F403836

General Info

Members Datasets Scaffolds Average Seq Length
316 209 292 105

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0066228|Ga0495606_0066228_378_743
Length 121
Sequence MARNISAGTTPLLRSHTMYWFVLVLAGLFEIAWAVGLKYTEGFTKLIPSVLTGAAMLVSIVLLAYATKKLPLGTAYAVWTGIGAVGAVTLGIILFGESAQPLRLLCVGLIVVGILGLKLTA

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
14 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
15 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
16 2919085039 Luteibacter sp. 1214 Isolate Unclassified
17 2919395869 Microbacterium resistens 2980 Isolate Unclassified
18 2919404418 Luteibacter sp. 3190 Isolate Unclassified
19 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
20 2920879853 Kocuria salina CV6 Isolate Unclassified
21 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
22 2941471342 Luteibacter sp. 621 Isolate Unclassified
23 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
205 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.14
Metatranscriptomes 1.27
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 1.27
Rhizoplane 2.53
Rhizosphere 70.57
Stem 0
Stem Tuber 0
Unclassified 17.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1018015 3300001904 Bacteria 1119
2 JGI24740J21852_10006283 3300001979 Bacteria 4933
3 JGI24738J21930_10000182 3300002075 Bacteria 16187
4 JGI25162J39368_1015547 3300002737 Bacteria 785
5 JGI25157J39369_1000352 3300002741 Bacteria 32246
6 JGI25151J46595_10000232 3300003187 Bacteria 66291
7 JGI25153J46596_10019484 3300003215 Bacteria 2598
8 Ga0006770J48903_1041571 3300003305 Bacteria 585
9 rootH2_10000931 3300003320 Bacteria 1893
10 rootH1_10176990 3300003323 Bacteria 2216
11 Ga0055540_1063875 3300003792 Bacteria 730
12 Ga0065165_1000118 3300005262 Bacteria 134488
13 Ga0070661_100000837 3300005344 Bacteria 22128
14 Ga0070661_100572562 3300005344 Bacteria 911
15 Ga0070661_100575926 3300005344 Bacteria 908
16 Ga0070668_100651056 3300005347 Bacteria 926
17 Ga0070714_100031787 3300005435 Bacteria 4406
18 Ga0070663_100516998 3300005455 Bacteria 993
19 Ga0070663_102183640 3300005455 Bacteria 500
20 Ga0070681_11556400 3300005458 Bacteria 586
21 Ga0068855_100036704 3300005563 Bacteria 5830
22 Ga0070664_100002549 3300005564 Bacteria 14698
23 Ga0068857_102015178 3300005577 Bacteria 566
24 Ga0068854_100078721 3300005578 Bacteria 2429
25 Ga0068856_100157430 3300005614 Bacteria 2282
26 Ga0068852_102558648 3300005616 Bacteria 530
27 Ga0068859_101998965 3300005617 Bacteria 640
28 Ga0081455_10779591 3300005937 Bacteria 602
29 Ga0075369_10071976 3300006186 Bacteria 1523
30 Ga0075369_10101890 3300006186 Bacteria 1289
31 Ga0075429_100007863 3300006880 Bacteria 9261
32 Ga0097620_101998489 3300006931 Bacteria 640
33 Ga0105247_10004235 3300009101 Bacteria 9197
34 Ga0114129_10018286 3300009147 Bacteria 9982
35 Ga0105237_10215433 3300009545 Bacteria 1920
36 Ga0105237_10510451 3300009545 Bacteria 1209
37 Ga0105238_10149829 3300009551 Bacteria 2308
38 Ga0105238_10196324 3300009551 Bacteria 1994
39 Ga0157316_1073563 3300012510 Bacteria 521
40 Ga0157371_11654605 3300013102 Bacteria 502
41 Ga0157370_10000033 3300013104 Bacteria 138137
42 Ga0157370_10013097 3300013104 Bacteria 8559
43 Ga0157370_10169854 3300013104 Bacteria 2027
44 Ga0157370_10390186 3300013104 Bacteria 1282
45 Ga0157369_10003288 3300013105 Bacteria 19236
46 Ga0157369_11641660 3300013105 Bacteria 653
47 Ga0157372_10176630 3300013307 Bacteria 2472
48 Ga0157372_10366024 3300013307 Bacteria 1680
49 Ga0157372_10786005 3300013307 Bacteria 1106
50 Ga0157375_10602688 3300013308 Bacteria 1257
51 Ga0182008_10003328 3300014497 Bacteria 9763
52 Ga0182008_10007477 3300014497 Bacteria 6028
53 Ga0182006_1000027 3300015261 Bacteria 252946
54 Ga0182006_1001007 3300015261 Bacteria 18434
55 Ga0182007_10004187 3300015262 Bacteria 6599
56 Ga0182005_1002679 3300015265 Bacteria 6260
57 Ga0182005_1015472 3300015265 Bacteria 2127
58 Ga0182005_1025643 3300015265 Bacteria 1609
59 Ga0163161_10072921 3300017792 Bacteria 2515
60 Ga0163161_10094799 3300017792 Bacteria 2213
61 Ga0206349_1307886 3300020075 Bacteria 785
62 Ga0206351_10939305 3300020077 Bacteria 799
63 Ga0154015_1537362 3300020610 Bacteria 602
64 Ga0213876_10005896 3300021384 Bacteria 6698
65 Ga0213875_10041109 3300021388 Bacteria 2175
66 Ga0209674_100348 3300025226 Bacteria 26853
67 Ga0209674_101957 3300025226 Bacteria 4812
68 Ga0209147_105466 3300025229 Bacteria 1897
69 Ga0207427_110682 3300025231 Bacteria 949
70 Ga0209437_101038 3300025233 Bacteria 9335
71 Ga0209026_1000069 3300025250 Bacteria 207574
72 Ga0209148_1012107 3300025254 Bacteria 1585
73 Ga0209759_1009913 3300025256 Bacteria 2840
74 Ga0209129_1000798 3300025258 Bacteria 19879
75 Ga0209025_1000395 3300025294 Bacteria 90003
76 Ga0209758_1005775 3300025297 Bacteria 9282
77 Ga0209758_1032081 3300025297 Bacteria 2141
78 Ga0209256_1011370 3300025299 Bacteria 3570
79 Ga0207426_1008705 3300025302 Bacteria 4068
80 Ga0209051_1004390 3300025303 Bacteria 8720
81 Ga0209257_1049466 3300025304 Bacteria 1196
82 Ga0207647_10001338 3300025904 Bacteria 18951
83 Ga0207705_10954363 3300025909 Bacteria 663
84 Ga0207671_10263744 3300025914 Bacteria 1356
85 Ga0207671_11467471 3300025914 Bacteria 527
86 Ga0207660_10169511 3300025917 Bacteria 1689
87 Ga0207657_10543717 3300025919 Bacteria 908
88 Ga0207649_10000509 3300025920 Bacteria 27403
89 Ga0207649_10097275 3300025920 Bacteria 1941
90 Ga0207649_10856326 3300025920 Bacteria 711
91 Ga0207694_10102008 3300025924 Bacteria 2274
92 Ga0207664_10325070 3300025929 Bacteria 1357
93 Ga0207679_10000185 3300025945 Bacteria 50612
94 Ga0207679_10713195 3300025945 Bacteria 911
95 Ga0207667_10177992 3300025949 Bacteria 2184
96 Ga0207651_10031858 3300025960 Bacteria 3377
97 Ga0207640_10030462 3300025981 Bacteria 3323
98 Ga0207678_10171343 3300026067 Bacteria 1853
99 Ga0207702_10187954 3300026078 Bacteria 1906
100 Ga0209281_1000797 3300027111 Bacteria 29424
101 Ga0209281_1004118 3300027111 Bacteria 4460
102 Ga0209281_1016593 3300027111 Bacteria 1510
103 Ga0265320_10003777 3300031240 Bacteria 10075
104 Ga0265327_10000868 3300031251 Bacteria 44811
105 Ga0307408_100063555 3300031548 Bacteria 2701
106 Ga0265314_10018975 3300031711 Bacteria 5336
107 Ga0307406_10000782 3300031901 Bacteria 17799
108 Ga0307406_10200184 3300031901 Bacteria 1469
109 Ga0307412_10007137 3300031911 Bacteria 6342
110 Ga0307412_10007269 3300031911 Bacteria 6280
111 Ga0307416_101716772 3300032002 Bacteria 732
112 Ga0307416_102164849 3300032002 Bacteria 658
113 Ga0395898_0062729 3300037466 Bacteria 3609
114 Ga0436364_0465566 3300037853 Bacteria 15323
115 Ga0436364_1152931 3300037853 Bacteria 2888
116 Ga0436365_1215810 3300039437 Bacteria 13407
117 Ga0436363_1009039 3300039450 Unclassified 920
118 Ga0436362_0304585 3300039453 Bacteria 5556
119 Ga0439436_0000038 3300041404 Bacteria 42088
120 Ga0439465_0000102 3300041413 Bacteria 19643
121 Ga0451795_0368099 3300041456 Bacteria 971
122 Ga0451802_0560897 3300041460 Bacteria 653
123 Ga0450908_004639 3300042184 Bacteria 2646
124 Ga0466972_0336215 3300044658 Bacteria 706
125 Ga0466982_0032234 3300044672 Bacteria 3116
126 Ga0466964_0292405 3300044706 Bacteria 818
127 Ga0466970_0000301 3300044765 Bacteria 24129
128 Ga0466957_0452032 3300044842 Bacteria 885
129 Ga0466960_0627083 3300044901 Bacteria 640
130 Ga0466967_1954995 3300045976 Bacteria 583
131 Ga0495617_000220 3300046452 Bacteria 34639
132 Ga0495617_003224 3300046452 Bacteria 6194
133 Ga0495590_0056731 3300046457 Bacteria 1369
134 Ga0495638_0000522 3300046460 Bacteria 44904
135 Ga0495638_0034406 3300046460 Bacteria 3234
136 Ga0495650_0002811 3300046471 Bacteria 13358
137 Ga0495584_0129907 3300046491 Bacteria 1278
138 Ga0495585_0000019 3300046492 Bacteria 156966
139 Ga0495585_0007901 3300046492 Bacteria 6468
140 Ga0495607_0000019 3300046501 Bacteria 167319
141 Ga0495607_0000784 3300046501 Bacteria 30230
142 Ga0495607_0035683 3300046501 Bacteria 3006
143 Ga0495583_0032674 3300046506 Bacteria 2509
144 Ga0495606_0000181 3300046507 Bacteria 111247
145 Ga0495606_0000445 3300046507 Bacteria 67615
146 Ga0495606_0019255 3300046507 Bacteria 5086
147 Ga0495606_0066228 3300046507 Bacteria 2291
148 Ga0495610_0071396 3300046512 Bacteria 1619
149 Ga0495610_0135802 3300046512 Bacteria 1063
150 Ga0495616_0000047 3300046513 Bacteria 110592
151 Ga0495616_0088236 3300046513 Bacteria 1472
152 Ga0495620_0003425 3300046515 Bacteria 9081
153 Ga0495620_0004202 3300046515 Bacteria 8148
154 Ga0495620_0010944 3300046515 Bacteria 4759
155 Ga0495631_0000330 3300046518 Bacteria 32514
156 Ga0495631_0000831 3300046518 Bacteria 19646
157 Ga0495632_0000080 3300046519 Bacteria 99523
158 Ga0495632_0024219 3300046519 Bacteria 3228
159 Ga0495632_0050794 3300046519 Bacteria 2043
160 Ga0495648_0022878 3300046524 Bacteria 4291
161 Ga0495648_0073091 3300046524 Bacteria 1981
162 Ga0495654_0056403 3300046530 Bacteria 1899
163 Ga0495609_0023494 3300046538 Bacteria 2833
164 Ga0495668_0008008 3300046616 Bacteria 6659
165 Ga0495611_0000001 3300046648 Bacteria 2628469
166 Ga0495611_0000043 3300046648 Bacteria 94862
167 Ga0495625_0000001 3300046660 Bacteria 1641829
168 Ga0495625_0024822 3300046660 Bacteria 4554
169 Ga0495625_0134361 3300046660 Bacteria 1673
170 Ga0495661_0003900 3300046665 Bacteria 10892
171 Ga0495670_0012673 3300046691 Bacteria 4147
172 Ga0495670_0432320 3300046691 Bacteria 712
173 Ga0495671_0000794 3300046692 Bacteria 22646
174 Ga0495649_0221233 3300046694 Bacteria 979
175 Ga0495589_0000294 3300046794 Bacteria 39809
176 Ga0495660_0000078 3300046810 Bacteria 104055
177 Ga0495660_0000102 3300046810 Bacteria 91206
178 Ga0495672_0001184 3300047320 Bacteria 26451
179 Ga0495679_000001 3300047446 Bacteria 1607568
180 Ga0495673_0000001 3300047469 Bacteria 1630730
181 Ga0495673_0001155 3300047469 Bacteria 22423
182 Ga0495673_0009326 3300047469 Bacteria 5439
183 Ga0495686_0000085 3300047472 Bacteria 198128
184 Ga0495686_0007770 3300047472 Bacteria 7984
185 Ga0495686_0104581 3300047472 Bacteria 1704
186 Ga0495686_0229568 3300047472 Bacteria 1051
187 Ga0496100_0001623 3300048903 Bacteria 11129
188 Ga0496101_0002373 3300048904 Bacteria 11560
189 Ga0496102_0829127 3300048905 Bacteria 847
190 Ga0496106_0019509 3300048909 Bacteria 5030
191 Ga0496106_0253285 3300048909 Bacteria 1408
192 Ga0496107_1330882 3300048910 Bacteria 513
193 Ga0496116_0488764 3300048919 Bacteria 515
194 Ga0496117_0012075 3300048920 Bacteria 7666
195 Ga0496117_0021660 3300048920 Bacteria 5189
196 Ga0496117_0112097 3300048920 Bacteria 1697
197 Ga0496117_0121292 3300048920 Bacteria 1605
198 Ga0496117_0181479 3300048920 Bacteria 1209
199 Ga0496118_0005036 3300048921 Bacteria 15243
200 Ga0496118_0005188 3300048921 Bacteria 14912
201 Ga0496118_0006961 3300048921 Bacteria 12212
202 Ga0496118_0265751 3300048921 Bacteria 965
203 Ga0496118_0270647 3300048921 Bacteria 952
204 Ga0496118_0409974 3300048921 Bacteria 701
205 Ga0496118_0496806 3300048921 Bacteria 608
206 Ga0496121_0002293 3300048924 Bacteria 29709
207 Ga0496121_0004449 3300048924 Bacteria 18827
208 Ga0496121_0015154 3300048924 Bacteria 8107
209 Ga0496121_0035093 3300048924 Bacteria 4499
210 Ga0496122_0140188 3300048925 Bacteria 1514
211 Ga0496122_0522857 3300048925 Bacteria 571
212 Ga0496123_0197079 3300048926 Bacteria 1036
213 Ga0496123_0317918 3300048926 Bacteria 736
214 Ga0496123_0344978 3300048926 Bacteria 694
215 Ga0496125_0051590 3300048928 Bacteria 3391
216 Ga0496126_0544932 3300048929 Bacteria 921
217 Ga0495678_000141 3300049459 Bacteria 86861
218 Ga0495682_0010185 3300049460 Bacteria 3651
219 Ga0495682_0016606 3300049460 Bacteria 2785
220 Ga0501031_0451516 3300049568 Bacteria 830
221 Ga0501032_0026639 3300049569 Bacteria 3974
222 Ga0501032_0031485 3300049569 Bacteria 3636
223 Ga0501032_0160111 3300049569 Bacteria 1478
224 Ga0501033_0065322 3300049570 Bacteria 2677
225 Ga0501033_0165762 3300049570 Bacteria 1588
226 Ga0501034_0265759 3300049571 Bacteria 1657
227 Ga0501034_0277903 3300049571 Bacteria 1614
228 Ga0501034_0681532 3300049571 Bacteria 928
229 Ga0501034_0873327 3300049571 Bacteria 788
230 Ga0501036_0241866 3300049572 Bacteria 1513
231 Ga0501036_1648203 3300049572 Unclassified 517
232 Ga0501037_0060180 3300049573 Bacteria 2770
233 Ga0501037_0145760 3300049573 Bacteria 1693
234 Ga0501037_0158798 3300049573 Bacteria 1612
235 Ga0501038_0028450 3300049574 Bacteria 4966
236 Ga0501038_0076469 3300049574 Bacteria 2827
237 Ga0501038_0328692 3300049574 Bacteria 1194
238 Ga0501038_0828244 3300049574 Bacteria 686
239 Ga0501039_0014374 3300049575 Bacteria 6062
240 Ga0501039_0367849 3300049575 Bacteria 1129
241 Ga0501040_0370607 3300049576 Bacteria 1027
242 Ga0501042_0045257 3300049578 Bacteria 3137
243 Ga0501043_0117910 3300049579 Bacteria 2082
244 Ga0501043_0524558 3300049579 Bacteria 882
245 Ga0501046_0062125 3300049580 Bacteria 2919
246 Ga0501047_0010868 3300049581 Bacteria 8605
247 Ga0501047_0309467 3300049581 Bacteria 1420
248 Ga0501048_0006368 3300049582 Bacteria 8975
249 Ga0501048_0140640 3300049582 Bacteria 1707
250 Ga0501067_0106985 3300049583 Bacteria 1554
251 Ga0501069_0102609 3300049585 Bacteria 1624
252 Ga0501069_0212096 3300049585 Bacteria 1124
253 Ga0501069_0355649 3300049585 Bacteria 863
254 Ga0501070_0076862 3300049586 Bacteria 2763
255 Ga0501070_0076864 3300049586 Bacteria 2763
256 Ga0501070_0151755 3300049586 Bacteria 1911
257 Ga0501070_0285981 3300049586 Bacteria 1345
258 Ga0501072_0155262 3300049588 Bacteria 1825
259 Ga0501073_0060313 3300049589 Bacteria 2647
260 Ga0501073_0175625 3300049589 Bacteria 1482
261 Ga0501073_0187034 3300049589 Bacteria 1433
262 Ga0501074_0058022 3300049590 Bacteria 2788
263 Ga0501074_0918173 3300049590 Bacteria 616
264 Ga0501076_0428257 3300049592 Bacteria 1089
265 Ga0501077_0629556 3300049593 Bacteria 689
266 Ga0501079_0057932 3300049741 Bacteria 2989
267 Ga0501080_0162409 3300049742 Bacteria 2062
268 Ga0501080_0180098 3300049742 Bacteria 1945
269 Ga0501080_0285453 3300049742 Bacteria 1499
270 Ga0501083_0030262 3300049744 Bacteria 3720
271 Ga0501083_0120046 3300049744 Bacteria 1724
272 Ga0501035_0129545 3300049822 Bacteria 2200
273 Ga0501035_0207155 3300049822 Bacteria 1679
274 Ga0501035_0346605 3300049822 Bacteria 1243
275 Ga0501044_0020418 3300049823 Bacteria 7074
276 Ga0501044_0262481 3300049823 Bacteria 1665
277 Ga0501044_0347428 3300049823 Bacteria 1403
278 Ga0501044_0637599 3300049823 Bacteria 955
279 Ga0501045_0630627 3300049824 Bacteria 793
280 nmdc:mga03683_36107_c1 3300050489 Bacteria 2009
281 nmdc:mga05p37_642083_c1 3300050507 Bacteria 1190
282 nmdc:mga09592_4339_c1 3300050508 Bacteria 11466
283 nmdc:mga0qj67_462823_c1 3300050509 Bacteria 1021
284 nmdc:mga0sz30_62511_c1 3300050516 Bacteria 1593
285 Ga0500643_000206 3300053087 Bacteria 55488
286 Ga0500555_000447 3300053103 Bacteria 17103
287 Ga0500633_0222651 3300053160 Bacteria 704
288 Ga0500645_001195 3300053730 Bacteria 13804
289 Ga0501084_1070098 3300054114 Bacteria 677
290 Ga0501082_0012588 3300060353 Bacteria 7270
291 Ga0501082_0351836 3300060353 Bacteria 1284
292 Ga0501082_0950289 3300060353 Bacteria 751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0012075 Ga0496117_0012075_1919_2353 80
2 3300048921 Ga0496118_0005036 Ga0496118_0005036_3104_3538 80
3 3300049569 Ga0501032_0160111 Ga0501032_0160111_1111_1434 88
4 3300049570 Ga0501033_0065322 Ga0501033_0065322_866_1189 88
5 3300049571 Ga0501034_0277903 Ga0501034_0277903_182_505 88
6 3300049573 Ga0501037_0158798 Ga0501037_0158798_1205_1528 88
7 3300049574 Ga0501038_0076469 Ga0501038_0076469_1564_1887 88
8 3300049575 Ga0501039_0367849 Ga0501039_0367849_434_757 88
9 3300049576 Ga0501040_0370607 Ga0501040_0370607_282_593 88
10 3300049579 Ga0501043_0524558 Ga0501043_0524558_385_708 88
11 3300049585 Ga0501069_0102609 Ga0501069_0102609_849_1172 88
12 3300049586 Ga0501070_0151755 Ga0501070_0151755_1151_1474 88
13 3300049589 Ga0501073_0187034 Ga0501073_0187034_101_424 88
14 3300049742 Ga0501080_0180098 Ga0501080_0180098_1351_1674 88
15 3300049822 Ga0501035_0129545 Ga0501035_0129545_661_984 88
16 3300049823 Ga0501044_0347428 Ga0501044_0347428_836_1159 88
17 3300060353 Ga0501082_0351836 Ga0501082_0351836_163_486 88
18 3300009147 Ga0114129_10018286 Ga0114129_100182868 100
19 3300046515 Ga0495620_0010944 Ga0495620_0010944_1985_2293 100
20 3300047320 Ga0495672_0001184 Ga0495672_0001184_23098_23406 100
21 iso_pu_bacteria 2574179768 2574430315 100
22 iso_pu_bacteria 2593339238 2595445700 100
23 iso_pu_bacteria 2593339239 2595449451 100
24 iso_pu_bacteria 2643221562 2643829948 100
25 iso_pu_bacteria 2643221617 2644101980 100
26 iso_pu_bacteria 2643221620 2644115203 100
27 iso_pu_bacteria 2718218334 2721027998 100
28 iso_pu_bacteria 2734482264 2735836432 100
29 iso_pu_bacteria 2738541305 2738870173 100
30 iso_pu_bacteria 2738543009 2739227472 100
31 iso_pu_bacteria 2818991440 2819563182 100
32 iso_pu_bacteria 2842918807 2842921826 100
33 iso_pu_bacteria 2884338543 2884340076 100
34 iso_pu_bacteria 2904463128 2904463800 100
35 iso_pu_bacteria 2919085039 2919085838 100
36 iso_pu_bacteria 2919395869 2919399409 100
37 iso_pu_bacteria 2919404418 2919405967 100
38 iso_pu_bacteria 2920107658 2920108572 100
39 iso_pu_bacteria 2939611941 2939612145 100
40 iso_pu_bacteria 2941471342 2941475173 100
41 iso_pu_bacteria 2953994433 2953997830 100
42 iso_pu_bacteria 8054558443 8054559665 100
43 3300049742 Ga0501080_0285453 Ga0501080_0285453_860_1168 101
44 iso_pu_bacteria 2920879853 2920880435 101
45 3300049568 Ga0501031_0451516 Ga0501031_0451516_342_653 102
46 3300049569 Ga0501032_0026639 Ga0501032_0026639_2094_2405 102
47 3300049569 Ga0501032_0031485 Ga0501032_0031485_1505_1816 102
48 3300049570 Ga0501033_0165762 Ga0501033_0165762_982_1293 102
49 3300049571 Ga0501034_0265759 Ga0501034_0265759_1078_1389 102
50 3300049571 Ga0501034_0873327 Ga0501034_0873327_127_438 102
51 3300049572 Ga0501036_0241866 Ga0501036_0241866_865_1176 102
52 3300049572 Ga0501036_1648203 Ga0501036_1648203_164_487 102
53 3300049573 Ga0501037_0060180 Ga0501037_0060180_410_721 102
54 3300049573 Ga0501037_0145760 Ga0501037_0145760_423_734 102
55 3300049574 Ga0501038_0028450 Ga0501038_0028450_3284_3595 102
56 3300049574 Ga0501038_0328692 Ga0501038_0328692_546_857 102
57 3300049575 Ga0501039_0014374 Ga0501039_0014374_1940_2251 102
58 3300049578 Ga0501042_0045257 Ga0501042_0045257_797_1108 102
59 3300049579 Ga0501043_0117910 Ga0501043_0117910_1170_1481 102
60 3300049580 Ga0501046_0062125 Ga0501046_0062125_597_908 102
61 3300049581 Ga0501047_0010868 Ga0501047_0010868_4412_4723 102
62 3300049581 Ga0501047_0309467 Ga0501047_0309467_66_377 102
63 3300049582 Ga0501048_0140640 Ga0501048_0140640_423_734 102
64 3300049583 Ga0501067_0106985 Ga0501067_0106985_681_992 102
65 3300049585 Ga0501069_0212096 Ga0501069_0212096_714_1025 102
66 3300049585 Ga0501069_0355649 Ga0501069_0355649_338_649 102
67 3300049586 Ga0501070_0076862 Ga0501070_0076862_1375_1686 102
68 3300049586 Ga0501070_0076864 Ga0501070_0076864_1078_1389 102
69 3300049586 Ga0501070_0285981 Ga0501070_0285981_341_652 102
70 3300049588 Ga0501072_0155262 Ga0501072_0155262_1374_1685 102
71 3300049589 Ga0501073_0060313 Ga0501073_0060313_2210_2521 102
72 3300049589 Ga0501073_0175625 Ga0501073_0175625_738_1049 102
73 3300049590 Ga0501074_0058022 Ga0501074_0058022_668_979 102
74 3300049590 Ga0501074_0918173 Ga0501074_0918173_112_435 102
75 3300049592 Ga0501076_0428257 Ga0501076_0428257_115_426 102
76 3300049593 Ga0501077_0629556 Ga0501077_0629556_276_587 102
77 3300049741 Ga0501079_0057932 Ga0501079_0057932_2052_2363 102
78 3300049742 Ga0501080_0162409 Ga0501080_0162409_1562_1873 102
79 3300049744 Ga0501083_0030262 Ga0501083_0030262_141_452 102
80 3300049744 Ga0501083_0120046 Ga0501083_0120046_795_1106 102
81 3300049822 Ga0501035_0207155 Ga0501035_0207155_219_530 102
82 3300049822 Ga0501035_0346605 Ga0501035_0346605_674_985 102
83 3300049823 Ga0501044_0020418 Ga0501044_0020418_2637_2948 102
84 3300049823 Ga0501044_0262481 Ga0501044_0262481_19_330 102
85 3300049823 Ga0501044_0637599 Ga0501044_0637599_338_649 102
86 3300049824 Ga0501045_0630627 Ga0501045_0630627_318_641 102
87 3300054114 Ga0501084_1070098 Ga0501084_1070098_120_431 102
88 3300060353 Ga0501082_0012588 Ga0501082_0012588_4386_4697 102
89 3300060353 Ga0501082_0950289 Ga0501082_0950289_103_414 102
90 3300031240 Ga0265320_10003777 Ga0265320_100037776 103
91 3300031711 Ga0265314_10018975 Ga0265314_100189752 103
92 3300001904 JGI24736J21556_1018015 JGI24736J21556_10180152 104
93 3300001979 JGI24740J21852_10006283 JGI24740J21852_100062834 104
94 3300002075 JGI24738J21930_10000182 JGI24738J21930_100001824 104
95 3300002737 JGI25162J39368_1015547 JGI25162J39368_10155472 104
96 3300002741 JGI25157J39369_1000352 JGI25157J39369_100035216 104
97 3300003187 JGI25151J46595_10000232 JGI25151J46595_1000023227 104
98 3300003215 JGI25153J46596_10019484 JGI25153J46596_100194841 104
99 3300003305 Ga0006770J48903_1041571 Ga0006770J48903_10415711 104
100 3300003320 rootH2_10000931 rootH2_100009313 104
101 3300003323 rootH1_10176990 rootH1_101769903 104
102 3300003792 Ga0055540_1063875 Ga0055540_10638752 104
103 3300005262 Ga0065165_1000118 Ga0065165_100011872 104
104 3300005344 Ga0070661_100000837 Ga0070661_1000008374 104
105 3300005344 Ga0070661_100572562 Ga0070661_1005725621 104
106 3300005344 Ga0070661_100575926 Ga0070661_1005759261 104
107 3300005347 Ga0070668_100651056 Ga0070668_1006510562 104
108 3300005435 Ga0070714_100031787 Ga0070714_1000317875 104
109 3300005455 Ga0070663_100516998 Ga0070663_1005169982 104
110 3300005455 Ga0070663_102183640 Ga0070663_1021836401 104
111 3300005458 Ga0070681_11556400 Ga0070681_115564002 104
112 3300005563 Ga0068855_100036704 Ga0068855_1000367045 104
113 3300005564 Ga0070664_100002549 Ga0070664_10000254913 104
114 3300005577 Ga0068857_102015178 Ga0068857_1020151781 104
115 3300005578 Ga0068854_100078721 Ga0068854_1000787212 104
116 3300005614 Ga0068856_100157430 Ga0068856_1001574303 104
117 3300005616 Ga0068852_102558648 Ga0068852_1025586481 104
118 3300005617 Ga0068859_101998965 Ga0068859_1019989652 104
119 3300005937 Ga0081455_10779591 Ga0081455_107795912 104
120 3300006186 Ga0075369_10071976 Ga0075369_100719761 104
121 3300006186 Ga0075369_10101890 Ga0075369_101018902 104
122 3300006880 Ga0075429_100007863 Ga0075429_1000078636 104
123 3300006931 Ga0097620_101998489 Ga0097620_1019984892 104
124 3300009101 Ga0105247_10004235 Ga0105247_100042359 104
125 3300009545 Ga0105237_10215433 Ga0105237_102154332 104
126 3300009545 Ga0105237_10510451 Ga0105237_105104512 104
127 3300009551 Ga0105238_10149829 Ga0105238_101498292 104
128 3300009551 Ga0105238_10196324 Ga0105238_101963242 104
129 3300012510 Ga0157316_1073563 Ga0157316_10735631 104
130 3300013102 Ga0157371_11654605 Ga0157371_116546052 104
131 3300013104 Ga0157370_10000033 Ga0157370_1000003320 104
132 3300013104 Ga0157370_10013097 Ga0157370_100130979 104
133 3300013104 Ga0157370_10169854 Ga0157370_101698542 104
134 3300013104 Ga0157370_10390186 Ga0157370_103901862 104
135 3300013105 Ga0157369_10003288 Ga0157369_1000328811 104
136 3300013105 Ga0157369_11641660 Ga0157369_116416602 104
137 3300013307 Ga0157372_10176630 Ga0157372_101766303 104
138 3300013307 Ga0157372_10366024 Ga0157372_103660242 104
139 3300013307 Ga0157372_10786005 Ga0157372_107860052 104
140 3300013308 Ga0157375_10602688 Ga0157375_106026882 104
141 3300014497 Ga0182008_10003328 Ga0182008_100033284 104
142 3300014497 Ga0182008_10007477 Ga0182008_100074777 104
143 3300015261 Ga0182006_1000027 Ga0182006_100002787 104
144 3300015261 Ga0182006_1001007 Ga0182006_10010074 104
145 3300015262 Ga0182007_10004187 Ga0182007_100041873 104
146 3300015265 Ga0182005_1002679 Ga0182005_10026795 104
147 3300015265 Ga0182005_1015472 Ga0182005_10154722 104
148 3300015265 Ga0182005_1025643 Ga0182005_10256433 104
149 3300017792 Ga0163161_10072921 Ga0163161_100729214 104
150 3300017792 Ga0163161_10094799 Ga0163161_100947993 104
151 3300020075 Ga0206349_1307886 Ga0206349_13078862 104
152 3300020077 Ga0206351_10939305 Ga0206351_109393051 104
153 3300020610 Ga0154015_1537362 Ga0154015_15373621 104
154 3300021384 Ga0213876_10005896 Ga0213876_100058964 104
155 3300021388 Ga0213875_10041109 Ga0213875_100411093 104
156 3300025226 Ga0209674_100348 Ga0209674_10034822 104
157 3300025226 Ga0209674_101957 Ga0209674_1019571 104
158 3300025229 Ga0209147_105466 Ga0209147_1054661 104
159 3300025231 Ga0207427_110682 Ga0207427_1106823 104
160 3300025233 Ga0209437_101038 Ga0209437_10103810 104
161 3300025250 Ga0209026_1000069 Ga0209026_1000069173 104
162 3300025254 Ga0209148_1012107 Ga0209148_10121072 104
163 3300025256 Ga0209759_1009913 Ga0209759_10099133 104
164 3300025258 Ga0209129_1000798 Ga0209129_100079812 104
165 3300025294 Ga0209025_1000395 Ga0209025_100039547 104
166 3300025297 Ga0209758_1005775 Ga0209758_10057755 104
167 3300025297 Ga0209758_1032081 Ga0209758_10320813 104
168 3300025299 Ga0209256_1011370 Ga0209256_10113701 104
169 3300025302 Ga0207426_1008705 Ga0207426_10087053 104
170 3300025303 Ga0209051_1004390 Ga0209051_10043907 104
171 3300025304 Ga0209257_1049466 Ga0209257_10494663 104
172 3300025904 Ga0207647_10001338 Ga0207647_1000133815 104
173 3300025909 Ga0207705_10954363 Ga0207705_109543631 104
174 3300025914 Ga0207671_10263744 Ga0207671_102637442 104
175 3300025914 Ga0207671_11467471 Ga0207671_114674711 104
176 3300025917 Ga0207660_10169511 Ga0207660_101695112 104
177 3300025919 Ga0207657_10543717 Ga0207657_105437172 104
178 3300025920 Ga0207649_10000509 Ga0207649_1000050914 104
179 3300025920 Ga0207649_10097275 Ga0207649_100972751 104
180 3300025920 Ga0207649_10856326 Ga0207649_108563262 104
181 3300025924 Ga0207694_10102008 Ga0207694_101020082 104
182 3300025929 Ga0207664_10325070 Ga0207664_103250702 104
183 3300025945 Ga0207679_10000185 Ga0207679_1000018535 104
184 3300025945 Ga0207679_10713195 Ga0207679_107131952 104
185 3300025949 Ga0207667_10177992 Ga0207667_101779923 104
186 3300025960 Ga0207651_10031858 Ga0207651_100318583 104
187 3300025981 Ga0207640_10030462 Ga0207640_100304622 104
188 3300026067 Ga0207678_10171343 Ga0207678_101713433 104
189 3300026078 Ga0207702_10187954 Ga0207702_101879542 104
190 3300027111 Ga0209281_1000797 Ga0209281_100079736 104
191 3300027111 Ga0209281_1004118 Ga0209281_10041183 104
192 3300027111 Ga0209281_1016593 Ga0209281_10165932 104
193 3300031251 Ga0265327_10000868 Ga0265327_100008689 104
194 3300031548 Ga0307408_100063555 Ga0307408_1000635552 104
195 3300031901 Ga0307406_10000782 Ga0307406_100007829 104
196 3300031901 Ga0307406_10200184 Ga0307406_102001842 104
197 3300031911 Ga0307412_10007137 Ga0307412_100071373 104
198 3300031911 Ga0307412_10007269 Ga0307412_100072692 104
199 3300032002 Ga0307416_101716772 Ga0307416_1017167722 104
200 3300032002 Ga0307416_102164849 Ga0307416_1021648491 104
201 3300037466 Ga0395898_0062729 Ga0395898_0062729_2929_3255 104
202 3300037853 Ga0436364_0465566 Ga0436364_0465566_12426_12746 104
203 3300037853 Ga0436364_1152931 Ga0436364_1152931_222_536 104
204 3300039437 Ga0436365_1215810 Ga0436365_1215810_7479_7793 104
205 3300039450 Ga0436363_1009039 Ga0436363_1009039_465_797 104
206 3300039453 Ga0436362_0304585 Ga0436362_0304585_1675_1989 104
207 3300041404 Ga0439436_0000038 Ga0439436_0000038_10665_10985 104
208 3300041413 Ga0439465_0000102 Ga0439465_0000102_406_726 104
209 3300041456 Ga0451795_0368099 Ga0451795_0368099_596_910 104
210 3300041460 Ga0451802_0560897 Ga0451802_0560897_225_548 104
211 3300042184 Ga0450908_004639 Ga0450908_004639_2168_2488 104
212 3300044658 Ga0466972_0336215 Ga0466972_0336215_39_365 104
213 3300044672 Ga0466982_0032234 Ga0466982_0032234_1547_1867 104
214 3300044706 Ga0466964_0292405 Ga0466964_0292405_400_726 104
215 3300044765 Ga0466970_0000301 Ga0466970_0000301_13386_13712 104
216 3300044842 Ga0466957_0452032 Ga0466957_0452032_143_469 104
217 3300044901 Ga0466960_0627083 Ga0466960_0627083_250_564 104
218 3300045976 Ga0466967_1954995 Ga0466967_1954995_53_379 104
219 3300046452 Ga0495617_000220 Ga0495617_000220_3642_3956 104
220 3300046452 Ga0495617_003224 Ga0495617_003224_5274_5594 104
221 3300046457 Ga0495590_0056731 Ga0495590_0056731_64_384 104
222 3300046460 Ga0495638_0000522 Ga0495638_0000522_35849_36169 104
223 3300046460 Ga0495638_0034406 Ga0495638_0034406_1825_2139 104
224 3300046471 Ga0495650_0002811 Ga0495650_0002811_67_381 104
225 3300046491 Ga0495584_0129907 Ga0495584_0129907_687_1007 104
226 3300046492 Ga0495585_0000019 Ga0495585_0000019_124024_124338 104
227 3300046492 Ga0495585_0007901 Ga0495585_0007901_4068_4382 104
228 3300046501 Ga0495607_0000019 Ga0495607_0000019_103708_104028 104
229 3300046501 Ga0495607_0000784 Ga0495607_0000784_27822_28142 104
230 3300046501 Ga0495607_0035683 Ga0495607_0035683_1972_2292 104
231 3300046506 Ga0495583_0032674 Ga0495583_0032674_1246_1566 104
232 3300046507 Ga0495606_0000181 Ga0495606_0000181_65031_65345 104
233 3300046507 Ga0495606_0000445 Ga0495606_0000445_63644_63958 104
234 3300046507 Ga0495606_0019255 Ga0495606_0019255_944_1264 104
235 3300046507 Ga0495606_0066228 Ga0495606_0066228_378_743 104
236 3300046512 Ga0495610_0071396 Ga0495610_0071396_58_378 104
237 3300046512 Ga0495610_0135802 Ga0495610_0135802_699_1013 104
238 3300046513 Ga0495616_0000047 Ga0495616_0000047_86661_86975 104
239 3300046513 Ga0495616_0088236 Ga0495616_0088236_583_903 104
240 3300046515 Ga0495620_0003425 Ga0495620_0003425_6673_6987 104
241 3300046515 Ga0495620_0004202 Ga0495620_0004202_7609_7923 104
242 3300046518 Ga0495631_0000330 Ga0495631_0000330_3769_4083 104
243 3300046518 Ga0495631_0000831 Ga0495631_0000831_15418_15732 104
244 3300046519 Ga0495632_0000080 Ga0495632_0000080_185_508 104
245 3300046519 Ga0495632_0024219 Ga0495632_0024219_2741_3106 104
246 3300046519 Ga0495632_0050794 Ga0495632_0050794_88_402 104
247 3300046524 Ga0495648_0022878 Ga0495648_0022878_2355_2669 104
248 3300046524 Ga0495648_0073091 Ga0495648_0073091_153_518 104
249 3300046530 Ga0495654_0056403 Ga0495654_0056403_695_1015 104
250 3300046538 Ga0495609_0023494 Ga0495609_0023494_25_345 104
251 3300046616 Ga0495668_0008008 Ga0495668_0008008_6317_6631 104
252 3300046648 Ga0495611_0000001 Ga0495611_0000001_547770_548090 104
253 3300046648 Ga0495611_0000043 Ga0495611_0000043_122_436 104
254 3300046660 Ga0495625_0000001 Ga0495625_0000001_1367957_1368277 104
255 3300046660 Ga0495625_0024822 Ga0495625_0024822_1776_2090 104
256 3300046660 Ga0495625_0134361 Ga0495625_0134361_625_990 104
257 3300046665 Ga0495661_0003900 Ga0495661_0003900_39_353 104
258 3300046691 Ga0495670_0012673 Ga0495670_0012673_95_409 104
259 3300046691 Ga0495670_0432320 Ga0495670_0432320_339_659 104
260 3300046692 Ga0495671_0000794 Ga0495671_0000794_515_835 104
261 3300046694 Ga0495649_0221233 Ga0495649_0221233_89_409 104
262 3300046794 Ga0495589_0000294 Ga0495589_0000294_2882_3202 104
263 3300046810 Ga0495660_0000078 Ga0495660_0000078_1105_1425 104
264 3300046810 Ga0495660_0000102 Ga0495660_0000102_90830_91150 104
265 3300047446 Ga0495679_000001 Ga0495679_000001_1040506_1040826 104
266 3300047469 Ga0495673_0000001 Ga0495673_0000001_1438312_1438632 104
267 3300047469 Ga0495673_0001155 Ga0495673_0001155_1007_1372 104
268 3300047469 Ga0495673_0009326 Ga0495673_0009326_1139_1459 104
269 3300047472 Ga0495686_0000085 Ga0495686_0000085_37323_37640 104
270 3300047472 Ga0495686_0007770 Ga0495686_0007770_3996_4310 104
271 3300047472 Ga0495686_0104581 Ga0495686_0104581_1291_1605 104
272 3300047472 Ga0495686_0229568 Ga0495686_0229568_680_994 104
273 3300048903 Ga0496100_0001623 Ga0496100_0001623_553_873 104
274 3300048904 Ga0496101_0002373 Ga0496101_0002373_6462_6782 104
275 3300048905 Ga0496102_0829127 Ga0496102_0829127_493_822 104
276 3300048909 Ga0496106_0019509 Ga0496106_0019509_1346_1666 104
277 3300048909 Ga0496106_0253285 Ga0496106_0253285_946_1260 104
278 3300048910 Ga0496107_1330882 Ga0496107_1330882_69_389 104
279 3300048919 Ga0496116_0488764 Ga0496116_0488764_130_444 104
280 3300048920 Ga0496117_0021660 Ga0496117_0021660_341_658 104
281 3300048920 Ga0496117_0112097 Ga0496117_0112097_1080_1400 104
282 3300048920 Ga0496117_0121292 Ga0496117_0121292_1119_1433 104
283 3300048920 Ga0496117_0181479 Ga0496117_0181479_492_821 104
284 3300048921 Ga0496118_0005188 Ga0496118_0005188_767_1081 104
285 3300048921 Ga0496118_0006961 Ga0496118_0006961_4132_4449 104
286 3300048921 Ga0496118_0265751 Ga0496118_0265751_83_403 104
287 3300048921 Ga0496118_0270647 Ga0496118_0270647_510_839 104
288 3300048921 Ga0496118_0409974 Ga0496118_0409974_183_509 104
289 3300048921 Ga0496118_0496806 Ga0496118_0496806_238_558 104
290 3300048924 Ga0496121_0002293 Ga0496121_0002293_19139_19453 104
291 3300048924 Ga0496121_0004449 Ga0496121_0004449_3834_4163 104
292 3300048924 Ga0496121_0015154 Ga0496121_0015154_3984_4304 104
293 3300048924 Ga0496121_0035093 Ga0496121_0035093_111_425 104
294 3300048925 Ga0496122_0140188 Ga0496122_0140188_382_702 104
295 3300048925 Ga0496122_0522857 Ga0496122_0522857_149_463 104
296 3300048926 Ga0496123_0197079 Ga0496123_0197079_39_359 104
297 3300048926 Ga0496123_0317918 Ga0496123_0317918_205_525 104
298 3300048926 Ga0496123_0344978 Ga0496123_0344978_186_500 104
299 3300048928 Ga0496125_0051590 Ga0496125_0051590_156_470 104
300 3300048929 Ga0496126_0544932 Ga0496126_0544932_188_502 104
301 3300049459 Ga0495678_000141 Ga0495678_000141_62_382 104
302 3300049460 Ga0495682_0010185 Ga0495682_0010185_3282_3596 104
303 3300049460 Ga0495682_0016606 Ga0495682_0016606_1232_1552 104
304 3300049571 Ga0501034_0681532 Ga0501034_0681532_459_776 104
305 3300049574 Ga0501038_0828244 Ga0501038_0828244_191_508 104
306 3300049582 Ga0501048_0006368 Ga0501048_0006368_7254_7583 104
307 3300050489 nmdc:mga03683_36107_c1 nmdc:mga03683_36107_c1_1298_1744 104
308 3300050507 nmdc:mga05p37_642083_c1 nmdc:mga05p37_642083_c1_201_554 104
309 3300050508 nmdc:mga09592_4339_c1 nmdc:mga09592_4339_c1_506_829 104
310 3300050509 nmdc:mga0qj67_462823_c1 nmdc:mga0qj67_462823_c1_163_486 104
311 3300050516 nmdc:mga0sz30_62511_c1 nmdc:mga0sz30_62511_c1_955_1275 104
312 3300053087 Ga0500643_000206 Ga0500643_000206_55117_55437 104
313 3300053103 Ga0500555_000447 Ga0500555_000447_16755_17075 104
314 3300053160 Ga0500633_0222651 Ga0500633_0222651_234_599 104
315 3300053730 Ga0500645_001195 Ga0500645_001195_13442_13756 104
316 iso_pu_bacteria 2751185897 2753765000 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

18

110

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9363 1 104
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8877 31 100
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8738 1 98
7mgx-assembly2.cif.gz_F structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8506 1 98
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8479 1 104
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9998 1 104 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9903 1 104 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8983 3 103 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8882 2 104 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8771 1 104 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A7D6H8E5-F1-model_v4 Quaternary ammonium compound efflux SMR transporter SugE 1.001 1 103 GO:0005886
GO:0022857
AF-A0A3A5JHG6-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 1.001 2 103 GO:0005886
GO:0022857
AF-A0A7Z7EBA3-F1-model_v4 deleted 1.001 2 104
AF-Q328H6-F1-model_v4 Guanidinium exporter 1 1 103 GO:0005886
GO:0022857
AF-C6B3X2-F1-model_v4 Guanidinium exporter 0.9968 1 103 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
95.78 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map