F403843

General Info

Members Datasets Scaffolds Average Seq Length
316 222 632 157

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0031546|Ga0495642_0031546_892_1392
Length 166
Sequence LKGGWTVIHRESHRPNNTRRVGLISDTHGLLRPEALRFLRGAEHIIHAGDIGTPEILEALRKLAPVTAVRGNNDRGAWARAVPSSAELEVDEVAIHILHDIADLRLPARCRVVVSGHSHKPMVEERDGVLFVNPGSAGPRRFTLPIALGELKISAASVRARIKELG

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
154 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
211 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
212 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
213 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
214 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
215 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
216 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
217 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
218 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
219 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
220 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
221 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
222 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 0.32
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 9.18
Nodule 0
Rhizoplane 0.32
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0031546 3300046528 Bacteria 2125
2 rootH2_10153220 3300003320 Bacteria 1554
3 Ga0032354_1172173 3300003693 Bacteria 664
4 Ga0065165_1027889 3300005262 Bacteria 1832
5 Ga0065715_10141511 3300005293 Bacteria 1835
6 Ga0070658_10213698 3300005327 Bacteria 1630
7 Ga0070658_10274504 3300005327 Bacteria 1434
8 Ga0070676_10124177 3300005328 Bacteria 1624
9 Ga0070690_100798307 3300005330 Bacteria 732
10 Ga0070670_100013108 3300005331 Bacteria 7102
11 Ga0070670_100132472 3300005331 Unclassified 2153
12 Ga0070677_10033977 3300005333 Bacteria 1967
13 Ga0068869_100495221 3300005334 Unclassified 1019
14 Ga0070666_10256438 3300005335 Bacteria 1239
15 Ga0068868_100025209 3300005338 Bacteria 4519
16 Ga0068868_100180824 3300005338 Bacteria 1749
17 Ga0070689_101490735 3300005340 Unclassified 612
18 Ga0070669_100223782 3300005353 Bacteria 1489
19 Ga0070675_100004787 3300005354 Bacteria 10320
20 Ga0070671_100030989 3300005355 Bacteria 4415
21 Ga0070671_100092597 3300005355 Bacteria 2532
22 Ga0070671_100154542 3300005355 Bacteria 1938
23 Ga0070674_100027247 3300005356 Bacteria 3743
24 Ga0070673_100061215 3300005364 Bacteria 2986
25 Ga0070688_100915901 3300005365 Bacteria 692
26 Ga0070667_100011233 3300005367 Bacteria 7408
27 Ga0070667_100046712 3300005367 Bacteria 3643
28 Ga0070667_100253029 3300005367 Unclassified 1575
29 Ga0070709_10469997 3300005434 Unclassified 950
30 Ga0070714_100135780 3300005435 Bacteria 2203
31 Ga0070705_100262693 3300005440 Bacteria 1218
32 Ga0070678_100009176 3300005456 Bacteria 5975
33 Ga0070678_100357344 3300005456 Bacteria 1258
34 Ga0070681_10002340 3300005458 Bacteria 17307
35 Ga0070681_10023835 3300005458 Bacteria 6160
36 Ga0070681_10711900 3300005458 Unclassified 920
37 Ga0068867_100023787 3300005459 Bacteria 4388
38 Ga0068867_100115711 3300005459 Bacteria 2065
39 Ga0070685_10290689 3300005466 Bacteria 1098
40 Ga0070679_100050130 3300005530 Bacteria 4159
41 Ga0070679_100231395 3300005530 Bacteria 1807
42 Ga0070679_100874478 3300005530 Bacteria 842
43 Ga0070672_100050422 3300005543 Bacteria 3241
44 Ga0070695_100035134 3300005545 Bacteria 3147
45 Ga0070704_101243865 3300005549 Unclassified 680
46 Ga0068855_100017217 3300005563 Bacteria 8697
47 Ga0068855_100029062 3300005563 Bacteria 6611
48 Ga0070664_100014262 3300005564 Bacteria 6481
49 Ga0068854_100427110 3300005578 Bacteria 1102
50 Ga0068856_100009092 3300005614 Bacteria 9661
51 Ga0068856_100782155 3300005614 Bacteria 974
52 Ga0068859_100059743 3300005617 Bacteria 3841
53 Ga0068864_100052154 3300005618 Bacteria 3525
54 Ga0068864_100066470 3300005618 Bacteria 3130
55 Ga0068861_100154645 3300005719 Bacteria 1885
56 Ga0068851_10627769 3300005834 Bacteria 656
57 Ga0068863_100008911 3300005841 Bacteria 9795
58 Ga0068863_100497305 3300005841 Bacteria 1200
59 Ga0068862_100100385 3300005844 Bacteria 2530
60 Ga0068862_100467962 3300005844 Bacteria 1191
61 Ga0081539_10000521 3300005985 Bacteria 80101
62 Ga0075368_10247285 3300006042 Bacteria 761
63 Ga0075363_100020163 3300006048 Bacteria 3342
64 Ga0075364_10561609 3300006051 Bacteria 780
65 Ga0075367_10050225 3300006178 Bacteria 2462
66 Ga0075367_10688674 3300006178 Bacteria 650
67 Ga0075369_10150662 3300006186 Bacteria 1063
68 Ga0075366_10000689 3300006195 Bacteria 15998
69 Ga0075366_10005772 3300006195 Bacteria 6723
70 Ga0075366_10158705 3300006195 Bacteria 1370
71 Ga0075366_10363734 3300006195 Bacteria 889
72 Ga0075366_10481398 3300006195 Bacteria 767
73 Ga0075366_10502714 3300006195 Bacteria 749
74 Ga0075370_10013017 3300006353 Bacteria 4413
75 Ga0075370_10306238 3300006353 Bacteria 945
76 Ga0075370_10470857 3300006353 Bacteria 757
77 Ga0068871_100097925 3300006358 Bacteria 2453
78 Ga0068865_100064192 3300006881 Bacteria 2584
79 Ga0097620_100059743 3300006931 Bacteria 3841
80 Ga0075435_100960743 3300007076 Bacteria 746
81 Ga0105245_10054076 3300009098 Bacteria 3605
82 Ga0105245_10090365 3300009098 Bacteria 2816
83 Ga0105243_10769029 3300009148 Unclassified 946
84 Ga0105241_10267929 3300009174 Bacteria 1454
85 Ga0105242_10029651 3300009176 Bacteria 4363
86 Ga0105242_10263342 3300009176 Unclassified 1558
87 Ga0105242_10801112 3300009176 Bacteria 933
88 Ga0105248_10231302 3300009177 Bacteria 2081
89 Ga0105249_10105249 3300009553 Bacteria 2660
90 Ga0105249_11260122 3300009553 Unclassified 811
91 Ga0105246_10176582 3300011119 Unclassified 1641
92 Ga0157371_10002732 3300013102 Bacteria 16616
93 Ga0157371_10437055 3300013102 Bacteria 961
94 Ga0157369_10017685 3300013105 Bacteria 8007
95 Ga0157374_10002109 3300013296 Bacteria 16724
96 Ga0157378_10112008 3300013297 Bacteria 2503
97 Ga0157378_10968758 3300013297 Bacteria 884
98 Ga0163162_10548695 3300013306 Bacteria 1284
99 Ga0157372_10013644 3300013307 Bacteria 8683
100 Ga0157372_10428795 3300013307 Bacteria 1541
101 Ga0157372_10596050 3300013307 Bacteria 1288
102 Ga0157375_10041953 3300013308 Bacteria 4423
103 Ga0163163_10213957 3300014325 Unclassified 1976
104 Ga0157379_10887613 3300014968 Bacteria 845
105 Ga0163161_10029527 3300017792 Bacteria 3898
106 Ga0163161_10088107 3300017792 Bacteria 2294
107 Ga0213876_10001003 3300021384 Bacteria 18424
108 Ga0207697_10015097 3300025315 Bacteria 3195
109 Ga0207656_10176873 3300025321 Bacteria 1022
110 Ga0207682_10019224 3300025893 Bacteria 2674
111 Ga0207688_10141893 3300025901 Bacteria 1414
112 Ga0207699_10861464 3300025906 Unclassified 668
113 Ga0207645_10126805 3300025907 Bacteria 1659
114 Ga0207643_10169090 3300025908 Bacteria 1319
115 Ga0207705_10320210 3300025909 Bacteria 1191
116 Ga0207705_10534234 3300025909 Bacteria 911
117 Ga0207707_10125839 3300025912 Bacteria 2241
118 Ga0207693_10010502 3300025915 Bacteria 7515
119 Ga0207663_10195312 3300025916 Unclassified 1456
120 Ga0207660_10154363 3300025917 Bacteria 1766
121 Ga0207652_10178445 3300025921 Bacteria 1908
122 Ga0207652_10276960 3300025921 Bacteria 1513
123 Ga0207681_10017280 3300025923 Bacteria 4528
124 Ga0207650_10001307 3300025925 Bacteria 18053
125 Ga0207650_10358998 3300025925 Bacteria 1200
126 Ga0207659_10162192 3300025926 Bacteria 1756
127 Ga0207687_10115267 3300025927 Unclassified 2002
128 Ga0207664_10624448 3300025929 Bacteria 968
129 Ga0207644_10014591 3300025931 Bacteria 5260
130 Ga0207644_10056564 3300025931 Bacteria 2831
131 Ga0207706_10099894 3300025933 Bacteria 2553
132 Ga0207686_10014799 3300025934 Bacteria 4352
133 Ga0207686_10049915 3300025934 Bacteria 2600
134 Ga0207709_10863916 3300025935 Unclassified 733
135 Ga0207669_10059622 3300025937 Bacteria 2335
136 Ga0207704_10236909 3300025938 Bacteria 1361
137 Ga0207691_10027550 3300025940 Bacteria 5326
138 Ga0207689_10535606 3300025942 Unclassified 983
139 Ga0207679_10213440 3300025945 Bacteria 1620
140 Ga0207667_10092973 3300025949 Bacteria 3115
141 Ga0207667_10517313 3300025949 Bacteria 1209
142 Ga0207651_10012369 3300025960 Bacteria 4827
143 Ga0207712_10249000 3300025961 Bacteria 1435
144 Ga0207640_10226986 3300025981 Bacteria 1434
145 Ga0207640_10309668 3300025981 Bacteria 1253
146 Ga0207658_10006466 3300025986 Bacteria 7997
147 Ga0207658_10180711 3300025986 Unclassified 1746
148 Ga0207702_10004213 3300026078 Bacteria 12851
149 Ga0207641_10082609 3300026088 Unclassified 2792
150 Ga0207641_10207459 3300026088 Unclassified 1810
151 Ga0207641_10741538 3300026088 Bacteria 969
152 Ga0207648_10014697 3300026089 Bacteria 7225
153 Ga0207676_10080612 3300026095 Bacteria 2642
154 Ga0207674_10267358 3300026116 Bacteria 1657
155 Ga0207675_100173350 3300026118 Bacteria 2063
156 Ga0207683_10148004 3300026121 Bacteria 2119
157 Ga0207698_10125475 3300026142 Bacteria 2182
158 Ga0209969_1001033 3300027360 Bacteria 3791
159 Ga0209967_1000516 3300027364 Bacteria 5074
160 Ga0210000_1029344 3300027462 Bacteria 858
161 Ga0209971_1001978 3300027682 Bacteria 4996
162 Ga0209974_10000863 3300027876 Bacteria 10457
163 Ga0265356_1001227 3300028017 Bacteria 3892
164 Ga0307515_10152993 3300028794 Bacteria 2400
165 Ga0307515_10452662 3300028794 Bacteria 899
166 Ga0265332_10034126 3300031238 Bacteria 2212
167 Ga0265320_10033938 3300031240 Bacteria 2602
168 Ga0265339_10050048 3300031249 Bacteria 2286
169 Ga0265331_10020266 3300031250 Bacteria 3418
170 Ga0265327_10163121 3300031251 Bacteria 1028
171 Ga0265316_10270659 3300031344 Bacteria 1243
172 Ga0307509_10559318 3300031507 Bacteria 821
173 Ga0307509_10689075 3300031507 Bacteria 689
174 Ga0307508_10058895 3300031616 Bacteria 3398
175 Ga0265314_10011288 3300031711 Bacteria 7388
176 Ga0265342_10032198 3300031712 Bacteria 3235
177 Ga0307516_10207547 3300031730 Bacteria 1675
178 Ga0307405_10054297 3300031731 Bacteria 2500
179 Ga0307405_11726746 3300031731 Bacteria 555
180 Ga0307413_10031212 3300031824 Bacteria 3003
181 Ga0307413_10841922 3300031824 Bacteria 774
182 Ga0307518_10230874 3300031838 Bacteria 1198
183 Ga0307410_10071896 3300031852 Bacteria 2400
184 Ga0307406_10005151 3300031901 Bacteria 7130
185 Ga0307412_10002147 3300031911 Bacteria 10937
186 Ga0307416_100002601 3300032002 Bacteria 10424
187 Ga0307416_100899835 3300032002 Bacteria 985
188 Ga0307416_101652276 3300032002 Bacteria 746
189 Ga0307416_101777330 3300032002 Bacteria 721
190 Ga0307414_10022820 3300032004 Bacteria 3956
191 Ga0307414_10953799 3300032004 Bacteria 788
192 Ga0307414_11021113 3300032004 Bacteria 762
193 Ga0307411_10327121 3300032005 Bacteria 1240
194 Ga0307510_10107185 3300033180 Bacteria 2554
195 Ga0373940_0276501 3300035088 Bacteria 572
196 Ga0373933_0246439 3300035724 Bacteria 1150
197 Ga0373937_0140401 3300036401 Bacteria 2260
198 Ga0395899_0015555 3300037312 Bacteria 5801
199 Ga0395899_0025836 3300037312 Bacteria 4433
200 Ga0395899_0050527 3300037312 Bacteria 3086
201 Ga0395899_0077252 3300037312 Bacteria 2428
202 Ga0395900_0001636 3300037418 Bacteria 26293
203 Ga0395900_0107459 3300037418 Bacteria 2866
204 Ga0395900_0248597 3300037418 Bacteria 1780
205 Ga0395900_0524829 3300037418 Bacteria 1131
206 Ga0395898_0027093 3300037466 Bacteria 5758
207 Ga0395898_0042928 3300037466 Bacteria 4459
208 Ga0395898_0048169 3300037466 Bacteria 4180
209 Ga0395898_0076223 3300037466 Bacteria 3238
210 Ga0395898_0094893 3300037466 Bacteria 2866
211 Ga0395905_0689413 3300037471 Bacteria 924
212 Ga0395901_0010291 3300038443 Bacteria 9472
213 Ga0395901_0012867 3300038443 Bacteria 8485
214 Ga0395901_0033929 3300038443 Bacteria 5270
215 Ga0395901_0230493 3300038443 Bacteria 1933
216 Ga0395901_0339348 3300038443 Bacteria 1552
217 Ga0436365_1753418 3300039437 Bacteria 95553
218 Ga0439438_047864 3300041405 Bacteria 1095
219 Ga0451793_1582599 3300041452 Bacteria 1316
220 Ga0451839_0177942 3300041496 Bacteria 995
221 Ga0451839_0714711 3300041496 Bacteria 991
222 Ga0450891_012817 3300042129 Bacteria 783
223 Ga0450898_002363 3300042134 Bacteria 2626
224 Ga0466969_0023341 3300044656 Bacteria 3188
225 Ga0466965_0095589 3300044683 Bacteria 1515
226 Ga0466965_0155490 3300044683 Bacteria 1197
227 Ga0466966_0012541 3300044684 Bacteria 5614
228 Ga0466961_0003635 3300044693 Bacteria 9607
229 Ga0466970_0421730 3300044765 Bacteria 763
230 Ga0466959_0013036 3300045049 Bacteria 6020
231 Ga0466959_0222542 3300045049 Bacteria 1308
232 Ga0451576_0277489 3300045051 Unclassified 1752
233 Ga0451576_1124966 3300045051 Bacteria 821
234 Ga0495592_0000953 3300046454 Bacteria 20073
235 Ga0495590_0049255 3300046457 Bacteria 1470
236 Ga0495610_0048715 3300046512 Bacteria 2079
237 Ga0495620_0210910 3300046515 Bacteria 745
238 Ga0495631_0097000 3300046518 Bacteria 1269
239 Ga0495632_0009181 3300046519 Bacteria 5977
240 Ga0495632_0026841 3300046519 Bacteria 3024
241 Ga0495637_0194571 3300046520 Bacteria 747
242 Ga0495643_0020059 3300046522 Bacteria 3861
243 Ga0495642_0192781 3300046528 Bacteria 888
244 Ga0495609_0316126 3300046538 Bacteria 634
245 Ga0495597_0008200 3300046542 Bacteria 5251
246 Ga0495656_0051493 3300046615 Bacteria 1762
247 Ga0495668_0339860 3300046616 Unclassified 824
248 Ga0495625_0002387 3300046660 Bacteria 20399
249 Ga0495625_0089599 3300046660 Bacteria 2129
250 Ga0495625_0193889 3300046660 Bacteria 1344
251 Ga0495659_0084638 3300046664 Bacteria 1209
252 Ga0495658_0261847 3300046683 Bacteria 1089
253 Ga0495669_0017517 3300046684 Bacteria 3076
254 Ga0495671_0311726 3300046692 Bacteria 756
255 Ga0495649_0003079 3300046694 Bacteria 11414
256 Ga0495649_0452170 3300046694 Bacteria 641
257 Ga0495660_0005268 3300046810 Bacteria 7752
258 Ga0495674_0278866 3300047319 Bacteria 1370
259 Ga0495687_000733 3300047443 Bacteria 36127
260 Ga0495687_069809 3300047443 Bacteria 1412
261 Ga0495686_0095011 3300047472 Bacteria 1806
262 Ga0495626_0096446 3300048091 Bacteria 1294
263 Ga0501298_007701 3300049521 Bacteria 1791
264 Ga0501031_0559062 3300049568 Bacteria 737
265 Ga0501033_0013898 3300049570 Bacteria 6125
266 Ga0501034_0297424 3300049571 Bacteria 1551
267 Ga0501036_0103940 3300049572 Bacteria 2402
268 Ga0501037_0066902 3300049573 Bacteria 2617
269 Ga0501037_0204904 3300049573 Bacteria 1393
270 Ga0501038_0082230 3300049574 Bacteria 2712
271 Ga0501043_0011455 3300049579 Bacteria 6943
272 Ga0501043_0173367 3300049579 Bacteria 1682
273 Ga0501046_0000013 3300049580 Bacteria 303594
274 Ga0501046_0165263 3300049580 Bacteria 1663
275 Ga0501046_0275826 3300049580 Bacteria 1232
276 Ga0501047_0010106 3300049581 Bacteria 8920
277 Ga0501047_0059060 3300049581 Bacteria 3703
278 Ga0501047_0095512 3300049581 Bacteria 2851
279 Ga0501073_0017431 3300049589 Bacteria 5203
280 Ga0501074_0298731 3300049590 Bacteria 1144
281 Ga0501207_121105 3300049654 Bacteria 543
282 Ga0501235_041231 3300049669 Bacteria 1056
283 Ga0501080_0034227 3300049742 Bacteria 4741
284 Ga0501035_0038947 3300049822 Bacteria 4303
285 Ga0501035_0128668 3300049822 Bacteria 2209
286 Ga0501035_0270816 3300049822 Bacteria 1437
287 Ga0501044_0081085 3300049823 Bacteria 3285
288 Ga0501044_0083340 3300049823 Bacteria 3234
289 Ga0501044_0431381 3300049823 Bacteria 1227
290 Ga0501045_1113072 3300049824 Bacteria 577
291 nmdc:mga03n38_190806_c1 3300050490 Bacteria 1055
292 nmdc:mga00v17_289472_c1 3300050491 Bacteria 1063
293 nmdc:mga0k408_234078_c1 3300050493 Bacteria 1097
294 nmdc:mga0k408_26007_c1 3300050493 Bacteria 3317
295 nmdc:mga0k408_33276_c1 3300050493 Bacteria 2948
296 nmdc:mga0k408_399869_c1 3300050493 Bacteria 818
297 nmdc:mga0k408_506147_c1 3300050493 Bacteria 715
298 nmdc:mga0k408_681336_c1 3300050493 Bacteria 603
299 nmdc:mga0k408_97379_c1 3300050493 Bacteria 1732
300 nmdc:mga08x19_714134_c1 3300050514 Bacteria 711
301 Ga0500578_0056045 3300053086 Bacteria 2521
302 Ga0500658_0002823 3300053134 Bacteria 6666
303 Ga0500645_067341 3300053730 Bacteria 1030
304 Ga0500587_013045 3300053739 Bacteria 1048
305 2510284808 2510065053 Bacteria 5005518
306 2510295118 2510065055 Bacteria 5037935
307 2510312186 2510065058 Bacteria 5005894
308 2587756177 2585428062 Bacteria 6842168
309 2588293951 2588253510 Bacteria 6901809
310 2774131347 2773857672 Bacteria 4993178
311 2894414835 2894414249 Bacteria 4405451
312 2917834207 2917832318 Bacteria 5346010
313 2919127763 2919125081 Bacteria 5385106
314 2984500882 2984499530 Bacteria 5020881
315 2984505673 2984504281 Bacteria 5262371
316 8016732395 8016728285 Bacteria 5263933
317 Ga0495642_0031546
318 rootH2_10153220
319 Ga0032354_1172173
320 Ga0065165_1027889
321 Ga0065715_10141511
322 Ga0070658_10213698
323 Ga0070658_10274504
324 Ga0070676_10124177
325 Ga0070690_100798307
326 Ga0070670_100013108
327 Ga0070670_100132472
328 Ga0070677_10033977
329 Ga0068869_100495221
330 Ga0070666_10256438
331 Ga0068868_100025209
332 Ga0068868_100180824
333 Ga0070689_101490735
334 Ga0070669_100223782
335 Ga0070675_100004787
336 Ga0070671_100030989
337 Ga0070671_100092597
338 Ga0070671_100154542
339 Ga0070674_100027247
340 Ga0070673_100061215
341 Ga0070688_100915901
342 Ga0070667_100011233
343 Ga0070667_100046712
344 Ga0070667_100253029
345 Ga0070709_10469997
346 Ga0070714_100135780
347 Ga0070705_100262693
348 Ga0070678_100009176
349 Ga0070678_100357344
350 Ga0070681_10002340
351 Ga0070681_10023835
352 Ga0070681_10711900
353 Ga0068867_100023787
354 Ga0068867_100115711
355 Ga0070685_10290689
356 Ga0070679_100050130
357 Ga0070679_100231395
358 Ga0070679_100874478
359 Ga0070672_100050422
360 Ga0070695_100035134
361 Ga0070704_101243865
362 Ga0068855_100017217
363 Ga0068855_100029062
364 Ga0070664_100014262
365 Ga0068854_100427110
366 Ga0068856_100009092
367 Ga0068856_100782155
368 Ga0068859_100059743
369 Ga0068864_100052154
370 Ga0068864_100066470
371 Ga0068861_100154645
372 Ga0068851_10627769
373 Ga0068863_100008911
374 Ga0068863_100497305
375 Ga0068862_100100385
376 Ga0068862_100467962
377 Ga0081539_10000521
378 Ga0075368_10247285
379 Ga0075363_100020163
380 Ga0075364_10561609
381 Ga0075367_10050225
382 Ga0075367_10688674
383 Ga0075369_10150662
384 Ga0075366_10000689
385 Ga0075366_10005772
386 Ga0075366_10158705
387 Ga0075366_10363734
388 Ga0075366_10481398
389 Ga0075366_10502714
390 Ga0075370_10013017
391 Ga0075370_10306238
392 Ga0075370_10470857
393 Ga0068871_100097925
394 Ga0068865_100064192
395 Ga0097620_100059743
396 Ga0075435_100960743
397 Ga0105245_10054076
398 Ga0105245_10090365
399 Ga0105243_10769029
400 Ga0105241_10267929
401 Ga0105242_10029651
402 Ga0105242_10263342
403 Ga0105242_10801112
404 Ga0105248_10231302
405 Ga0105249_10105249
406 Ga0105249_11260122
407 Ga0105246_10176582
408 Ga0157371_10002732
409 Ga0157371_10437055
410 Ga0157369_10017685
411 Ga0157374_10002109
412 Ga0157378_10112008
413 Ga0157378_10968758
414 Ga0163162_10548695
415 Ga0157372_10013644
416 Ga0157372_10428795
417 Ga0157372_10596050
418 Ga0157375_10041953
419 Ga0163163_10213957
420 Ga0157379_10887613
421 Ga0163161_10029527
422 Ga0163161_10088107
423 Ga0213876_10001003
424 Ga0207697_10015097
425 Ga0207656_10176873
426 Ga0207682_10019224
427 Ga0207688_10141893
428 Ga0207699_10861464
429 Ga0207645_10126805
430 Ga0207643_10169090
431 Ga0207705_10320210
432 Ga0207705_10534234
433 Ga0207707_10125839
434 Ga0207693_10010502
435 Ga0207663_10195312
436 Ga0207660_10154363
437 Ga0207652_10178445
438 Ga0207652_10276960
439 Ga0207681_10017280
440 Ga0207650_10001307
441 Ga0207650_10358998
442 Ga0207659_10162192
443 Ga0207687_10115267
444 Ga0207664_10624448
445 Ga0207644_10014591
446 Ga0207644_10056564
447 Ga0207706_10099894
448 Ga0207686_10014799
449 Ga0207686_10049915
450 Ga0207709_10863916
451 Ga0207669_10059622
452 Ga0207704_10236909
453 Ga0207691_10027550
454 Ga0207689_10535606
455 Ga0207679_10213440
456 Ga0207667_10092973
457 Ga0207667_10517313
458 Ga0207651_10012369
459 Ga0207712_10249000
460 Ga0207640_10226986
461 Ga0207640_10309668
462 Ga0207658_10006466
463 Ga0207658_10180711
464 Ga0207702_10004213
465 Ga0207641_10082609
466 Ga0207641_10207459
467 Ga0207641_10741538
468 Ga0207648_10014697
469 Ga0207676_10080612
470 Ga0207674_10267358
471 Ga0207675_100173350
472 Ga0207683_10148004
473 Ga0207698_10125475
474 Ga0209969_1001033
475 Ga0209967_1000516
476 Ga0210000_1029344
477 Ga0209971_1001978
478 Ga0209974_10000863
479 Ga0265356_1001227
480 Ga0307515_10152993
481 Ga0307515_10452662
482 Ga0265332_10034126
483 Ga0265320_10033938
484 Ga0265339_10050048
485 Ga0265331_10020266
486 Ga0265327_10163121
487 Ga0265316_10270659
488 Ga0307509_10559318
489 Ga0307509_10689075
490 Ga0307508_10058895
491 Ga0265314_10011288
492 Ga0265342_10032198
493 Ga0307516_10207547
494 Ga0307405_10054297
495 Ga0307405_11726746
496 Ga0307413_10031212
497 Ga0307413_10841922
498 Ga0307518_10230874
499 Ga0307410_10071896
500 Ga0307406_10005151
501 Ga0307412_10002147
502 Ga0307416_100002601
503 Ga0307416_100899835
504 Ga0307416_101652276
505 Ga0307416_101777330
506 Ga0307414_10022820
507 Ga0307414_10953799
508 Ga0307414_11021113
509 Ga0307411_10327121
510 Ga0307510_10107185
511 Ga0373940_0276501
512 Ga0373933_0246439
513 Ga0373937_0140401
514 Ga0395899_0015555
515 Ga0395899_0025836
516 Ga0395899_0050527
517 Ga0395899_0077252
518 Ga0395900_0001636
519 Ga0395900_0107459
520 Ga0395900_0248597
521 Ga0395900_0524829
522 Ga0395898_0027093
523 Ga0395898_0042928
524 Ga0395898_0048169
525 Ga0395898_0076223
526 Ga0395898_0094893
527 Ga0395905_0689413
528 Ga0395901_0010291
529 Ga0395901_0012867
530 Ga0395901_0033929
531 Ga0395901_0230493
532 Ga0395901_0339348
533 Ga0436365_1753418
534 Ga0439438_047864
535 Ga0451793_1582599
536 Ga0451839_0177942
537 Ga0451839_0714711
538 Ga0450891_012817
539 Ga0450898_002363
540 Ga0466969_0023341
541 Ga0466965_0095589
542 Ga0466965_0155490
543 Ga0466966_0012541
544 Ga0466961_0003635
545 Ga0466970_0421730
546 Ga0466959_0013036
547 Ga0466959_0222542
548 Ga0451576_0277489
549 Ga0451576_1124966
550 Ga0495592_0000953
551 Ga0495590_0049255
552 Ga0495610_0048715
553 Ga0495620_0210910
554 Ga0495631_0097000
555 Ga0495632_0009181
556 Ga0495632_0026841
557 Ga0495637_0194571
558 Ga0495643_0020059
559 Ga0495642_0192781
560 Ga0495609_0316126
561 Ga0495597_0008200
562 Ga0495656_0051493
563 Ga0495668_0339860
564 Ga0495625_0002387
565 Ga0495625_0089599
566 Ga0495625_0193889
567 Ga0495659_0084638
568 Ga0495658_0261847
569 Ga0495669_0017517
570 Ga0495671_0311726
571 Ga0495649_0003079
572 Ga0495649_0452170
573 Ga0495660_0005268
574 Ga0495674_0278866
575 Ga0495687_000733
576 Ga0495687_069809
577 Ga0495686_0095011
578 Ga0495626_0096446
579 Ga0501298_007701
580 Ga0501031_0559062
581 Ga0501033_0013898
582 Ga0501034_0297424
583 Ga0501036_0103940
584 Ga0501037_0066902
585 Ga0501037_0204904
586 Ga0501038_0082230
587 Ga0501043_0011455
588 Ga0501043_0173367
589 Ga0501046_0000013
590 Ga0501046_0165263
591 Ga0501046_0275826
592 Ga0501047_0010106
593 Ga0501047_0059060
594 Ga0501047_0095512
595 Ga0501073_0017431
596 Ga0501074_0298731
597 Ga0501207_121105
598 Ga0501235_041231
599 Ga0501080_0034227
600 Ga0501035_0038947
601 Ga0501035_0128668
602 Ga0501035_0270816
603 Ga0501044_0081085
604 Ga0501044_0083340
605 Ga0501044_0431381
606 Ga0501045_1113072
607 nmdc:mga03n38_190806_c1
608 nmdc:mga00v17_289472_c1
609 nmdc:mga0k408_234078_c1
610 nmdc:mga0k408_26007_c1
611 nmdc:mga0k408_33276_c1
612 nmdc:mga0k408_399869_c1
613 nmdc:mga0k408_506147_c1
614 nmdc:mga0k408_681336_c1
615 nmdc:mga0k408_97379_c1
616 nmdc:mga08x19_714134_c1
617 Ga0500578_0056045
618 Ga0500658_0002823
619 Ga0500645_067341
620 Ga0500587_013045
621 2510284808
622 2510295118
623 2510312186
624 2587756177
625 2588293951
626 2774131347
627 2894414835
628 2917834207
629 2919127763
630 2984500882
631 2984505673
632 8016732395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

20

155

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8112 2 149
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8059 1 149
5w8m-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8009 1 149
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.797 2 150
5w8m-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7891 1 149
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8632 2 149 3.60.21.10
af_Q4DWH1_2_191_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.833 2 148 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8313 2 149 3.60.21.10
af_Q8IKJ1_766_1052_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8304 91 150 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8221 2 150 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7L9U224-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9889 2 153 GO:0016787
GO:0046872
AF-A0A530HE49-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9874 1 119 GO:0016787
GO:0046872
AF-A0A2V6USC2-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9873 2 150 GO:0016787
GO:0046872
AF-E8WZF2-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9868 2 153 GO:0016787
GO:0046872
AF-A0A6P2E7T1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9867 2 153 GO:0016787
GO:0046872

Map