F403697

General Info

Members Datasets Scaffolds Average Seq Length
316 182 632 273

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10028911|Ga0213875_100289113
Length 296
Sequence MQCTSGGAVPMSFPFRNKREPLIGIRAAFLTPGAITMLLLFFVPMLIVATYSFLSRGAYGGVMWPWTLENYTRVFDPLYAEIFWRSIWVAALSTLLCFVLGFPLALFIGRSASHKTLLLNLVMLPFWTSFLIRTYAWMFLLRDTGLINSGLEALHLIREPLPLLFNWEAVILGLVYGYLPFMVLPLYATLEKLDPGLLDAAADLGARPWGVLWRVIVPLSKPGIIAGVLLVFVPCLGAYLTPDLMGGGKTVMVGSLVQNQFTTARDWPFGAAVSLLLMTVVLVVTLSLRRSSDELL

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.9
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 8.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10028911 3300021388 Bacteria 2628
2 Ga0058862_12321139 3300004803 Bacteria 1601
3 Ga0065715_10148836 3300005293 Bacteria 1754
4 Ga0070658_10015922 3300005327 Bacteria 6013
5 Ga0070658_10270426 3300005327 Bacteria 1445
6 Ga0070683_100201398 3300005329 Bacteria 1890
7 Ga0070683_100202770 3300005329 Bacteria 1884
8 Ga0070670_100011173 3300005331 Bacteria 7674
9 Ga0068869_100001474 3300005334 Bacteria 13929
10 Ga0068869_100122653 3300005334 Bacteria 1989
11 Ga0068869_100148632 3300005334 Bacteria 1815
12 Ga0068868_100001054 3300005338 Bacteria 18857
13 Ga0068868_100050826 3300005338 Unclassified 3257
14 Ga0068868_100227180 3300005338 Bacteria 1565
15 Ga0070660_100022795 3300005339 Bacteria 4637
16 Ga0070660_100052670 3300005339 Bacteria 3138
17 Ga0070660_100208783 3300005339 Unclassified 1585
18 Ga0070675_100779455 3300005354 Bacteria 873
19 Ga0070659_100013441 3300005366 Bacteria 6093
20 Ga0070659_100041340 3300005366 Bacteria 3604
21 Ga0070711_100085618 3300005439 Bacteria 2258
22 Ga0070705_100022696 3300005440 Bacteria 3357
23 Ga0070705_100027910 3300005440 Bacteria 3086
24 Ga0070678_100042227 3300005456 Bacteria 3240
25 Ga0070678_100312199 3300005456 Bacteria 1340
26 Ga0070681_10055472 3300005458 Bacteria 3945
27 Ga0070681_10078668 3300005458 Unclassified 3254
28 Ga0070681_10110833 3300005458 Bacteria 2684
29 Ga0068867_100031745 3300005459 Bacteria 3816
30 Ga0068867_100042838 3300005459 Bacteria 3313
31 Ga0070706_100067335 3300005467 Bacteria 3312
32 Ga0070698_100013925 3300005471 Bacteria 8507
33 Ga0070699_100005717 3300005518 Bacteria 10889
34 Ga0070699_100039921 3300005518 Bacteria 4065
35 Ga0070699_100091357 3300005518 Bacteria 2662
36 Ga0070679_100036445 3300005530 Bacteria 4880
37 Ga0070679_100065897 3300005530 Bacteria 3610
38 Ga0070679_100104019 3300005530 Bacteria 2826
39 Ga0070679_100262540 3300005530 Bacteria 1682
40 Ga0070679_100389623 3300005530 Bacteria 1340
41 Ga0070684_100093047 3300005535 Bacteria 2683
42 Ga0070697_100172827 3300005536 Bacteria 1829
43 Ga0068853_100011090 3300005539 Bacteria 7310
44 Ga0068853_100230852 3300005539 Unclassified 1693
45 Ga0070695_100044872 3300005545 Bacteria 2816
46 Ga0070696_100002318 3300005546 Bacteria 12559
47 Ga0070665_100191702 3300005548 Bacteria 2045
48 Ga0068855_100026173 3300005563 Bacteria 6979
49 Ga0068855_100224912 3300005563 Bacteria 2103
50 Ga0068855_100328736 3300005563 Bacteria 1688
51 Ga0070664_100001111 3300005564 Bacteria 21282
52 Ga0070664_100298193 3300005564 Bacteria 1456
53 Ga0070664_100363472 3300005564 Unclassified 1318
54 Ga0068857_100000254 3300005577 Bacteria 35845
55 Ga0068857_100269803 3300005577 Bacteria 1563
56 Ga0068854_100023980 3300005578 Bacteria 4172
57 Ga0068856_100003649 3300005614 Bacteria 15461
58 Ga0068856_100006650 3300005614 Bacteria 11329
59 Ga0068856_100025023 3300005614 Bacteria 5818
60 Ga0068856_100912877 3300005614 Bacteria 897
61 Ga0068852_100126693 3300005616 Bacteria 2346
62 Ga0068859_100014594 3300005617 Bacteria 7891
63 Ga0068859_100129936 3300005617 Bacteria 2590
64 Ga0068864_100007058 3300005618 Bacteria 9222
65 Ga0068866_10004605 3300005718 Bacteria 5652
66 Ga0068863_100021837 3300005841 Bacteria 6109
67 Ga0068858_100008323 3300005842 Bacteria 9977
68 Ga0068858_100015514 3300005842 Bacteria 7164
69 Ga0068858_100071109 3300005842 Bacteria 3226
70 Ga0068858_100174473 3300005842 Bacteria 2028
71 Ga0068858_100550454 3300005842 Unclassified 1117
72 Ga0068860_100080829 3300005843 Unclassified 3090
73 Ga0068862_100070412 3300005844 Unclassified 3019
74 Ga0081455_10011599 3300005937 Bacteria 8844
75 Ga0081455_10017857 3300005937 Bacteria 6782
76 Ga0081539_10045401 3300005985 Bacteria 2527
77 Ga0070717_10005352 3300006028 Bacteria 9359
78 Ga0070717_10089231 3300006028 Bacteria 2600
79 Ga0070716_100156666 3300006173 Bacteria 1471
80 Ga0097621_100001793 3300006237 Bacteria 14744
81 Ga0068871_100002603 3300006358 Bacteria 12315
82 Ga0068871_100034640 3300006358 Unclassified 4008
83 Ga0075428_100568371 3300006844 Bacteria 1212
84 Ga0075430_100031450 3300006846 Bacteria 4504
85 Ga0075430_100049270 3300006846 Bacteria 3555
86 Ga0075431_100002802 3300006847 Bacteria 16889
87 Ga0075431_100035986 3300006847 Bacteria 5099
88 Ga0075434_100079890 3300006871 Bacteria 3267
89 Ga0075434_100277196 3300006871 Bacteria 1696
90 Ga0075434_100665547 3300006871 Bacteria 1059
91 Ga0075429_100352893 3300006880 Bacteria 1288
92 Ga0068865_100098786 3300006881 Bacteria 2133
93 Ga0068865_100315107 3300006881 Unclassified 1256
94 Ga0075436_100045039 3300006914 Bacteria 3043
95 Ga0097620_100014594 3300006931 Bacteria 7891
96 Ga0097620_100129931 3300006931 Bacteria 2590
97 Ga0075435_100313240 3300007076 Bacteria 1343
98 Ga0105240_10000643 3300009093 Bacteria 64456
99 Ga0105240_10006430 3300009093 Bacteria 17272
100 Ga0105240_10010946 3300009093 Bacteria 12708
101 Ga0105240_10164289 3300009093 Bacteria 2634
102 Ga0105240_10516072 3300009093 Bacteria 1327
103 Ga0105240_10755952 3300009093 Bacteria 1056
104 Ga0111539_10129172 3300009094 Bacteria 2959
105 Ga0105245_10003071 3300009098 Bacteria 14946
106 Ga0105245_10134873 3300009098 Unclassified 2319
107 Ga0105245_10183627 3300009098 Bacteria 2000
108 Ga0105245_10402479 3300009098 Bacteria 1368
109 Ga0114129_10001374 3300009147 Bacteria 32719
110 Ga0114129_10267644 3300009147 Bacteria 2287
111 Ga0105241_10007308 3300009174 Bacteria 8125
112 Ga0105241_10180851 3300009174 Unclassified 1749
113 Ga0105242_10311206 3300009176 Bacteria 1441
114 Ga0105248_10057064 3300009177 Bacteria 4382
115 Ga0105237_10006665 3300009545 Bacteria 12764
116 Ga0105237_10094547 3300009545 Bacteria 2978
117 Ga0105237_10159450 3300009545 Bacteria 2254
118 Ga0105237_10220863 3300009545 Bacteria 1895
119 Ga0105238_10179524 3300009551 Bacteria 2094
120 Ga0105249_10220583 3300009553 Bacteria 1865
121 Ga0105239_10445901 3300010375 Bacteria 1468
122 Ga0105239_10846970 3300010375 Unclassified 1048
123 Ga0157373_10043139 3300013100 Bacteria 3222
124 Ga0157373_10069759 3300013100 Bacteria 2484
125 Ga0157371_10312812 3300013102 Bacteria 1139
126 Ga0157370_10080908 3300013104 Bacteria 3058
127 Ga0157370_10158965 3300013104 Bacteria 2103
128 Ga0157369_10007867 3300013105 Bacteria 12259
129 Ga0157369_10011909 3300013105 Bacteria 9877
130 Ga0157369_10175723 3300013105 Bacteria 2255
131 Ga0157374_10000341 3300013296 Bacteria 43231
132 Ga0157374_10001857 3300013296 Bacteria 17775
133 Ga0157374_10003119 3300013296 Bacteria 13921
134 Ga0157374_10017039 3300013296 Bacteria 6396
135 Ga0157374_10394781 3300013296 Bacteria 1379
136 Ga0157374_10410862 3300013296 Bacteria 1351
137 Ga0157374_10646250 3300013296 Bacteria 1069
138 Ga0157378_10000604 3300013297 Bacteria 33691
139 Ga0157378_10001529 3300013297 Bacteria 20915
140 Ga0157378_10036332 3300013297 Bacteria 4360
141 Ga0157378_10318693 3300013297 Bacteria 1510
142 Ga0163162_10278849 3300013306 Unclassified 1804
143 Ga0163162_10703302 3300013306 Bacteria 1132
144 Ga0157372_10000359 3300013307 Bacteria 50182
145 Ga0157372_10050276 3300013307 Bacteria 4637
146 Ga0157372_10137547 3300013307 Bacteria 2814
147 Ga0157372_10235309 3300013307 Bacteria 2124
148 Ga0157372_10628549 3300013307 Bacteria 1251
149 Ga0157375_10279505 3300013308 Bacteria 1832
150 Ga0157375_10658248 3300013308 Bacteria 1203
151 Ga0163163_10592738 3300014325 Bacteria 1171
152 Ga0157380_10589794 3300014326 Bacteria 1097
153 Ga0213872_10001311 3300021361 Bacteria 16531
154 Ga0213874_10034653 3300021377 Bacteria 1479
155 Ga0213876_10042082 3300021384 Bacteria 2414
156 Ga0213875_10002949 3300021388 Bacteria 9911
157 Ga0213875_10043138 3300021388 Bacteria 2118
158 Ga0213875_10047559 3300021388 Bacteria 2013
159 Ga0213875_10182268 3300021388 Bacteria 987
160 Ga0207642_10004619 3300025899 Bacteria 4447
161 Ga0207647_10010460 3300025904 Bacteria 6554
162 Ga0207647_10015274 3300025904 Bacteria 5269
163 Ga0207643_10083485 3300025908 Bacteria 1853
164 Ga0207684_10093574 3300025910 Bacteria 2563
165 Ga0207654_10131391 3300025911 Unclassified 1585
166 Ga0207707_10051484 3300025912 Bacteria 3586
167 Ga0207707_10061250 3300025912 Bacteria 3274
168 Ga0207695_10003497 3300025913 Bacteria 22040
169 Ga0207695_10005227 3300025913 Bacteria 17355
170 Ga0207695_10178724 3300025913 Bacteria 2044
171 Ga0207671_10029959 3300025914 Bacteria 4061
172 Ga0207671_10056683 3300025914 Bacteria 2903
173 Ga0207663_10015176 3300025916 Bacteria 4242
174 Ga0207657_10048952 3300025919 Bacteria 3687
175 Ga0207657_10184919 3300025919 Unclassified 1683
176 Ga0207652_10058484 3300025921 Bacteria 3322
177 Ga0207652_10173956 3300025921 Bacteria 1933
178 Ga0207652_10257029 3300025921 Bacteria 1576
179 Ga0207646_10216847 3300025922 Bacteria 1728
180 Ga0207694_10353141 3300025924 Unclassified 1217
181 Ga0207650_10006322 3300025925 Bacteria 8071
182 Ga0207659_10119862 3300025926 Bacteria 2015
183 Ga0207690_10019006 3300025932 Bacteria 4220
184 Ga0207706_10015992 3300025933 Bacteria 6779
185 Ga0207709_10166197 3300025935 Bacteria 1544
186 Ga0207704_10326283 3300025938 Bacteria 1186
187 Ga0207665_10403946 3300025939 Bacteria 1041
188 Ga0207711_10194666 3300025941 Bacteria 1848
189 Ga0207689_10000231 3300025942 Bacteria 49731
190 Ga0207689_10004709 3300025942 Bacteria 12313
191 Ga0207667_10022171 3300025949 Bacteria 7025
192 Ga0207667_10182754 3300025949 Bacteria 2153
193 Ga0207640_10024623 3300025981 Bacteria 3634
194 Ga0207677_10003929 3300026023 Bacteria 7913
195 Ga0207703_10008748 3300026035 Bacteria 7987
196 Ga0207703_10216938 3300026035 Bacteria 1709
197 Ga0207703_10456188 3300026035 Bacteria 1195
198 Ga0207639_10007791 3300026041 Bacteria 7314
199 Ga0207702_10013248 3300026078 Bacteria 6858
200 Ga0207702_10036683 3300026078 Bacteria 4101
201 Ga0207641_10049908 3300026088 Bacteria 3538
202 Ga0207641_10108389 3300026088 Unclassified 2458
203 Ga0207641_10320482 3300026088 Bacteria 1470
204 Ga0207648_10029977 3300026089 Bacteria 4823
205 Ga0207648_10037347 3300026089 Bacteria 4278
206 Ga0207648_10041661 3300026089 Bacteria 4033
207 Ga0207674_10002748 3300026116 Bacteria 21948
208 Ga0207674_10371748 3300026116 Unclassified 1382
209 Ga0207683_10064288 3300026121 Bacteria 3233
210 Ga0207698_10179539 3300026142 Bacteria 1874
211 Ga0268266_10212233 3300028379 Bacteria 1776
212 Ga0268264_10049542 3300028381 Bacteria 3495
213 Ga0265316_10082471 3300031344 Bacteria 2464
214 Ga0373923_0055580 3300035111 Bacteria 1669
215 Ga0373941_0047802 3300035115 Unclassified 1349
216 Ga0373954_0106699 3300035118 Archaea 1353
217 Ga0373954_0175429 3300035118 Bacteria 1050
218 Ga0373957_0051747 3300035120 Bacteria 1572
219 Ga0373955_0034143 3300035172 Bacteria 2684
220 Ga0373935_0031020 3300035692 Bacteria 3314
221 Ga0373935_0066105 3300035692 Bacteria 2322
222 Ga0373927_0000517 3300035695 Bacteria 29365
223 Ga0373937_0014660 3300036401 Bacteria 6921
224 Ga0373937_0058366 3300036401 Bacteria 3545
225 Ga0373937_0370218 3300036401 Bacteria 1358
226 Ga0373925_0484215 3300037068 Bacteria 1015
227 Ga0395898_0141345 3300037466 Unclassified 2305
228 Ga0436364_0155861 3300037853 Bacteria 1866
229 Ga0436364_0213210 3300037853 Bacteria 2780
230 Ga0436364_0343138 3300037853 Bacteria 6717
231 Ga0436364_0547608 3300037853 Bacteria 3590
232 Ga0436364_1103136 3300037853 Bacteria 2776
233 Ga0436364_1324799 3300037853 Bacteria 1344
234 Ga0436364_1551406 3300037853 Bacteria 7195
235 Ga0395901_0215008 3300038443 Unclassified 2011
236 Ga0436365_0674106 3300039437 Unclassified 3358
237 Ga0436365_0998534 3300039437 Bacteria 4998
238 Ga0436365_1171591 3300039437 Unclassified 1506
239 Ga0436365_1268549 3300039437 Bacteria 1779
240 Ga0436365_1649392 3300039437 Bacteria 2414
241 Ga0436365_1913335 3300039437 Bacteria 4752
242 Ga0436361_1176589 3300039447 Bacteria 29457
243 Ga0436363_1297548 3300039450 Bacteria 1244
244 Ga0436362_0356050 3300039453 Unclassified 934
245 Ga0436362_0522904 3300039453 Bacteria 1041
246 Ga0451577_0181277 3300042876 Bacteria 1899
247 Ga0466957_0002044 3300044842 Bacteria 10772
248 Ga0466957_0348732 3300044842 Bacteria 1004
249 Ga0451576_0030746 3300045051 Bacteria 5734
250 Ga0451576_0108198 3300045051 Bacteria 2893
251 Ga0495651_0198059 3300046462 Bacteria 1408
252 Ga0495580_0005960 3300046472 Bacteria 9993
253 Ga0495580_0011356 3300046472 Bacteria 6892
254 Ga0495580_0016169 3300046472 Bacteria 5607
255 Ga0495628_0225783 3300046516 Bacteria 1405
256 Ga0495645_0010141 3300046543 Bacteria 6601
257 Ga0495667_0250317 3300046559 Bacteria 1128
258 Ga0495674_0136712 3300047319 Bacteria 2062
259 Ga0495602_0396756 3300048088 Bacteria 985
260 Ga0496109_0601515 3300048912 Bacteria 1036
261 Ga0496112_0015973 3300048915 Bacteria 7018
262 Ga0496112_0041067 3300048915 Bacteria 4525
263 Ga0496112_0099247 3300048915 Bacteria 2881
264 Ga0496115_0017584 3300048918 Bacteria 5471
265 Ga0496115_0182998 3300048918 Bacteria 1732
266 Ga0501031_0139883 3300049568 Bacteria 1582
267 Ga0501033_0181185 3300049570 Bacteria 1510
268 Ga0501034_0005190 3300049571 Bacteria 14289
269 Ga0501036_0020236 3300049572 Bacteria 5589
270 Ga0501038_0156260 3300049574 Bacteria 1857
271 Ga0501040_0001209 3300049576 Bacteria 16449
272 Ga0501041_0001444 3300049577 Bacteria 13140
273 Ga0501042_0224968 3300049578 Bacteria 1353
274 Ga0501043_0107365 3300049579 Bacteria 2192
275 Ga0501046_0008275 3300049580 Bacteria 9082
276 Ga0501046_0261043 3300049580 Unclassified 1273
277 Ga0501047_0014936 3300049581 Bacteria 7390
278 Ga0501047_0030174 3300049581 Bacteria 5228
279 Ga0501047_0038962 3300049581 Bacteria 4597
280 Ga0501047_0072974 3300049581 Bacteria 3304
281 Ga0501047_0523097 3300049581 Bacteria 1012
282 Ga0501048_0033448 3300049582 Bacteria 3714
283 Ga0501070_0047495 3300049586 Bacteria 3567
284 Ga0501073_0047612 3300049589 Bacteria 3013
285 Ga0501075_0001128 3300049591 Bacteria 17211
286 Ga0501076_0004743 3300049592 Bacteria 9701
287 Ga0501077_0068277 3300049593 Bacteria 2253
288 Ga0501239_000924 3300049672 Bacteria 2396
289 Ga0501249_010676 3300049679 Bacteria 1924
290 Ga0501079_0055969 3300049741 Bacteria 3043
291 Ga0501080_0057065 3300049742 Bacteria 3636
292 Ga0501080_0484828 3300049742 Bacteria 1106
293 Ga0501083_0142341 3300049744 Bacteria 1570
294 Ga0501268_006003 3300049765 Bacteria 1767
295 Ga0501035_0032111 3300049822 Bacteria 4779
296 Ga0501035_0049513 3300049822 Bacteria 3765
297 Ga0501044_0000829 3300049823 Bacteria 37106
298 Ga0501044_0003219 3300049823 Bacteria 18399
299 Ga0501044_0031943 3300049823 Bacteria 5536
300 Ga0501044_0122668 3300049823 Bacteria 2598
301 Ga0501045_0009319 3300049824 Bacteria 6865
302 nmdc:mga05p37_136214_c1 3300050507 Bacteria 3011
303 nmdc:mga05p37_266906_c1 3300050507 Bacteria 2046
304 nmdc:mga09592_248752_c1 3300050508 Bacteria 1541
305 nmdc:mga0qj67_28369_c1 3300050509 Bacteria 4344
306 nmdc:mga0qj67_51401_c1 3300050509 Bacteria 3259
307 nmdc:mga06r32_88713_c1 3300050510 Bacteria 3019
308 nmdc:mga08y16_112265_c1 3300050511 Bacteria 2837
309 nmdc:mga0n895_39194_c1 3300050512 Bacteria 4595
310 nmdc:mga0rr50_87725_c1 3300050513 Bacteria 2415
311 nmdc:mga08x19_24257_c1 3300050514 Bacteria 3768
312 nmdc:mga0a205_161564_c1 3300050515 Bacteria 2137
313 Ga0501084_0004067 3300054114 Bacteria 11913
314 Ga0501082_0000484 3300060353 Bacteria 35166
315 Ga0501082_0017779 3300060353 Bacteria 6125
316 Ga0530510_0099285 3300061734 Bacteria 2128
317 Ga0213875_10028911
318 Ga0058862_12321139
319 Ga0065715_10148836
320 Ga0070658_10015922
321 Ga0070658_10270426
322 Ga0070683_100201398
323 Ga0070683_100202770
324 Ga0070670_100011173
325 Ga0068869_100001474
326 Ga0068869_100122653
327 Ga0068869_100148632
328 Ga0068868_100001054
329 Ga0068868_100050826
330 Ga0068868_100227180
331 Ga0070660_100022795
332 Ga0070660_100052670
333 Ga0070660_100208783
334 Ga0070675_100779455
335 Ga0070659_100013441
336 Ga0070659_100041340
337 Ga0070711_100085618
338 Ga0070705_100022696
339 Ga0070705_100027910
340 Ga0070678_100042227
341 Ga0070678_100312199
342 Ga0070681_10055472
343 Ga0070681_10078668
344 Ga0070681_10110833
345 Ga0068867_100031745
346 Ga0068867_100042838
347 Ga0070706_100067335
348 Ga0070698_100013925
349 Ga0070699_100005717
350 Ga0070699_100039921
351 Ga0070699_100091357
352 Ga0070679_100036445
353 Ga0070679_100065897
354 Ga0070679_100104019
355 Ga0070679_100262540
356 Ga0070679_100389623
357 Ga0070684_100093047
358 Ga0070697_100172827
359 Ga0068853_100011090
360 Ga0068853_100230852
361 Ga0070695_100044872
362 Ga0070696_100002318
363 Ga0070665_100191702
364 Ga0068855_100026173
365 Ga0068855_100224912
366 Ga0068855_100328736
367 Ga0070664_100001111
368 Ga0070664_100298193
369 Ga0070664_100363472
370 Ga0068857_100000254
371 Ga0068857_100269803
372 Ga0068854_100023980
373 Ga0068856_100003649
374 Ga0068856_100006650
375 Ga0068856_100025023
376 Ga0068856_100912877
377 Ga0068852_100126693
378 Ga0068859_100014594
379 Ga0068859_100129936
380 Ga0068864_100007058
381 Ga0068866_10004605
382 Ga0068863_100021837
383 Ga0068858_100008323
384 Ga0068858_100015514
385 Ga0068858_100071109
386 Ga0068858_100174473
387 Ga0068858_100550454
388 Ga0068860_100080829
389 Ga0068862_100070412
390 Ga0081455_10011599
391 Ga0081455_10017857
392 Ga0081539_10045401
393 Ga0070717_10005352
394 Ga0070717_10089231
395 Ga0070716_100156666
396 Ga0097621_100001793
397 Ga0068871_100002603
398 Ga0068871_100034640
399 Ga0075428_100568371
400 Ga0075430_100031450
401 Ga0075430_100049270
402 Ga0075431_100002802
403 Ga0075431_100035986
404 Ga0075434_100079890
405 Ga0075434_100277196
406 Ga0075434_100665547
407 Ga0075429_100352893
408 Ga0068865_100098786
409 Ga0068865_100315107
410 Ga0075436_100045039
411 Ga0097620_100014594
412 Ga0097620_100129931
413 Ga0075435_100313240
414 Ga0105240_10000643
415 Ga0105240_10006430
416 Ga0105240_10010946
417 Ga0105240_10164289
418 Ga0105240_10516072
419 Ga0105240_10755952
420 Ga0111539_10129172
421 Ga0105245_10003071
422 Ga0105245_10134873
423 Ga0105245_10183627
424 Ga0105245_10402479
425 Ga0114129_10001374
426 Ga0114129_10267644
427 Ga0105241_10007308
428 Ga0105241_10180851
429 Ga0105242_10311206
430 Ga0105248_10057064
431 Ga0105237_10006665
432 Ga0105237_10094547
433 Ga0105237_10159450
434 Ga0105237_10220863
435 Ga0105238_10179524
436 Ga0105249_10220583
437 Ga0105239_10445901
438 Ga0105239_10846970
439 Ga0157373_10043139
440 Ga0157373_10069759
441 Ga0157371_10312812
442 Ga0157370_10080908
443 Ga0157370_10158965
444 Ga0157369_10007867
445 Ga0157369_10011909
446 Ga0157369_10175723
447 Ga0157374_10000341
448 Ga0157374_10001857
449 Ga0157374_10003119
450 Ga0157374_10017039
451 Ga0157374_10394781
452 Ga0157374_10410862
453 Ga0157374_10646250
454 Ga0157378_10000604
455 Ga0157378_10001529
456 Ga0157378_10036332
457 Ga0157378_10318693
458 Ga0163162_10278849
459 Ga0163162_10703302
460 Ga0157372_10000359
461 Ga0157372_10050276
462 Ga0157372_10137547
463 Ga0157372_10235309
464 Ga0157372_10628549
465 Ga0157375_10279505
466 Ga0157375_10658248
467 Ga0163163_10592738
468 Ga0157380_10589794
469 Ga0213872_10001311
470 Ga0213874_10034653
471 Ga0213876_10042082
472 Ga0213875_10002949
473 Ga0213875_10043138
474 Ga0213875_10047559
475 Ga0213875_10182268
476 Ga0207642_10004619
477 Ga0207647_10010460
478 Ga0207647_10015274
479 Ga0207643_10083485
480 Ga0207684_10093574
481 Ga0207654_10131391
482 Ga0207707_10051484
483 Ga0207707_10061250
484 Ga0207695_10003497
485 Ga0207695_10005227
486 Ga0207695_10178724
487 Ga0207671_10029959
488 Ga0207671_10056683
489 Ga0207663_10015176
490 Ga0207657_10048952
491 Ga0207657_10184919
492 Ga0207652_10058484
493 Ga0207652_10173956
494 Ga0207652_10257029
495 Ga0207646_10216847
496 Ga0207694_10353141
497 Ga0207650_10006322
498 Ga0207659_10119862
499 Ga0207690_10019006
500 Ga0207706_10015992
501 Ga0207709_10166197
502 Ga0207704_10326283
503 Ga0207665_10403946
504 Ga0207711_10194666
505 Ga0207689_10000231
506 Ga0207689_10004709
507 Ga0207667_10022171
508 Ga0207667_10182754
509 Ga0207640_10024623
510 Ga0207677_10003929
511 Ga0207703_10008748
512 Ga0207703_10216938
513 Ga0207703_10456188
514 Ga0207639_10007791
515 Ga0207702_10013248
516 Ga0207702_10036683
517 Ga0207641_10049908
518 Ga0207641_10108389
519 Ga0207641_10320482
520 Ga0207648_10029977
521 Ga0207648_10037347
522 Ga0207648_10041661
523 Ga0207674_10002748
524 Ga0207674_10371748
525 Ga0207683_10064288
526 Ga0207698_10179539
527 Ga0268266_10212233
528 Ga0268264_10049542
529 Ga0265316_10082471
530 Ga0373923_0055580
531 Ga0373941_0047802
532 Ga0373954_0106699
533 Ga0373954_0175429
534 Ga0373957_0051747
535 Ga0373955_0034143
536 Ga0373935_0031020
537 Ga0373935_0066105
538 Ga0373927_0000517
539 Ga0373937_0014660
540 Ga0373937_0058366
541 Ga0373937_0370218
542 Ga0373925_0484215
543 Ga0395898_0141345
544 Ga0436364_0155861
545 Ga0436364_0213210
546 Ga0436364_0343138
547 Ga0436364_0547608
548 Ga0436364_1103136
549 Ga0436364_1324799
550 Ga0436364_1551406
551 Ga0395901_0215008
552 Ga0436365_0674106
553 Ga0436365_0998534
554 Ga0436365_1171591
555 Ga0436365_1268549
556 Ga0436365_1649392
557 Ga0436365_1913335
558 Ga0436361_1176589
559 Ga0436363_1297548
560 Ga0436362_0356050
561 Ga0436362_0522904
562 Ga0451577_0181277
563 Ga0466957_0002044
564 Ga0466957_0348732
565 Ga0451576_0030746
566 Ga0451576_0108198
567 Ga0495651_0198059
568 Ga0495580_0005960
569 Ga0495580_0011356
570 Ga0495580_0016169
571 Ga0495628_0225783
572 Ga0495645_0010141
573 Ga0495667_0250317
574 Ga0495674_0136712
575 Ga0495602_0396756
576 Ga0496109_0601515
577 Ga0496112_0015973
578 Ga0496112_0041067
579 Ga0496112_0099247
580 Ga0496115_0017584
581 Ga0496115_0182998
582 Ga0501031_0139883
583 Ga0501033_0181185
584 Ga0501034_0005190
585 Ga0501036_0020236
586 Ga0501038_0156260
587 Ga0501040_0001209
588 Ga0501041_0001444
589 Ga0501042_0224968
590 Ga0501043_0107365
591 Ga0501046_0008275
592 Ga0501046_0261043
593 Ga0501047_0014936
594 Ga0501047_0030174
595 Ga0501047_0038962
596 Ga0501047_0072974
597 Ga0501047_0523097
598 Ga0501048_0033448
599 Ga0501070_0047495
600 Ga0501073_0047612
601 Ga0501075_0001128
602 Ga0501076_0004743
603 Ga0501077_0068277
604 Ga0501239_000924
605 Ga0501249_010676
606 Ga0501079_0055969
607 Ga0501080_0057065
608 Ga0501080_0484828
609 Ga0501083_0142341
610 Ga0501268_006003
611 Ga0501035_0032111
612 Ga0501035_0049513
613 Ga0501044_0000829
614 Ga0501044_0003219
615 Ga0501044_0031943
616 Ga0501044_0122668
617 Ga0501045_0009319
618 nmdc:mga05p37_136214_c1
619 nmdc:mga05p37_266906_c1
620 nmdc:mga09592_248752_c1
621 nmdc:mga0qj67_28369_c1
622 nmdc:mga0qj67_51401_c1
623 nmdc:mga06r32_88713_c1
624 nmdc:mga08y16_112265_c1
625 nmdc:mga0n895_39194_c1
626 nmdc:mga0rr50_87725_c1
627 nmdc:mga08x19_24257_c1
628 nmdc:mga0a205_161564_c1
629 Ga0501084_0004067
630 Ga0501082_0000484
631 Ga0501082_0017779
632 Ga0530510_0099285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

78

293

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7313 1 254
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.7307 2 252
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7185 1 254
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7115 1 254
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7083 2 248
ID Description Score Start End Superfamily
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7579 1 249 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7483 2 256 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7417 2 258 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.73 2 256 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7288 2 258 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X9GGP4-F1-model_v4 ABC transporter permease 0.804 2 208 GO:0005886
GO:0055085
AF-A0A2G4E2K8-F1-model_v4 ABC transporter permease 0.7981 2 196 GO:0005886
GO:0055085
AF-A0A359ERU1-F1-model_v4 deleted 0.7971 31 201
AF-A0A4Q2YHH0-F1-model_v4 ABC transporter permease 0.7941 2 201 GO:0005886
GO:0055085
AF-A0A4Q5Y1P2-F1-model_v4 deleted 0.7912 6 198

Map