 2204
207 Ga0265318_10002625 3300028577 Bacteria 9493
208 Ga0307517_10142026 3300028786 Bacteria 1682
209 Ga0265338_10002769 3300028800 Bacteria 25666
210 Ga0265332_10019428 3300031238 Bacteria 2999
211 Ga0265340_10024280 3300031247 Bacteria 3081
212 Ga0265339_10053630 3300031249 Unclassified 2193
213 Ga0265331_10005926 3300031250 Bacteria 7303
214 Ga0265331_10094643 3300031250 Unclassified 1379
215 Ga0265316_10098952 3300031344 Unclassified 2219
216 Ga0265313_10000715 3300031595 Bacteria 34158
217 Ga0265313_10000717 3300031595 Bacteria 34092
218 Ga0265314_10019717 3300031711 Bacteria 5216
219 Ga0265314_10133991 3300031711 Bacteria 1541
220 Ga0265314_10175538 3300031711 Bacteria 1289
221 Ga0265342_10206695 3300031712 Bacteria 1064
222 Ga0395901_0018569 3300038443 Bacteria 7102
223 Ga0436365_1708243 3300039437 Bacteria 11380
224 Ga0466957_0211536 3300044842 Bacteria 1277
225 Ga0466967_0063131 3300045976 Bacteria 3290
226 Ga0495592_0182327 3300046454 Bacteria 1429
227 Ga0495654_0174950 3300046530 Unclassified 933
228 Ga0495621_0026640 3300046539 Bacteria 1953
229 Ga0495622_0007251 3300046557 Bacteria 5147
230 Ga0495613_0092956 3300046689 Bacteria 2184
231 Ga0496106_0531545 3300048909 Bacteria 944
232 Ga0496121_0000252 3300048924 Bacteria 113870
233 Ga0496126_0227508 3300048929 Unclassified 1564
234 Ga0501031_0029931 3300049568 Bacteria 3551
235 Ga0501032_0007830 3300049569 Bacteria 7784
236 Ga0501033_0004591 3300049570 Bacteria 11064
237 Ga0501033_0005452 3300049570 Bacteria 10080
238 Ga0501033_0061231 3300049570 Bacteria 2774
239 Ga0501033_0123144 3300049570 Unclassified 1880
240 Ga0501033_0174308 3300049570 Unclassified 1544
241 Ga0501034_0009490 3300049571 Bacteria 10186
242 Ga0501034_0079847 3300049571 Bacteria 3275
243 Ga0501034_0221936 3300049571 Bacteria 1842
244 Ga0501036_0001081 3300049572 Bacteria 20656
245 Ga0501036_0137625 3300049572 Bacteria 2061
246 Ga0501036_0325075 3300049572 Bacteria 1285
247 Ga0501037_0021468 3300049573 Bacteria 4772
248 Ga0501037_0200683 3300049573 Bacteria 1410
249 Ga0501038_0038433 3300049574 Bacteria 4191
250 Ga0501038_0098104 3300049574 Bacteria 2443
251 Ga0501038_0104815 3300049574 Unclassified 2350
252 Ga0501038_0121907 3300049574 Bacteria 2149
253 Ga0501039_0007518 3300049575 Bacteria 8323
254 Ga0501039_0600407 3300049575 Bacteria 863
255 Ga0501042_0083735 3300049578 Bacteria 2286
256 Ga0501043_0007326 3300049579 Bacteria 8759
257 Ga0501043_0181513 3300049579 Bacteria 1640
258 Ga0501046_0002000 3300049580 Bacteria 19343
259 Ga0501046_0006911 3300049580 Bacteria 9999
260 Ga0501046_0122464 3300049580 Bacteria 1978
261 Ga0501046_0261496 3300049580 Bacteria 1271
262 Ga0501047_0001026 3300049581 Bacteria 28057
263 Ga0501047_0004354 3300049581 Bacteria 13319
264 Ga0501047_0073534 3300049581 Bacteria 3291
265 Ga0501047_0095037 3300049581 Bacteria 2859
266 Ga0501047_0097994 3300049581 Bacteria 2810
267 Ga0501047_0122904 3300049581 Bacteria 2477
268 Ga0501047_0138384 3300049581 Bacteria 2314
269 Ga0501047_0139985 3300049581 Unclassified 2298
270 Ga0501047_0149416 3300049581 Bacteria 2213
271 Ga0501047_0618310 3300049581 Bacteria 904
272 Ga0501048_0010349 3300049582 Bacteria 6969
273 Ga0501067_0000535 3300049583 Bacteria 20644
274 Ga0501069_0012685 3300049585 Bacteria 4484
275 Ga0501070_0023326 3300049586 Bacteria 5183
276 Ga0501070_0377455 3300049586 Bacteria 1149
277 Ga0501072_0037123 3300049588 Bacteria 3822
278 Ga0501073_0007454 3300049589 Bacteria 8133
279 Ga0501073_0012170 3300049589 Bacteria 6283
280 Ga0501073_0040706 3300049589 Unclassified 3287
281 Ga0501074_0008345 3300049590 Bacteria 7509
282 Ga0501076_0211907 3300049592 Unclassified 1583
283 Ga0501079_0024560 3300049741 Bacteria 4625
284 Ga0501080_0026362 3300049742 Bacteria 5401
285 Ga0501080_0076284 3300049742 Bacteria 3118
286 Ga0501080_0431660 3300049742 Unclassified 1182
287 Ga0501083_0008023 3300049744 Bacteria 7475
288 Ga0501083_0091324 3300049744 Unclassified 2010
289 Ga0501083_0251129 3300049744 Bacteria 1151
290 Ga0501035_0008431 3300049822 Bacteria 9598
291 Ga0501035_0020098 3300049822 Bacteria 6133
292 Ga0501035_0033021 3300049822 Bacteria 4707
293 Ga0501035_0066919 3300049822 Bacteria 3188
294 Ga0501035_0067114 3300049822 Bacteria 3183
295 Ga0501044_0000921 3300049823 Bacteria 35420
296 Ga0501044_0008187 3300049823 Bacteria 11472
297 Ga0501044_0060270 3300049823 Bacteria 3886
298 Ga0501044_0161705 3300049823 Bacteria 2215
299 Ga0501044_0213912 3300049823 Bacteria 1881
300 Ga0501044_0238646 3300049823 Bacteria 1762
301 Ga0501044_0476943 3300049823 Bacteria 1151
302 Ga0501044_0479616 3300049823 Bacteria 1147
303 Ga0501044_0732316 3300049823 Bacteria 872
304 Ga0501045_0042677 3300049824 Bacteria 3302
305 Ga0500635_0042068 3300053080 Unclassified 1531
306 Ga0500643_000064 3300053087 Bacteria 121004
307 Ga0500595_000162 3300053119 Bacteria 44030
308 Ga0500595_023687 3300053119 Bacteria 2154
309 Ga0500559_0031749 3300053136 Bacteria 2266
310 Ga0500573_0000049 3300053140 Bacteria 96218
311 Ga0500577_0065930 3300053142 Bacteria 1407
312 Ga0500639_033692 3300053163 Bacteria 2707
313 Ga0501084_0012062 3300054114 Bacteria 7157
314 Ga0501084_0117373 3300054114 Bacteria 2237
315 Ga0501082_0079360 3300060353 Bacteria 2831
316 Ga0501082_0099410 3300060353 Bacteria 2515
317 Ga0501037_0200797
318 JGI25165J46597_1000047
319 JGI25153J46596_10003327
320 rootH2_10061589
321 Ga0070658_10004175
322 Ga0070658_10040518
323 Ga0070683_100169435
324 Ga0070690_100016820
325 Ga0068869_100125838
326 Ga0068869_100732955
327 Ga0070666_10001952
328 Ga0070666_10004617
329 Ga0070682_100197680
330 Ga0068868_100009135
331 Ga0068868_100073870
332 Ga0068868_100195365
333 Ga0068868_100435904
334 Ga0070660_100071301
335 Ga0070660_100083609
336 Ga0070668_100344833
337 Ga0070675_100028672
338 Ga0070675_100043469
339 Ga0070671_100032420
340 Ga0070671_100068035
341 Ga0070673_100264730
342 Ga0070673_100460354
343 Ga0070688_100090808
344 Ga0070667_100068476
345 Ga0070714_100421296
346 Ga0070713_100098962
347 Ga0070713_100775732
348 Ga0070662_100056476
349 Ga0070681_10010012
350 Ga0070681_10147789
351 Ga0068867_100006415
352 Ga0068867_100032733
353 Ga0070679_100005925
354 Ga0070679_100048633
355 Ga0070679_100238162
356 Ga0070684_100049943
357 Ga0068853_100342695
358 Ga0070672_100276683
359 Ga0070695_100255967
360 Ga0070693_100109396
361 Ga0070665_100000601
362 Ga0070665_100020107
363 Ga0070665_100031223
364 Ga0070665_100031352
365 Ga0070665_100035569
366 Ga0070665_100054680
367 Ga0070665_100353847
368 Ga0068855_100022977
369 Ga0068855_100072595
370 Ga0068855_100082827
371 Ga0068855_100083504
372 Ga0068855_100147132
373 Ga0070664_100170921
374 Ga0068857_100052338
375 Ga0068857_100063060
376 Ga0068857_100522277
377 Ga0068854_100448366
378 Ga0068856_100100844
379 Ga0068856_100282433
380 Ga0068852_100044229
381 Ga0068864_100293076
382 Ga0068864_100615169
383 Ga0068866_10006531
384 Ga0068851_10176933
385 Ga0068870_10018963
386 Ga0068863_100028349
387 Ga0068858_100007980
388 Ga0068860_100024076
389 Ga0068862_100252346
390 Ga0070712_100367799
391 Ga0070712_100408543
392 Ga0097621_100001402
393 Ga0097621_100004118
394 Ga0097621_100006991
395 Ga0068871_100000016
396 Ga0068871_100021287
397 Ga0068871_100159227
398 Ga0068871_100187073
399 Ga0068865_100001476
400 Ga0068865_100089913
401 Ga0068865_100553682
402 Ga0105240_10017840
403 Ga0105240_10025897
404 Ga0105240_10043486
405 Ga0105240_10045184
406 Ga0105240_10227654
407 Ga0105240_10236124
408 Ga0105240_10308567
409 Ga0105245_10002612
410 Ga0105245_10062033
411 Ga0105245_10172967
412 Ga0105247_10253069
413 Ga0105243_10061978
414 Ga0105241_10009128
415 Ga0105241_10022781
416 Ga0105241_10037049
417 Ga0105241_10069328
418 Ga0105241_10090053
419 Ga0105242_10030946
420 Ga0105242_10063380
421 Ga0105248_10032244
422 Ga0105248_10041153
423 Ga0105238_10023117
424 Ga0105238_10045321
425 Ga0105238_10054398
426 Ga0105238_10332983
427 Ga0105239_10054014
428 Ga0105246_10006093
429 Ga0105246_10007281
430 Ga0157370_10068801
431 Ga0157369_10055442
432 Ga0157369_10081305
433 Ga0157374_10043241
434 Ga0157374_10119768
435 Ga0157378_10018102
436 Ga0157378_10026483
437 Ga0163162_10044425
438 Ga0163163_10000205
439 Ga0163163_10011431
440 Ga0163163_10013373
441 Ga0163163_10175240
442 Ga0157380_10292709
443 Ga0157379_10063241
444 Ga0157376_10376446
445 Ga0157376_10478206
446 Ga0213876_10057003
447 Ga0209233_1000045
448 Ga0209233_1023961
449 Ga0209758_1000008
450 Ga0207680_10011358
451 Ga0207680_10130266
452 Ga0207643_10023675
453 Ga0207643_10026244
454 Ga0207705_10094464
455 Ga0207654_10002091
456 Ga0207654_10019684
457 Ga0207707_10019224
458 Ga0207707_10193683
459 Ga0207695_10033352
460 Ga0207695_10066739
461 Ga0207695_10216452
462 Ga0207695_10231185
463 Ga0207695_10276706
464 Ga0207693_10117926
465 Ga0207657_10011402
466 Ga0207657_10193808
467 Ga0207649_10116699
468 Ga0207652_10035448
469 Ga0207652_10191368
470 Ga0207694_10013378
471 Ga0207694_10027379
472 Ga0207694_10041960
473 Ga0207650_10072981
474 Ga0207650_10292511
475 Ga0207659_10020448
476 Ga0207687_10051568
477 Ga0207687_10086778
478 Ga0207687_10228115
479 Ga0207700_10540511
480 Ga0207706_10030506
481 Ga0207686_10437792
482 Ga0207709_10008561
483 Ga0207670_10175131
484 Ga0207704_10015475
485 Ga0207704_10233977
486 Ga0207704_10293411
487 Ga0207704_10316628
488 Ga0207711_10003150
489 Ga0207711_10030871
490 Ga0207661_10620528
491 Ga0207679_10300307
492 Ga0207667_10094785
493 Ga0207667_10113108
494 Ga0207667_10176590
495 Ga0207667_10404864
496 Ga0207651_10006800
497 Ga0207651_10324578
498 Ga0207640_10159916
499 Ga0207640_10320573
500 Ga0207658_10166464
501 Ga0207677_10107763
502 Ga0207677_10184480
503 Ga0207703_10020807
504 Ga0207703_10035553
505 Ga0207703_10077467
506 Ga0207648_10002474
507 Ga0207648_10006280
508 Ga0207676_10149258
509 Ga0207676_10152431
510 Ga0207674_10506909
511 Ga0207674_10607342
512 Ga0207674_10727490
513 Ga0207683_10010396
514 Ga0207683_10435740
515 Ga0268266_10000545
516 Ga0268266_10007738
517 Ga0268266_10039681
518 Ga0268266_10223906
519 Ga0268266_10291354
520 Ga0268266_10460416
521 Ga0268266_10640142
522 Ga0268265_10115068
523 Ga0265318_10002625
524 Ga0307517_10142026
525 Ga0265338_10002769
526 Ga0265332_10019428
527 Ga0265340_10024280
528 Ga0265339_10053630
529 Ga0265331_10005926
530 Ga0265331_10094643
531 Ga0265316_10098952
532 Ga0265313_10000715
533 Ga0265313_10000717
534 Ga0265314_10019717
535 Ga0265314_10133991
536 Ga0265314_10175538
537 Ga0265342_10206695
538 Ga0395901_0018569
539 Ga0436365_1708243
540 Ga0466957_0211536
541 Ga0466967_0063131
542 Ga0495592_0182327
543 Ga0495654_0174950
544 Ga0495621_0026640
545 Ga0495622_0007251
546 Ga0495613_0092956
547 Ga0496106_0531545
548 Ga0496121_0000252
549 Ga0496126_0227508
550 Ga0501031_0029931
551 Ga0501032_0007830
552 Ga0501033_0004591
553 Ga0501033_0005452
554 Ga0501033_0061231
555 Ga0501033_0123144
556 Ga0501033_0174308
557 Ga0501034_0009490
558 Ga0501034_0079847
559 Ga0501034_0221936
560 Ga0501036_0001081
561 Ga0501036_0137625
562 Ga0501036_0325075
563 Ga0501037_0021468
564 Ga0501037_0200683
565 Ga0501038_0038433
566 Ga0501038_0098104
567 Ga0501038_0104815
568 Ga0501038_0121907
569 Ga0501039_0007518
570 Ga0501039_0600407
571 Ga0501042_0083735
572 Ga0501043_0007326
573 Ga0501043_0181513
574 Ga0501046_0002000
575 Ga0501046_0006911
576 Ga0501046_0122464
577 Ga0501046_0261496
578 Ga0501047_0001026
579 Ga0501047_0004354
580 Ga0501047_0073534
581 Ga0501047_0095037
582 Ga0501047_0097994
583 Ga0501047_0122904
584 Ga0501047_0138384
585 Ga0501047_0139985
586 Ga0501047_0149416
587 Ga0501047_0618310
588 Ga0501048_0010349
589 Ga0501067_0000535
590 Ga0501069_0012685
591 Ga0501070_0023326
592 Ga0501070_0377455
593 Ga0501072_0037123
594 Ga0501073_0007454
595 Ga0501073_0012170
596 Ga0501073_0040706
597 Ga0501074_0008345
598 Ga0501076_0211907
599 Ga0501079_0024560
600 Ga0501080_0026362
601 Ga0501080_0076284
602 Ga0501080_0431660
603 Ga0501083_0008023
604 Ga0501083_0091324
605 Ga0501083_0251129
606 Ga0501035_0008431
607 Ga0501035_0020098
608 Ga0501035_0033021
609 Ga0501035_0066919
610 Ga0501035_0067114
611 Ga0501044_0000921
612 Ga0501044_0008187
613 Ga0501044_0060270
614 Ga0501044_0161705
615 Ga0501044_0213912
616 Ga0501044_0238646
617 Ga0501044_0476943
618 Ga0501044_0479616
619 Ga0501044_0732316
620 Ga0501045_0042677
621 Ga0500635_0042068
622 Ga0500643_000064
623 Ga0500595_000162
624 Ga0500595_023687
625 Ga0500559_0031749
626 Ga0500573_0000049
627 Ga0500577_0065930
628 Ga0500639_033692
629 Ga0501084_0012062
630 Ga0501084_0117373
631 Ga0501082_0079360
632 Ga0501082_0099410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

50

196

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

46

253

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

52

278

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8492 1 252
5ie5-assembly2.cif.gz_C-2 crystal structure of a lactonase double mutant in complex with substrate a 0.837 6 123
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8248 1 123
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8185 1 252
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.8101 2 252
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8422 2 91 3.40.50.12270
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8269 1 123 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8242 6 123 3.40.50.12270
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8204 18 123 3.40.50.1820
3bdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8155 1 252 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y8MT27-F1-model_v4 Alpha/beta hydrolase 0.964 1 252 GO:0004806
GO:0046503
AF-A0A352Q7D4-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9497 5 252 GO:0004806
GO:0046503
AF-A0A4Q3GZC5-F1-model_v4 deleted 0.948 2 123
AF-A0A8A8PJX4-F1-model_v4 deleted 0.9452 26 252
AF-A0A2A4FUI1-F1-model_v4 Alpha/beta hydrolase 0.9443 1 251 GO:0004806
GO:0046503

Map