F403813

General Info

Members Datasets Scaffolds Average Seq Length
316 234 316 322

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000449|Ga0453684_0000449_96198_97283
Length 361
Sequence MTTPRPSAARPARQRPHIKENAMQLGMVGLGRMGGNMVRRLLRGGHRCVVFDRSTEVVQHMAKEGATAAASLSDLVKQLRPPRAIWMMVPGVFLEPLIADLLPHLEADDTLIDGGNSWYVDAIHRANSLAAHKIHYLDCGTSGGVMGLERGYCLMIGGPVSAVQRLDPIFRTLAPGRGELPRTPGRKAKSGTAEHGYLHCGPSGAGHFVKMVHNGIEYGLMAAYAEGMDLLQHANVGKHARSDDAETAPLSHPEEFQFDLDLADIAEVWRRGSVISSWLLDLSAAALLKDPALEAFSGRVSDSGEGRWTIKAAIDAGVPAPVLSSALYSRFSSRGESAFADKLLSAMRHQFGGHAEKPETP

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
175 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 2.22
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10012473 3300001990 Bacteria 2771
2 JGI24749J21850_1000264 3300002076 Bacteria 8062
3 JGI24751J29686_10006665 3300002459 Bacteria 2354
4 rootH1_10088787 3300003316 Bacteria 2545
5 rootL2_10032254 3300003322 Unclassified 4010
6 JGI25404J52841_10000794 3300003659 Bacteria 5002
7 JGI25404J52841_10005575 3300003659 Bacteria 2601
8 JGI25404J52841_10011523 3300003659 Bacteria 1908
9 Ga0055531_10000712 3300003794 Bacteria 28361
10 Ga0065715_10103786 3300005293 Bacteria 3009
11 Ga0065707_10106432 3300005295 Bacteria 2596
12 Ga0070676_10000080 3300005328 Bacteria 33074
13 Ga0070683_100001128 3300005329 Bacteria 20188
14 Ga0070690_100000379 3300005330 Bacteria 22638
15 Ga0070670_100000674 3300005331 Bacteria 26510
16 Ga0070677_10001792 3300005333 Bacteria 6798
17 Ga0068869_100001981 3300005334 Bacteria 12297
18 Ga0070666_10002036 3300005335 Bacteria 12286
19 Ga0070680_100003400 3300005336 Bacteria 11883
20 Ga0068868_100002919 3300005338 Bacteria 11864
21 Ga0070660_100000058 3300005339 Bacteria 66503
22 Ga0070689_100001020 3300005340 Bacteria 17575
23 Ga0070687_100000029 3300005343 Bacteria 43999
24 Ga0070661_100000363 3300005344 Bacteria 35836
25 Ga0070661_100006503 3300005344 Bacteria 8062
26 Ga0070668_100010906 3300005347 Bacteria 6762
27 Ga0070669_100000134 3300005353 Bacteria 67101
28 Ga0070675_100003237 3300005354 Bacteria 12330
29 Ga0070671_100003460 3300005355 Bacteria 12329
30 Ga0070674_100001536 3300005356 Bacteria 12330
31 Ga0070674_100003129 3300005356 Bacteria 9224
32 Ga0070673_100000210 3300005364 Bacteria 29073
33 Ga0070688_100000073 3300005365 Bacteria 49973
34 Ga0070659_100000173 3300005366 Bacteria 49470
35 Ga0070667_100004958 3300005367 Bacteria 11153
36 Ga0070667_100026258 3300005367 Bacteria 4844
37 Ga0070711_100298229 3300005439 Bacteria 1281
38 Ga0070705_100000145 3300005440 Bacteria 41981
39 Ga0070700_100028129 3300005441 Bacteria 3341
40 Ga0070700_100233292 3300005441 Bacteria 1311
41 Ga0070663_100000595 3300005455 Bacteria 19240
42 Ga0070678_100000040 3300005456 Bacteria 43653
43 Ga0070662_100000483 3300005457 Bacteria 23607
44 Ga0070681_10122970 3300005458 Bacteria 2528
45 Ga0068867_100002922 3300005459 Bacteria 12042
46 Ga0070685_10000121 3300005466 Bacteria 50316
47 Ga0070698_100027118 3300005471 Bacteria 5957
48 Ga0070699_100000002 3300005518 Bacteria 423451
49 Ga0070679_100154517 3300005530 Bacteria 2270
50 Ga0070679_100185667 3300005530 Bacteria 2050
51 Ga0070684_100023960 3300005535 Bacteria 5114
52 Ga0068853_100005425 3300005539 Bacteria 9991
53 Ga0070672_100000078 3300005543 Bacteria 45239
54 Ga0070686_100002539 3300005544 Bacteria 10056
55 Ga0070695_100117406 3300005545 Bacteria 1815
56 Ga0070695_100276366 3300005545 Bacteria 1232
57 Ga0070693_100008365 3300005547 Bacteria 5097
58 Ga0070665_100006089 3300005548 Bacteria 12330
59 Ga0070704_100113541 3300005549 Bacteria 2066
60 Ga0068855_100001612 3300005563 Bacteria 28308
61 Ga0070664_100001540 3300005564 Bacteria 18428
62 Ga0070664_100003700 3300005564 Bacteria 12330
63 Ga0068857_100003489 3300005577 Bacteria 13121
64 Ga0068854_100000355 3300005578 Bacteria 29408
65 Ga0068856_100000627 3300005614 Bacteria 38462
66 Ga0068852_100000081 3300005616 Bacteria 67190
67 Ga0068859_100002289 3300005617 Bacteria 19438
68 Ga0068859_100103337 3300005617 Bacteria 2907
69 Ga0068864_100000401 3300005618 Bacteria 37625
70 Ga0068866_10002368 3300005718 Bacteria 7818
71 Ga0068861_100007102 3300005719 Bacteria 7663
72 Ga0068851_10000407 3300005834 Bacteria 19414
73 Ga0068870_10000022 3300005840 Bacteria 51836
74 Ga0068863_100000598 3300005841 Bacteria 36657
75 Ga0068858_100006314 3300005842 Bacteria 11543
76 Ga0068860_100001125 3300005843 Bacteria 29422
77 Ga0068862_100000906 3300005844 Bacteria 28721
78 Ga0081455_10027974 3300005937 Bacteria 5157
79 Ga0081455_10172986 3300005937 Bacteria 1643
80 Ga0081540_1000694 3300005983 Bacteria 31380
81 Ga0081540_1002326 3300005983 Bacteria 15563
82 Ga0081540_1003975 3300005983 Bacteria 11474
83 Ga0097621_100002894 3300006237 Bacteria 11786
84 Ga0068871_100002476 3300006358 Bacteria 12596
85 Ga0068871_100029060 3300006358 Bacteria 4340
86 Ga0068871_100127099 3300006358 Bacteria 2158
87 Ga0075428_100004436 3300006844 Bacteria 15500
88 Ga0075428_100261378 3300006844 Bacteria 1864
89 Ga0075430_100001297 3300006846 Bacteria 20155
90 Ga0075431_100002128 3300006847 Bacteria 18930
91 Ga0075431_100046408 3300006847 Bacteria 4480
92 Ga0075433_10003021 3300006852 Bacteria 12923
93 Ga0075433_10241224 3300006852 Bacteria 1604
94 Ga0075434_100097432 3300006871 Bacteria 2946
95 Ga0075429_100002509 3300006880 Bacteria 15445
96 Ga0075429_100012573 3300006880 Bacteria 7341
97 Ga0068865_100001942 3300006881 Bacteria 12179
98 Ga0075436_100007045 3300006914 Bacteria 7697
99 Ga0097620_100002289 3300006931 Bacteria 19438
100 Ga0097620_100103337 3300006931 Bacteria 2907
101 Ga0075435_100256734 3300007076 Bacteria 1489
102 Ga0105240_10002350 3300009093 Bacteria 30527
103 Ga0111539_10029366 3300009094 Bacteria 6698
104 Ga0111539_10054389 3300009094 Bacteria 4763
105 Ga0111539_10240975 3300009094 Bacteria 2105
106 Ga0111539_10760857 3300009094 Bacteria 1127
107 Ga0105245_10000211 3300009098 Bacteria 55179
108 Ga0105247_10000261 3300009101 Bacteria 48791
109 Ga0114129_10000005 3300009147 Bacteria 159906
110 Ga0114129_10109590 3300009147 Bacteria 3811
111 Ga0114129_10125877 3300009147 Bacteria 3523
112 Ga0114129_10228881 3300009147 Bacteria 2504
113 Ga0105243_10004432 3300009148 Bacteria 11105
114 Ga0105242_10000241 3300009176 Bacteria 43080
115 Ga0105248_10000944 3300009177 Bacteria 32350
116 Ga0105237_10000612 3300009545 Bacteria 49843
117 Ga0105238_10000291 3300009551 Bacteria 55788
118 Ga0105249_10000315 3300009553 Bacteria 48867
119 Ga0105239_10000109 3300010375 Bacteria 116335
120 Ga0105246_10000152 3300011119 Bacteria 32764
121 Ga0157373_10021528 3300013100 Bacteria 4682
122 Ga0157371_10000699 3300013102 Bacteria 39420
123 Ga0157369_10000918 3300013105 Bacteria 37612
124 Ga0157378_10000141 3300013297 Bacteria 67073
125 Ga0163162_10000262 3300013306 Bacteria 47948
126 Ga0157372_10002121 3300013307 Bacteria 21534
127 Ga0157372_10712931 3300013307 Bacteria 1167
128 Ga0157375_10000612 3300013308 Bacteria 31637
129 Ga0163163_10000597 3300014325 Bacteria 31566
130 Ga0163163_10006587 3300014325 Bacteria 10171
131 Ga0157380_10003490 3300014326 Bacteria 10796
132 Ga0157380_10013958 3300014326 Bacteria 5866
133 Ga0157377_10000184 3300014745 Bacteria 36039
134 Ga0157379_10000031 3300014968 Bacteria 84367
135 Ga0157376_10002617 3300014969 Bacteria 12236
136 Ga0163161_10003159 3300017792 Bacteria 11619
137 Ga0213874_10025848 3300021377 Bacteria 1659
138 Ga0213876_10026233 3300021384 Bacteria 3073
139 Ga0209257_1000005 3300025304 Bacteria 1592528
140 Ga0207656_10000265 3300025321 Bacteria 18273
141 Ga0207682_10000027 3300025893 Bacteria 60031
142 Ga0207642_10000140 3300025899 Bacteria 20355
143 Ga0207710_10001644 3300025900 Bacteria 10902
144 Ga0207688_10001505 3300025901 Bacteria 12237
145 Ga0207680_10001526 3300025903 Bacteria 10900
146 Ga0207645_10000004 3300025907 Bacteria 212114
147 Ga0207643_10000015 3300025908 Bacteria 125948
148 Ga0207707_10172075 3300025912 Bacteria 1892
149 Ga0207707_10307795 3300025912 Bacteria 1369
150 Ga0207660_10005545 3300025917 Bacteria 8196
151 Ga0207662_10000035 3300025918 Bacteria 60201
152 Ga0207657_10000032 3300025919 Bacteria 129236
153 Ga0207649_10000317 3300025920 Bacteria 36587
154 Ga0207649_10001712 3300025920 Bacteria 12612
155 Ga0207652_10038956 3300025921 Bacteria 4032
156 Ga0207681_10000091 3300025923 Bacteria 78672
157 Ga0207650_10000113 3300025925 Bacteria 105325
158 Ga0207659_10000026 3300025926 Bacteria 139726
159 Ga0207659_10001766 3300025926 Bacteria 12807
160 Ga0207687_10000523 3300025927 Bacteria 25729
161 Ga0207644_10000103 3300025931 Bacteria 61764
162 Ga0207690_10000156 3300025932 Bacteria 53469
163 Ga0207706_10000021 3300025933 Bacteria 160122
164 Ga0207709_10005803 3300025935 Bacteria 6975
165 Ga0207670_10000055 3300025936 Bacteria 84688
166 Ga0207669_10000246 3300025937 Bacteria 24600
167 Ga0207669_10042289 3300025937 Bacteria 2659
168 Ga0207704_10001033 3300025938 Bacteria 12361
169 Ga0207691_10000008 3300025940 Bacteria 150329
170 Ga0207711_10000037 3300025941 Bacteria 165538
171 Ga0207689_10000001 3300025942 Bacteria 294504
172 Ga0207661_10002522 3300025944 Bacteria 12596
173 Ga0207679_10000076 3300025945 Bacteria 87612
174 Ga0207679_10000178 3300025945 Bacteria 52369
175 Ga0207667_10009199 3300025949 Bacteria 11671
176 Ga0207651_10000022 3300025960 Bacteria 76544
177 Ga0207712_10000166 3300025961 Bacteria 67960
178 Ga0207668_10001764 3300025972 Bacteria 12647
179 Ga0207640_10000123 3300025981 Bacteria 59036
180 Ga0207658_10000234 3300025986 Bacteria 58649
181 Ga0207677_10000031 3300026023 Bacteria 120606
182 Ga0207703_10000068 3300026035 Bacteria 125011
183 Ga0207639_10000419 3300026041 Bacteria 29402
184 Ga0207678_10000842 3300026067 Bacteria 28145
185 Ga0207708_10015646 3300026075 Bacteria 5690
186 Ga0207708_10029306 3300026075 Bacteria 4172
187 Ga0207702_10003343 3300026078 Bacteria 14710
188 Ga0207641_10000324 3300026088 Bacteria 58511
189 Ga0207648_10000004 3300026089 Bacteria 247806
190 Ga0207676_10000122 3300026095 Bacteria 68609
191 Ga0207674_10003085 3300026116 Bacteria 20601
192 Ga0207675_100000003 3300026118 Bacteria 262542
193 Ga0207683_10000054 3300026121 Bacteria 85047
194 Ga0207698_10000115 3300026142 Bacteria 50202
195 Ga0207428_10091245 3300027907 Bacteria 2365
196 Ga0207428_10350013 3300027907 Bacteria 1087
197 Ga0268266_10000172 3300028379 Bacteria 117909
198 Ga0268265_10000076 3300028380 Bacteria 124918
199 Ga0268264_10000203 3300028381 Bacteria 121101
200 Ga0265334_10001212 3300028573 Bacteria 12603
201 Ga0265338_10041719 3300028800 Bacteria 4288
202 Ga0265338_10047389 3300028800 Bacteria 3925
203 Ga0265338_10134639 3300028800 Bacteria 1945
204 Ga0265328_10044745 3300031239 Bacteria 1628
205 Ga0265331_10043043 3300031250 Bacteria 2188
206 Ga0265327_10000008 3300031251 Bacteria 658870
207 Ga0265327_10000540 3300031251 Bacteria 64733
208 Ga0307508_10165062 3300031616 Bacteria 1818
209 Ga0316575_10023767 3300031665 Bacteria 2370
210 Ga0316575_10053760 3300031665 Bacteria 1604
211 Ga0265314_10145004 3300031711 Bacteria 1463
212 Ga0316578_10072653 3300031728 Bacteria 2038
213 Ga0307409_100665302 3300031995 Bacteria 1037
214 Ga0316580_10059647 3300032139 Bacteria 1171
215 Ga0316592_1022878 3300033524 Bacteria 1339
216 Ga0316588_1013842 3300033528 Bacteria 1757
217 Ga0316587_1017668 3300033529 Bacteria 1197
218 Ga0316596_1009751 3300033541 Bacteria 2308
219 Ga0373954_0001495 3300035118 Bacteria 9506
220 Ga0373961_0000118 3300035241 Bacteria 40437
221 Ga0373961_0059072 3300035241 Bacteria 1158
222 Ga0316574_0042975 3300035398 Bacteria 2791
223 Ga0316574_0108790 3300035398 Bacteria 1776
224 Ga0373937_0016145 3300036401 Bacteria 6624
225 Ga0373937_0049005 3300036401 Bacteria 3868
226 Ga0316582_0127242 3300036647 Bacteria 1708
227 Ga0316582_0141761 3300036647 Bacteria 1621
228 Ga0436365_0863385 3300039437 Bacteria 1828
229 Ga0436365_1418787 3300039437 Bacteria 51993
230 Ga0436360_0704915 3300039438 Bacteria 1451
231 Ga0436363_0240569 3300039450 Bacteria 4087
232 Ga0436363_0625775 3300039450 Bacteria 1375
233 Ga0436363_0934711 3300039450 Bacteria 2627
234 Ga0453684_0000449 3300044712 Bacteria 166164
235 Ga0453684_0016501 3300044712 Bacteria 11538
236 Ga0453684_0166770 3300044712 Unclassified 2599
237 Ga0453684_0433979 3300044712 Bacteria 1465
238 Ga0453684_0667116 3300044712 Unclassified 1133
239 Ga0451576_0000167 3300045051 Bacteria 166164
240 Ga0451576_0031606 3300045051 Bacteria 5642
241 Ga0466958_0011257 3300045836 Bacteria 5036
242 Ga0466958_0087042 3300045836 Bacteria 1929
243 Ga0466967_0173196 3300045976 Bacteria 2032
244 Ga0495598_0042216 3300046537 Bacteria 1338
245 Ga0495621_0037142 3300046539 Bacteria 1693
246 Ga0496102_0029936 3300048905 Bacteria 4871
247 Ga0496103_0007097 3300048906 Bacteria 6689
248 Ga0496106_0001331 3300048909 Bacteria 18506
249 Ga0496107_0044383 3300048910 Bacteria 3195
250 Ga0496109_0003377 3300048912 Bacteria 13354
251 Ga0496113_0016946 3300048916 Bacteria 5044
252 Ga0496114_0000085 3300048917 Bacteria 67056
253 Ga0501031_0046454 3300049568 Bacteria 2831
254 Ga0501031_0091145 3300049568 Bacteria 1988
255 Ga0501036_0001745 3300049572 Bacteria 16886
256 Ga0501036_0039722 3300049572 Bacteria 3981
257 Ga0501039_0017934 3300049575 Bacteria 5429
258 Ga0501039_0033438 3300049575 Bacteria 3964
259 Ga0501039_0242221 3300049575 Bacteria 1418
260 Ga0501041_0009533 3300049577 Bacteria 5723
261 Ga0501042_0004938 3300049578 Bacteria 8540
262 Ga0501047_0245182 3300049581 Bacteria 1641
263 Ga0501048_0010893 3300049582 Bacteria 6781
264 Ga0501048_0018952 3300049582 Bacteria 5057
265 Ga0501067_0107975 3300049583 Bacteria 1547
266 Ga0501068_0011299 3300049584 Bacteria 5038
267 Ga0501068_0040501 3300049584 Bacteria 2797
268 Ga0501071_0028512 3300049587 Bacteria 3936
269 Ga0501072_0009999 3300049588 Bacteria 7214
270 Ga0501075_0000162 3300049591 Bacteria 34354
271 Ga0501077_0000281 3300049593 Bacteria 30339
272 Ga0501202_006441 3300049652 Bacteria 2102
273 Ga0501222_010663 3300049662 Bacteria 1214
274 Ga0501257_001567 3300049686 Bacteria 4768
275 Ga0501225_0039100 3300049705 Bacteria 1307
276 Ga0501079_0009401 3300049741 Bacteria 7409
277 Ga0501079_0145935 3300049741 Bacteria 1844
278 Ga0501080_0003529 3300049742 Bacteria 13779
279 Ga0501080_0210819 3300049742 Bacteria 1780
280 Ga0501081_0119134 3300049743 Bacteria 1879
281 Ga0501083_0098050 3300049744 Bacteria 1934
282 Ga0501035_0042649 3300049822 Bacteria 4092
283 Ga0501035_0256346 3300049822 Bacteria 1484
284 Ga0501044_0000495 3300049823 Bacteria 47801
285 Ga0501044_0001219 3300049823 Bacteria 30541
286 nmdc:mga0k408_37922_c1 3300050493 Bacteria 2767
287 nmdc:mga05p37_11197_c1 3300050507 Bacteria 10661
288 nmdc:mga05p37_159717_c1 3300050507 Bacteria 2753
289 nmdc:mga05p37_277463_c1 3300050507 Bacteria 2000
290 nmdc:mga09592_2867_c1 3300050508 Bacteria 13982
291 nmdc:mga09592_3393_c1 3300050508 Bacteria 12872
292 nmdc:mga0qj67_191176_c1 3300050509 Bacteria 1664
293 nmdc:mga0qj67_193734_c1 3300050509 Bacteria 1651
294 nmdc:mga0qj67_40924_c1 3300050509 Bacteria 3643
295 nmdc:mga06r32_113420_c1 3300050510 Bacteria 2668
296 nmdc:mga06r32_3423_c1 3300050510 Bacteria 14194
297 nmdc:mga06r32_860_c1 3300050510 Bacteria 19351
298 nmdc:mga06r32_86629_c1 3300050510 Bacteria 3055
299 nmdc:mga08y16_148344_c1 3300050511 Bacteria 2438
300 nmdc:mga08y16_17831_c1 3300050511 Bacteria 7477
301 nmdc:mga08y16_262379_c1 3300050511 Bacteria 1784
302 nmdc:mga0n895_35956_c1 3300050512 Bacteria 4779
303 nmdc:mga0n895_735850_c1 3300050512 Bacteria 980
304 nmdc:mga08x19_15051_c1 3300050514 Bacteria 4699
305 nmdc:mga08x19_19475_c1 3300050514 Bacteria 4165
306 nmdc:mga08x19_9755_c1 3300050514 Bacteria 5752
307 nmdc:mga0a205_11847_c1 3300050515 Bacteria 8049
308 nmdc:mga0a205_196165_c1 3300050515 Bacteria 1910
309 nmdc:mga0a205_320461_c1 3300050515 Bacteria 1421
310 nmdc:mga0a205_468_c1 3300050515 Bacteria 30445
311 Ga0501084_0010076 3300054114 Bacteria 7809
312 Ga0501084_0154372 3300054114 Bacteria 1936
313 Ga0501082_0000267 3300060353 Bacteria 45938
314 Ga0501082_0053851 3300060353 Bacteria 3468
315 Ga0530510_0105168 3300061734 Bacteria 2066
316 Ga0530510_0252481 3300061734 Bacteria 1314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0011299 Ga0501068_0011299_23_814 258
2 3300050515 nmdc:mga0a205_320461_c1 nmdc:mga0a205_320461_c1_20_835 270
3 3300028800 Ga0265338_10041719 Ga0265338_100417191 271
4 3300049741 Ga0501079_0145935 Ga0501079_0145935_834_1832 274
5 3300049743 Ga0501081_0119134 Ga0501081_0119134_235_1233 274
6 3300050512 nmdc:mga0n895_735850_c1 nmdc:mga0n895_735850_c1_117_950 274
7 3300061734 Ga0530510_0252481 Ga0530510_0252481_60_1058 274
8 3300006846 Ga0075430_100001297 Ga0075430_1000012979 288
9 3300006880 Ga0075429_100002509 Ga0075429_10000250925 288
10 3300007076 Ga0075435_100256734 Ga0075435_1002567342 288
11 3300009147 Ga0114129_10228881 Ga0114129_102288812 288
12 3300050507 nmdc:mga05p37_277463_c1 nmdc:mga05p37_277463_c1_653_1558 288
13 3300050508 nmdc:mga09592_3393_c1 nmdc:mga09592_3393_c1_10656_11561 288
14 3300050509 nmdc:mga0qj67_191176_c1 nmdc:mga0qj67_191176_c1_383_1288 288
15 3300050510 nmdc:mga06r32_86629_c1 nmdc:mga06r32_86629_c1_377_1282 288
16 3300014325 Ga0163163_10000597 Ga0163163_1000059728 289
17 3300049652 Ga0501202_006441 Ga0501202_006441_80_961 291
18 3300006847 Ga0075431_100002128 Ga0075431_10000212811 294
19 3300050510 nmdc:mga06r32_860_c1 nmdc:mga06r32_860_c1_388_1281 294
20 3300005549 Ga0070704_100113541 Ga0070704_1001135412 295
21 3300006844 Ga0075428_100004436 Ga0075428_1000044369 295
22 3300006847 Ga0075431_100046408 Ga0075431_1000464085 295
23 3300009147 Ga0114129_10000005 Ga0114129_10000005165 295
24 3300044712 Ga0453684_0166770 Ga0453684_0166770_373_1269 295
25 3300050507 nmdc:mga05p37_11197_c1 nmdc:mga05p37_11197_c1_8223_9116 295
26 3300050508 nmdc:mga09592_2867_c1 nmdc:mga09592_2867_c1_7719_8612 295
27 3300050509 nmdc:mga0qj67_193734_c1 nmdc:mga0qj67_193734_c1_351_1244 295
28 3300050510 nmdc:mga06r32_3423_c1 nmdc:mga06r32_3423_c1_11861_12754 295
29 3300003316 rootH1_10088787 rootH1_100887873 296
30 3300003794 Ga0055531_10000712 Ga0055531_1000071218 296
31 3300005617 Ga0068859_100103337 Ga0068859_1001033372 296
32 3300006931 Ga0097620_100103337 Ga0097620_1001033372 296
33 3300025304 Ga0209257_1000005 Ga0209257_1000005192 296
34 3300044712 Ga0453684_0667116 Ga0453684_0667116_16_912 296
35 3300045051 Ga0451576_0031606 Ga0451576_0031606_3361_4257 296
36 3300049662 Ga0501222_010663 Ga0501222_010663_208_1104 296
37 3300049686 Ga0501257_001567 Ga0501257_001567_116_1012 296
38 3300049705 Ga0501225_0039100 Ga0501225_0039100_343_1239 296
39 3300044712 Ga0453684_0016501 Ga0453684_0016501_2487_3386 297
40 3300005530 Ga0070679_100154517 Ga0070679_1001545173 299
41 3300006358 Ga0068871_100029060 Ga0068871_1000290605 299
42 3300031250 Ga0265331_10043043 Ga0265331_100430432 299
43 3300031251 Ga0265327_10000540 Ga0265327_1000054026 299
44 3300039437 Ga0436365_0863385 Ga0436365_0863385_74_979 299
45 3300049572 Ga0501036_0001745 Ga0501036_0001745_11449_12354 299
46 3300049575 Ga0501039_0017934 Ga0501039_0017934_1467_2372 299
47 3300049577 Ga0501041_0009533 Ga0501041_0009533_3045_3950 299
48 3300049582 Ga0501048_0018952 Ga0501048_0018952_1789_2694 299
49 3300049583 Ga0501067_0107975 Ga0501067_0107975_208_1203 299
50 3300049822 Ga0501035_0042649 Ga0501035_0042649_2709_3614 299
51 3300061734 Ga0530510_0105168 Ga0530510_0105168_407_1402 299
52 3300025912 Ga0207707_10307795 Ga0207707_103077952 300
53 3300031995 Ga0307409_100665302 Ga0307409_1006653022 300
54 3300009094 Ga0111539_10029366 Ga0111539_100293667 304
55 3300027907 Ga0207428_10350013 Ga0207428_103500132 304
56 3300050511 nmdc:mga08y16_17831_c1 nmdc:mga08y16_17831_c1_57_980 304
57 3300005545 Ga0070695_100276366 Ga0070695_1002763661 306
58 3300006880 Ga0075429_100012573 Ga0075429_1000125738 306
59 3300005367 Ga0070667_100026258 Ga0070667_1000262586 309
60 3300009094 Ga0111539_10760857 Ga0111539_107608572 310
61 3300036647 Ga0316582_0141761 Ga0316582_0141761_571_1554 312
62 3300045976 Ga0466967_0173196 Ga0466967_0173196_13_957 312
63 3300050493 nmdc:mga0k408_37922_c1 nmdc:mga0k408_37922_c1_1590_2579 312
64 3300050510 nmdc:mga06r32_113420_c1 nmdc:mga06r32_113420_c1_17_1006 312
65 3300049568 Ga0501031_0091145 Ga0501031_0091145_54_1040 313
66 3300049575 Ga0501039_0242221 Ga0501039_0242221_223_1209 313
67 3300049744 Ga0501083_0098050 Ga0501083_0098050_705_1691 313
68 3300039450 Ga0436363_0625775 Ga0436363_0625775_194_1177 314
69 3300050511 nmdc:mga08y16_148344_c1 nmdc:mga08y16_148344_c1_229_1224 316
70 3300039438 Ga0436360_0704915 Ga0436360_0704915_97_1095 317
71 3300050515 nmdc:mga0a205_196165_c1 nmdc:mga0a205_196165_c1_173_1198 318
72 3300039450 Ga0436363_0934711 Ga0436363_0934711_698_1657 319
73 3300003322 rootL2_10032254 rootL2_100322541 320
74 3300009094 Ga0111539_10240975 Ga0111539_102409752 320
75 3300014326 Ga0157380_10013958 Ga0157380_100139584 320
76 3300046537 Ga0495598_0042216 Ga0495598_0042216_272_1279 320
77 3300046539 Ga0495621_0037142 Ga0495621_0037142_491_1498 320
78 3300049581 Ga0501047_0245182 Ga0501047_0245182_286_1257 320
79 3300049822 Ga0501035_0256346 Ga0501035_0256346_360_1331 320
80 3300049823 Ga0501044_0000495 Ga0501044_0000495_20676_21647 320
81 3300049823 Ga0501044_0001219 Ga0501044_0001219_22354_23325 320
82 3300050511 nmdc:mga08y16_262379_c1 nmdc:mga08y16_262379_c1_94_1101 320
83 3300005295 Ga0065707_10106432 Ga0065707_101064322 321
84 3300005471 Ga0070698_100027118 Ga0070698_1000271182 321
85 3300005518 Ga0070699_100000002 Ga0070699_100000002134 321
86 3300027907 Ga0207428_10091245 Ga0207428_100912452 321
87 3300005356 Ga0070674_100003129 Ga0070674_1000031297 322
88 3300005439 Ga0070711_100298229 Ga0070711_1002982291 322
89 3300006844 Ga0075428_100261378 Ga0075428_1002613782 322
90 3300006852 Ga0075433_10241224 Ga0075433_102412241 322
91 3300009147 Ga0114129_10109590 Ga0114129_101095903 322
92 3300025926 Ga0207659_10001766 Ga0207659_100017667 322
93 3300025937 Ga0207669_10042289 Ga0207669_100422892 322
94 3300028800 Ga0265338_10134639 Ga0265338_101346391 322
95 3300031251 Ga0265327_10000008 Ga0265327_10000008567 322
96 3300031616 Ga0307508_10165062 Ga0307508_101650622 322
97 3300031665 Ga0316575_10023767 Ga0316575_100237672 322
98 3300031665 Ga0316575_10053760 Ga0316575_100537601 322
99 3300031728 Ga0316578_10072653 Ga0316578_100726531 322
100 3300032139 Ga0316580_10059647 Ga0316580_100596472 322
101 3300033524 Ga0316592_1022878 Ga0316592_10228781 322
102 3300033528 Ga0316588_1013842 Ga0316588_10138422 322
103 3300033529 Ga0316587_1017668 Ga0316587_10176681 322
104 3300033541 Ga0316596_1009751 Ga0316596_10097511 322
105 3300035118 Ga0373954_0001495 Ga0373954_0001495_5664_6683 322
106 3300035398 Ga0316574_0042975 Ga0316574_0042975_1053_2093 322
107 3300035398 Ga0316574_0108790 Ga0316574_0108790_91_1107 322
108 3300036401 Ga0373937_0016145 Ga0373937_0016145_4890_5909 322
109 3300036401 Ga0373937_0049005 Ga0373937_0049005_1921_2940 322
110 3300036647 Ga0316582_0127242 Ga0316582_0127242_258_1274 322
111 3300044712 Ga0453684_0000449 Ga0453684_0000449_96198_97283 322
112 3300045051 Ga0451576_0000167 Ga0451576_0000167_96198_97283 322
113 3300045836 Ga0466958_0087042 Ga0466958_0087042_303_1277 322
114 3300050509 nmdc:mga0qj67_40924_c1 nmdc:mga0qj67_40924_c1_1898_2917 322
115 3300050512 nmdc:mga0n895_35956_c1 nmdc:mga0n895_35956_c1_3211_4245 322
116 3300050515 nmdc:mga0a205_11847_c1 nmdc:mga0a205_11847_c1_1191_2225 322
117 3300054114 Ga0501084_0154372 Ga0501084_0154372_123_1136 322
118 3300001990 JGI24737J22298_10012473 JGI24737J22298_100124732 323
119 3300002076 JGI24749J21850_1000264 JGI24749J21850_10002642 323
120 3300002459 JGI24751J29686_10006665 JGI24751J29686_100066652 323
121 3300003659 JGI25404J52841_10000794 JGI25404J52841_100007943 323
122 3300003659 JGI25404J52841_10005575 JGI25404J52841_100055752 323
123 3300003659 JGI25404J52841_10011523 JGI25404J52841_100115232 323
124 3300005293 Ga0065715_10103786 Ga0065715_101037863 323
125 3300005328 Ga0070676_10000080 Ga0070676_100000807 323
126 3300005329 Ga0070683_100001128 Ga0070683_1000011286 323
127 3300005330 Ga0070690_100000379 Ga0070690_10000037917 323
128 3300005331 Ga0070670_100000674 Ga0070670_1000006747 323
129 3300005333 Ga0070677_10001792 Ga0070677_100017922 323
130 3300005334 Ga0068869_100001981 Ga0068869_1000019815 323
131 3300005335 Ga0070666_10002036 Ga0070666_100020367 323
132 3300005336 Ga0070680_100003400 Ga0070680_1000034005 323
133 3300005338 Ga0068868_100002919 Ga0068868_1000029197 323
134 3300005339 Ga0070660_100000058 Ga0070660_10000005825 323
135 3300005340 Ga0070689_100001020 Ga0070689_1000010207 323
136 3300005343 Ga0070687_100000029 Ga0070687_10000002913 323
137 3300005344 Ga0070661_100000363 Ga0070661_10000036313 323
138 3300005344 Ga0070661_100006503 Ga0070661_1000065034 323
139 3300005347 Ga0070668_100010906 Ga0070668_1000109067 323
140 3300005353 Ga0070669_100000134 Ga0070669_1000001347 323
141 3300005354 Ga0070675_100003237 Ga0070675_1000032377 323
142 3300005355 Ga0070671_100003460 Ga0070671_1000034607 323
143 3300005356 Ga0070674_100001536 Ga0070674_1000015367 323
144 3300005364 Ga0070673_100000210 Ga0070673_10000021021 323
145 3300005365 Ga0070688_100000073 Ga0070688_1000000737 323
146 3300005366 Ga0070659_100000173 Ga0070659_10000017324 323
147 3300005367 Ga0070667_100004958 Ga0070667_1000049584 323
148 3300005440 Ga0070705_100000145 Ga0070705_10000014515 323
149 3300005441 Ga0070700_100028129 Ga0070700_1000281292 323
150 3300005441 Ga0070700_100233292 Ga0070700_1002332921 323
151 3300005455 Ga0070663_100000595 Ga0070663_1000005955 323
152 3300005456 Ga0070678_100000040 Ga0070678_10000004017 323
153 3300005457 Ga0070662_100000483 Ga0070662_1000004835 323
154 3300005458 Ga0070681_10122970 Ga0070681_101229702 323
155 3300005459 Ga0068867_100002922 Ga0068867_1000029227 323
156 3300005466 Ga0070685_10000121 Ga0070685_100001217 323
157 3300005530 Ga0070679_100185667 Ga0070679_1001856672 323
158 3300005535 Ga0070684_100023960 Ga0070684_1000239603 323
159 3300005539 Ga0068853_100005425 Ga0068853_1000054254 323
160 3300005543 Ga0070672_100000078 Ga0070672_10000007812 323
161 3300005544 Ga0070686_100002539 Ga0070686_1000025397 323
162 3300005545 Ga0070695_100117406 Ga0070695_1001174061 323
163 3300005547 Ga0070693_100008365 Ga0070693_1000083655 323
164 3300005548 Ga0070665_100006089 Ga0070665_1000060898 323
165 3300005563 Ga0068855_100001612 Ga0068855_10000161225 323
166 3300005564 Ga0070664_100001540 Ga0070664_10000154015 323
167 3300005564 Ga0070664_100003700 Ga0070664_1000037008 323
168 3300005577 Ga0068857_100003489 Ga0068857_1000034892 323
169 3300005578 Ga0068854_100000355 Ga0068854_10000035522 323
170 3300005614 Ga0068856_100000627 Ga0068856_10000062712 323
171 3300005616 Ga0068852_100000081 Ga0068852_10000008125 323
172 3300005617 Ga0068859_100002289 Ga0068859_1000022898 323
173 3300005618 Ga0068864_100000401 Ga0068864_10000040124 323
174 3300005718 Ga0068866_10002368 Ga0068866_100023683 323
175 3300005719 Ga0068861_100007102 Ga0068861_1000071025 323
176 3300005834 Ga0068851_10000407 Ga0068851_1000040714 323
177 3300005840 Ga0068870_10000022 Ga0068870_1000002241 323
178 3300005841 Ga0068863_100000598 Ga0068863_10000059834 323
179 3300005842 Ga0068858_100006314 Ga0068858_1000063146 323
180 3300005843 Ga0068860_100001125 Ga0068860_10000112522 323
181 3300005844 Ga0068862_100000906 Ga0068862_1000009065 323
182 3300005937 Ga0081455_10027974 Ga0081455_100279743 323
183 3300005937 Ga0081455_10172986 Ga0081455_101729862 323
184 3300005983 Ga0081540_1000694 Ga0081540_10006944 323
185 3300005983 Ga0081540_1002326 Ga0081540_10023264 323
186 3300005983 Ga0081540_1003975 Ga0081540_100397510 323
187 3300006237 Ga0097621_100002894 Ga0097621_1000028942 323
188 3300006358 Ga0068871_100002476 Ga0068871_10000247611 323
189 3300006358 Ga0068871_100127099 Ga0068871_1001270992 323
190 3300006852 Ga0075433_10003021 Ga0075433_100030216 323
191 3300006871 Ga0075434_100097432 Ga0075434_1000974322 323
192 3300006881 Ga0068865_100001942 Ga0068865_1000019425 323
193 3300006914 Ga0075436_100007045 Ga0075436_1000070455 323
194 3300006931 Ga0097620_100002289 Ga0097620_10000228914 323
195 3300009093 Ga0105240_10002350 Ga0105240_100023505 323
196 3300009094 Ga0111539_10054389 Ga0111539_100543894 323
197 3300009098 Ga0105245_10000211 Ga0105245_1000021150 323
198 3300009101 Ga0105247_10000261 Ga0105247_1000026111 323
199 3300009147 Ga0114129_10125877 Ga0114129_101258771 323
200 3300009148 Ga0105243_10004432 Ga0105243_100044327 323
201 3300009176 Ga0105242_10000241 Ga0105242_1000024111 323
202 3300009177 Ga0105248_10000944 Ga0105248_100009447 323
203 3300009545 Ga0105237_10000612 Ga0105237_100006127 323
204 3300009551 Ga0105238_10000291 Ga0105238_1000029136 323
205 3300009553 Ga0105249_10000315 Ga0105249_1000031541 323
206 3300010375 Ga0105239_10000109 Ga0105239_1000010925 323
207 3300011119 Ga0105246_10000152 Ga0105246_1000015225 323
208 3300013100 Ga0157373_10021528 Ga0157373_100215282 323
209 3300013102 Ga0157371_10000699 Ga0157371_100006998 323
210 3300013105 Ga0157369_10000918 Ga0157369_1000091812 323
211 3300013297 Ga0157378_10000141 Ga0157378_1000014122 323
212 3300013306 Ga0163162_10000262 Ga0163162_100002626 323
213 3300013307 Ga0157372_10002121 Ga0157372_1000212115 323
214 3300013307 Ga0157372_10712931 Ga0157372_107129311 323
215 3300013308 Ga0157375_10000612 Ga0157375_100006126 323
216 3300014325 Ga0163163_10006587 Ga0163163_100065876 323
217 3300014326 Ga0157380_10003490 Ga0157380_100034904 323
218 3300014745 Ga0157377_10000184 Ga0157377_1000018414 323
219 3300014968 Ga0157379_10000031 Ga0157379_1000003112 323
220 3300014969 Ga0157376_10002617 Ga0157376_100026173 323
221 3300017792 Ga0163161_10003159 Ga0163161_100031593 323
222 3300021377 Ga0213874_10025848 Ga0213874_100258482 323
223 3300021384 Ga0213876_10026233 Ga0213876_100262332 323
224 3300025321 Ga0207656_10000265 Ga0207656_1000026513 323
225 3300025893 Ga0207682_10000027 Ga0207682_1000002730 323
226 3300025899 Ga0207642_10000140 Ga0207642_100001407 323
227 3300025900 Ga0207710_10001644 Ga0207710_100016442 323
228 3300025901 Ga0207688_10001505 Ga0207688_100015055 323
229 3300025903 Ga0207680_10001526 Ga0207680_100015265 323
230 3300025907 Ga0207645_10000004 Ga0207645_1000000450 323
231 3300025908 Ga0207643_10000015 Ga0207643_1000001510 323
232 3300025912 Ga0207707_10172075 Ga0207707_101720752 323
233 3300025917 Ga0207660_10005545 Ga0207660_100055455 323
234 3300025918 Ga0207662_10000035 Ga0207662_1000003539 323
235 3300025919 Ga0207657_10000032 Ga0207657_1000003271 323
236 3300025920 Ga0207649_10000317 Ga0207649_1000031733 323
237 3300025920 Ga0207649_10001712 Ga0207649_100017122 323
238 3300025921 Ga0207652_10038956 Ga0207652_100389562 323
239 3300025923 Ga0207681_10000091 Ga0207681_1000009171 323
240 3300025925 Ga0207650_10000113 Ga0207650_1000011349 323
241 3300025926 Ga0207659_10000026 Ga0207659_1000002689 323
242 3300025927 Ga0207687_10000523 Ga0207687_100005232 323
243 3300025931 Ga0207644_10000103 Ga0207644_1000010346 323
244 3300025932 Ga0207690_10000156 Ga0207690_1000015630 323
245 3300025933 Ga0207706_10000021 Ga0207706_1000002170 323
246 3300025935 Ga0207709_10005803 Ga0207709_100058032 323
247 3300025936 Ga0207670_10000055 Ga0207670_1000005525 323
248 3300025937 Ga0207669_10000246 Ga0207669_1000024617 323
249 3300025938 Ga0207704_10001033 Ga0207704_1000103311 323
250 3300025940 Ga0207691_10000008 Ga0207691_1000000864 323
251 3300025941 Ga0207711_10000037 Ga0207711_1000003789 323
252 3300025942 Ga0207689_10000001 Ga0207689_10000001210 323
253 3300025944 Ga0207661_10002522 Ga0207661_100025224 323
254 3300025945 Ga0207679_10000076 Ga0207679_1000007625 323
255 3300025945 Ga0207679_10000178 Ga0207679_1000017844 323
256 3300025949 Ga0207667_10009199 Ga0207667_100091995 323
257 3300025960 Ga0207651_10000022 Ga0207651_1000002250 323
258 3300025961 Ga0207712_10000166 Ga0207712_1000016640 323
259 3300025972 Ga0207668_10001764 Ga0207668_100017646 323
260 3300025981 Ga0207640_10000123 Ga0207640_100001238 323
261 3300025986 Ga0207658_10000234 Ga0207658_1000023433 323
262 3300026023 Ga0207677_10000031 Ga0207677_1000003145 323
263 3300026035 Ga0207703_10000068 Ga0207703_1000006871 323
264 3300026041 Ga0207639_10000419 Ga0207639_100004195 323
265 3300026067 Ga0207678_10000842 Ga0207678_100008425 323
266 3300026075 Ga0207708_10015646 Ga0207708_100156463 323
267 3300026075 Ga0207708_10029306 Ga0207708_100293062 323
268 3300026078 Ga0207702_10003343 Ga0207702_1000334312 323
269 3300026088 Ga0207641_10000324 Ga0207641_1000032413 323
270 3300026089 Ga0207648_10000004 Ga0207648_10000004209 323
271 3300026095 Ga0207676_10000122 Ga0207676_1000012242 323
272 3300026116 Ga0207674_10003085 Ga0207674_1000308516 323
273 3300026118 Ga0207675_100000003 Ga0207675_100000003109 323
274 3300026121 Ga0207683_10000054 Ga0207683_1000005458 323
275 3300026142 Ga0207698_10000115 Ga0207698_1000011524 323
276 3300028379 Ga0268266_10000172 Ga0268266_1000017271 323
277 3300028380 Ga0268265_10000076 Ga0268265_1000007649 323
278 3300028381 Ga0268264_10000203 Ga0268264_100002038 323
279 3300028573 Ga0265334_10001212 Ga0265334_100012127 323
280 3300028800 Ga0265338_10047389 Ga0265338_100473894 323
281 3300031239 Ga0265328_10044745 Ga0265328_100447451 323
282 3300031711 Ga0265314_10145004 Ga0265314_101450041 323
283 3300035241 Ga0373961_0000118 Ga0373961_0000118_4232_5218 323
284 3300035241 Ga0373961_0059072 Ga0373961_0059072_145_1131 323
285 3300039437 Ga0436365_1418787 Ga0436365_1418787_1242_2252 323
286 3300039450 Ga0436363_0240569 Ga0436363_0240569_826_1872 323
287 3300044712 Ga0453684_0433979 Ga0453684_0433979_362_1333 323
288 3300045836 Ga0466958_0011257 Ga0466958_0011257_2235_3227 323
289 3300048905 Ga0496102_0029936 Ga0496102_0029936_2206_3177 323
290 3300048906 Ga0496103_0007097 Ga0496103_0007097_1107_2078 323
291 3300048909 Ga0496106_0001331 Ga0496106_0001331_12572_13543 323
292 3300048910 Ga0496107_0044383 Ga0496107_0044383_382_1353 323
293 3300048912 Ga0496109_0003377 Ga0496109_0003377_6599_7570 323
294 3300048916 Ga0496113_0016946 Ga0496113_0016946_1675_2646 323
295 3300048917 Ga0496114_0000085 Ga0496114_0000085_61000_61980 323
296 3300049568 Ga0501031_0046454 Ga0501031_0046454_475_1509 323
297 3300049572 Ga0501036_0039722 Ga0501036_0039722_2060_3094 323
298 3300049575 Ga0501039_0033438 Ga0501039_0033438_761_1795 323
299 3300049578 Ga0501042_0004938 Ga0501042_0004938_1495_2529 323
300 3300049582 Ga0501048_0010893 Ga0501048_0010893_4546_5580 323
301 3300049584 Ga0501068_0040501 Ga0501068_0040501_1633_2619 323
302 3300049587 Ga0501071_0028512 Ga0501071_0028512_2335_3369 323
303 3300049588 Ga0501072_0009999 Ga0501072_0009999_1218_2252 323
304 3300049591 Ga0501075_0000162 Ga0501075_0000162_18386_19372 323
305 3300049593 Ga0501077_0000281 Ga0501077_0000281_26438_27424 323
306 3300049741 Ga0501079_0009401 Ga0501079_0009401_4988_6022 323
307 3300049742 Ga0501080_0003529 Ga0501080_0003529_6154_7140 323
308 3300049742 Ga0501080_0210819 Ga0501080_0210819_512_1546 323
309 3300050507 nmdc:mga05p37_159717_c1 nmdc:mga05p37_159717_c1_1539_2513 323
310 3300050514 nmdc:mga08x19_15051_c1 nmdc:mga08x19_15051_c1_151_1143 323
311 3300050514 nmdc:mga08x19_19475_c1 nmdc:mga08x19_19475_c1_2067_3050 323
312 3300050514 nmdc:mga08x19_9755_c1 nmdc:mga08x19_9755_c1_2710_3702 323
313 3300050515 nmdc:mga0a205_468_c1 nmdc:mga0a205_468_c1_11634_12632 323
314 3300054114 Ga0501084_0010076 Ga0501084_0010076_1533_2567 323
315 3300060353 Ga0501082_0000267 Ga0501082_0000267_31841_32827 323
316 3300060353 Ga0501082_0053851 Ga0501082_0053851_1262_2296 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

24

180

0.97

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

206

244

0.91

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

250

357

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9465 2 32
6pvj-assembly1.cif.gz_A crystal structure of phqk in complex with malbrancheamide c 0.9455 2 32
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9277 2 313
7zca-assembly1.cif.gz_A-2 crystal structure of the f191m/f201a variant of variovorax paradoxus indole monooxygenase (vpinda1) in complex with benzyl phenyl sulfoxide 0.925 1 32
7z98-assembly1.cif.gz_A crystal structure of f191m variant variovorax paradoxus indole monooxygenase (vpinda1) in complex with methyl phenyl sulfide 0.9236 1 32
ID Description Score Start End Superfamily
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9503 1 137 3.40.50.720
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 1 179 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9478 2 30 3.50.50.60
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9433 1 179 3.40.50.720
3qhaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9361 2 152 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9983 1 115 GO:0004616
GO:0050661
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9964 48 154 GO:0004616
GO:0050661
AF-A0A7W0X915-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9936 1 134 GO:0004616
GO:0050661
AF-A0A521XLA1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9919 1 143 GO:0004616
GO:0050661
AF-A0A7W1CXV2-F1-model_v4 NAD(P)-binding domain-containing protein 0.9869 1 144 GO:0004616
GO:0050661

Feature Viewer

pLDDT pTM Quality
91.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map