F403621

General Info

Members Datasets Scaffolds Average Seq Length
316 152 632 183

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100045659|Ga0075434_1000456594
Length 203
Sequence MVFFVRPRVLRGVAVAVLCASEKRARVTSDHDRELLLRVAREAIAAHVGAGAAHVPSDAPVLQQFAGAFVTIHNRGDLRGCIGHIEPTELLAHVIPRCAVAACSTDPRFPPVTASELDDISIEISVLGPLEPIAGPADIEVGRHGLVVEMGWQRGLLLPQVAPEWNWDAETFLAHTCHKAGLPRDAWQRGAKLWRFEAEVFSE

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
108 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.53
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 22.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100045659 3300006871 Bacteria 4346
2 Ga0065707_10129282 3300005295 Archaea 1950
3 Ga0065707_10378909 3300005295 Bacteria 880
4 Ga0070690_100007110 3300005330 Bacteria 6394
5 Ga0070670_100454941 3300005331 Bacteria 1135
6 Ga0068869_100414097 3300005334 Unclassified 1111
7 Ga0070666_10007203 3300005335 Bacteria 6858
8 Ga0070666_10081950 3300005335 Unclassified 2206
9 Ga0070666_10194274 3300005335 Bacteria 1427
10 Ga0068868_100027260 3300005338 Bacteria 4359
11 Ga0068868_100707122 3300005338 Bacteria 902
12 Ga0070689_100786535 3300005340 Bacteria 836
13 Ga0070691_10005466 3300005341 Bacteria 5782
14 Ga0070687_100072813 3300005343 Bacteria 1850
15 Ga0070669_100003902 3300005353 Bacteria 10788
16 Ga0070669_100059386 3300005353 Bacteria 2808
17 Ga0070669_100412524 3300005353 Unclassified 1107
18 Ga0070675_100035361 3300005354 Bacteria 4059
19 Ga0070674_100002747 3300005356 Bacteria 9728
20 Ga0070674_100206583 3300005356 Bacteria 1520
21 Ga0070674_100478973 3300005356 Unclassified 1033
22 Ga0070673_100009257 3300005364 Bacteria 6608
23 Ga0070673_100242027 3300005364 Bacteria 1569
24 Ga0070667_100034944 3300005367 Bacteria 4208
25 Ga0070701_10030559 3300005438 Bacteria 2666
26 Ga0070701_10484285 3300005438 Unclassified 800
27 Ga0070705_100004058 3300005440 Bacteria 7151
28 Ga0070705_100379231 3300005440 Bacteria 1040
29 Ga0070705_100775830 3300005440 Unclassified 760
30 Ga0070700_100002871 3300005441 Bacteria 8850
31 Ga0070700_100781700 3300005441 Unclassified 767
32 Ga0070694_100056688 3300005444 Bacteria 2662
33 Ga0070708_100183522 3300005445 Unclassified 1956
34 Ga0068867_100031902 3300005459 Unclassified 3807
35 Ga0068867_100032309 3300005459 Bacteria 3785
36 Ga0070707_100159193 3300005468 Bacteria 2200
37 Ga0070707_101406573 3300005468 Archaea 664
38 Ga0070698_100040015 3300005471 Bacteria 4820
39 Ga0070698_100490736 3300005471 Bacteria 1166
40 Ga0070699_100002968 3300005518 Bacteria 15082
41 Ga0070699_100743407 3300005518 Bacteria 897
42 Ga0070697_100049694 3300005536 Bacteria 3404
43 Ga0070697_100153119 3300005536 Bacteria 1944
44 Ga0070697_100256956 3300005536 Unclassified 1495
45 Ga0070672_100051287 3300005543 Bacteria 3217
46 Ga0070672_100124940 3300005543 Bacteria 2109
47 Ga0070672_100346450 3300005543 Bacteria 1266
48 Ga0070686_100001050 3300005544 Bacteria 15900
49 Ga0070686_100131375 3300005544 Bacteria 1732
50 Ga0070686_100799155 3300005544 Unclassified 760
51 Ga0070695_100014633 3300005545 Bacteria 4730
52 Ga0070695_100027845 3300005545 Bacteria 3504
53 Ga0070695_100512330 3300005545 Unclassified 929
54 Ga0070695_100664800 3300005545 Bacteria 824
55 Ga0070696_100034174 3300005546 Bacteria 3497
56 Ga0070696_100278520 3300005546 Bacteria 1274
57 Ga0070696_100490000 3300005546 Bacteria 976
58 Ga0070696_100843403 3300005546 Bacteria 757
59 Ga0070665_100107786 3300005548 Bacteria 2788
60 Ga0070704_100103064 3300005549 Bacteria 2155
61 Ga0070704_100146514 3300005549 Bacteria 1851
62 Ga0068855_100221893 3300005563 Bacteria 2119
63 Ga0068857_100994262 3300005577 Unclassified 807
64 Ga0068854_100010917 3300005578 Bacteria 5892
65 Ga0068854_100266617 3300005578 Bacteria 1373
66 Ga0070702_100076648 3300005615 Bacteria 1990
67 Ga0068859_100449265 3300005617 Bacteria 1385
68 Ga0068859_100477468 3300005617 Bacteria 1342
69 Ga0068859_100500621 3300005617 Archaea 1310
70 Ga0068859_100742163 3300005617 Bacteria 1071
71 Ga0068864_100657106 3300005618 Unclassified 1021
72 Ga0068861_100004175 3300005719 Bacteria 9682
73 Ga0068861_100029068 3300005719 Bacteria 4039
74 Ga0068861_100521087 3300005719 Unclassified 1078
75 Ga0068861_100845944 3300005719 Bacteria 862
76 Ga0068863_100019394 3300005841 Bacteria 6505
77 Ga0068863_100170700 3300005841 Bacteria 2086
78 Ga0068863_100662649 3300005841 Bacteria 1036
79 Ga0068858_100033393 3300005842 Bacteria 4776
80 Ga0068858_100109684 3300005842 Bacteria 2577
81 Ga0068860_100146557 3300005843 Bacteria 2272
82 Ga0068860_100197415 3300005843 Unclassified 1949
83 Ga0068860_100375900 3300005843 Unclassified 1402
84 Ga0068860_100694739 3300005843 Bacteria 1027
85 Ga0068860_101783304 3300005843 Unclassified 637
86 Ga0068860_101797206 3300005843 Bacteria 635
87 Ga0068860_101902556 3300005843 Bacteria 617
88 Ga0068862_100053552 3300005844 Bacteria 3455
89 Ga0068862_100109389 3300005844 Bacteria 2424
90 Ga0068862_100476668 3300005844 Bacteria 1181
91 Ga0068862_100510122 3300005844 Unclassified 1143
92 Ga0075432_10076592 3300006058 Bacteria 1208
93 Ga0070716_100060529 3300006173 Bacteria 2187
94 Ga0070716_100141470 3300006173 Bacteria 1535
95 Ga0097621_100176367 3300006237 Unclassified 1845
96 Ga0068871_100108461 3300006358 Bacteria 2333
97 Ga0068871_100260089 3300006358 Bacteria 1514
98 Ga0075428_100027444 3300006844 Bacteria 6299
99 Ga0075433_10017098 3300006852 Bacteria 5998
100 Ga0075433_10108456 3300006852 Bacteria 2463
101 Ga0075434_100000505 3300006871 Bacteria 29553
102 Ga0075434_100061083 3300006871 Bacteria 3748
103 Ga0075434_100117131 3300006871 Bacteria 2677
104 Ga0075434_100165444 3300006871 Bacteria 2232
105 Ga0075434_100537168 3300006871 Bacteria 1189
106 Ga0075429_100596380 3300006880 Bacteria 968
107 Ga0075436_100001003 3300006914 Bacteria 18959
108 Ga0075436_100015009 3300006914 Bacteria 5310
109 Ga0075436_100123478 3300006914 Bacteria 1813
110 Ga0075436_100246653 3300006914 Bacteria 1271
111 Ga0075436_100249889 3300006914 Bacteria 1263
112 Ga0075436_100272880 3300006914 Bacteria 1208
113 Ga0097620_100449310 3300006931 Bacteria 1385
114 Ga0097620_100477455 3300006931 Bacteria 1342
115 Ga0097620_100500633 3300006931 Archaea 1310
116 Ga0097620_100742096 3300006931 Bacteria 1071
117 Ga0075435_100000129 3300007076 Bacteria 43005
118 Ga0075435_100000566 3300007076 Bacteria 22768
119 Ga0075435_100027379 3300007076 Bacteria 4458
120 Ga0075435_100032243 3300007076 Bacteria 4136
121 Ga0075435_100127962 3300007076 Unclassified 2124
122 Ga0075435_100224668 3300007076 Bacteria 1595
123 Ga0075435_100361989 3300007076 Unclassified 1244
124 Ga0105240_10195967 3300009093 Bacteria 2372
125 Ga0111539_10003171 3300009094 Bacteria 21764
126 Ga0111539_10057320 3300009094 Bacteria 4627
127 Ga0111539_10866208 3300009094 Unclassified 1051
128 Ga0105245_10015807 3300009098 Bacteria 6578
129 Ga0114129_10003029 3300009147 Bacteria 23559
130 Ga0114129_10016552 3300009147 Bacteria 10500
131 Ga0114129_10018443 3300009147 Bacteria 9939
132 Ga0114129_10027029 3300009147 Bacteria 8125
133 Ga0114129_10101698 3300009147 Unclassified 3976
134 Ga0114129_10205119 3300009147 Bacteria 2668
135 Ga0114129_10511258 3300009147 Unclassified 1567
136 Ga0114129_10589042 3300009147 Unclassified 1442
137 Ga0114129_11097789 3300009147 Unclassified 996
138 Ga0105243_10098774 3300009148 Bacteria 2419
139 Ga0105243_11293442 3300009148 Bacteria 746
140 Ga0105242_10013301 3300009176 Bacteria 6355
141 Ga0105242_10399859 3300009176 Bacteria 1282
142 Ga0105248_10017587 3300009177 Bacteria 7885
143 Ga0105248_10133609 3300009177 Bacteria 2799
144 Ga0105248_10286881 3300009177 Bacteria 1853
145 Ga0105248_10324950 3300009177 Unclassified 1733
146 Ga0105249_10219033 3300009553 Bacteria 1872
147 Ga0157374_10019334 3300013296 Bacteria 6028
148 Ga0157374_10643058 3300013296 Unclassified 1072
149 Ga0157378_10499425 3300013297 Bacteria 1215
150 Ga0157378_10877705 3300013297 Bacteria 927
151 Ga0157378_11957601 3300013297 Unclassified 636
152 Ga0163162_10156549 3300013306 Bacteria 2398
153 Ga0157375_10325692 3300013308 Unclassified 1701
154 Ga0157375_10436576 3300013308 Unclassified 1475
155 Ga0157375_10469120 3300013308 Bacteria 1424
156 Ga0157375_10752080 3300013308 Bacteria 1126
157 Ga0157380_10514872 3300014326 Bacteria 1165
158 Ga0157377_10155448 3300014745 Bacteria 1418
159 Ga0157379_10009861 3300014968 Bacteria 8321
160 Ga0157379_10018670 3300014968 Bacteria 6113
161 Ga0157379_10040096 3300014968 Bacteria 4179
162 Ga0163161_10157806 3300017792 Bacteria 1728
163 Ga0163161_10543003 3300017792 Unclassified 952
164 Ga0207680_10019156 3300025903 Unclassified 3656
165 Ga0207680_10140958 3300025903 Bacteria 1598
166 Ga0207680_10302397 3300025903 Bacteria 1115
167 Ga0207645_10003237 3300025907 Bacteria 12441
168 Ga0207645_10188473 3300025907 Bacteria 1355
169 Ga0207645_10683850 3300025907 Unclassified 697
170 Ga0207684_10347520 3300025910 Bacteria 1277
171 Ga0207684_10418989 3300025910 Unclassified 1151
172 Ga0207684_10444226 3300025910 Bacteria 1114
173 Ga0207662_10013380 3300025918 Bacteria 4588
174 Ga0207646_10049213 3300025922 Bacteria 3775
175 Ga0207681_10003393 3300025923 Bacteria 9959
176 Ga0207681_10274245 3300025923 Bacteria 1325
177 Ga0207681_10293830 3300025923 Bacteria 1283
178 Ga0207681_10989291 3300025923 Bacteria 705
179 Ga0207650_10562340 3300025925 Bacteria 957
180 Ga0207650_10579406 3300025925 Archaea 942
181 Ga0207659_10276486 3300025926 Bacteria 1371
182 Ga0207687_10318963 3300025927 Bacteria 1257
183 Ga0207644_10002532 3300025931 Bacteria 11754
184 Ga0207644_10676676 3300025931 Bacteria 860
185 Ga0207706_10120370 3300025933 Bacteria 2308
186 Ga0207686_10428250 3300025934 Bacteria 1013
187 Ga0207709_10415818 3300025935 Unclassified 1032
188 Ga0207670_10509166 3300025936 Bacteria 979
189 Ga0207669_10264913 3300025937 Unclassified 1287
190 Ga0207704_10209050 3300025938 Bacteria 1435
191 Ga0207691_10061359 3300025940 Bacteria 3415
192 Ga0207691_10570197 3300025940 Bacteria 959
193 Ga0207711_10167720 3300025941 Bacteria 1991
194 Ga0207711_10241103 3300025941 Unclassified 1657
195 Ga0207711_10358154 3300025941 Bacteria 1351
196 Ga0207689_10170546 3300025942 Unclassified 1793
197 Ga0207689_11086930 3300025942 Bacteria 674
198 Ga0207667_10382164 3300025949 Bacteria 1435
199 Ga0207651_10073513 3300025960 Bacteria 2431
200 Ga0207651_10168158 3300025960 Unclassified 1726
201 Ga0207651_10274057 3300025960 Bacteria 1391
202 Ga0207712_10366521 3300025961 Unclassified 1202
203 Ga0207668_10048763 3300025972 Bacteria 2908
204 Ga0207640_10038610 3300025981 Bacteria 3015
205 Ga0207640_10115182 3300025981 Bacteria 1914
206 Ga0207658_10038424 3300025986 Bacteria 3448
207 Ga0207677_10129477 3300026023 Unclassified 1913
208 Ga0207677_10295044 3300026023 Bacteria 1337
209 Ga0207677_10607464 3300026023 Bacteria 960
210 Ga0207703_10006395 3300026035 Bacteria 9419
211 Ga0207703_10038885 3300026035 Bacteria 3799
212 Ga0207703_10059702 3300026035 Bacteria 3116
213 Ga0207703_10097636 3300026035 Bacteria 2483
214 Ga0207703_10314703 3300026035 Bacteria 1432
215 Ga0207708_10002255 3300026075 Bacteria 14198
216 Ga0207708_10075272 3300026075 Bacteria 2588
217 Ga0207708_10131599 3300026075 Bacteria 1956
218 Ga0207708_10782723 3300026075 Unclassified 820
219 Ga0207641_10002052 3300026088 Bacteria 19139
220 Ga0207641_10340616 3300026088 Bacteria 1427
221 Ga0207648_10010838 3300026089 Bacteria 8615
222 Ga0207676_10598948 3300026095 Unclassified 1058
223 Ga0207675_100001401 3300026118 Bacteria 24104
224 Ga0207675_100047829 3300026118 Bacteria 3993
225 Ga0207675_100218745 3300026118 Bacteria 1835
226 Ga0207675_100715592 3300026118 Bacteria 1011
227 Ga0207428_10085790 3300027907 Bacteria 2451
228 Ga0207428_10500042 3300027907 Unclassified 883
229 Ga0268266_10092503 3300028379 Bacteria 2653
230 Ga0268265_10004373 3300028380 Bacteria 9821
231 Ga0268265_10601953 3300028380 Bacteria 1050
232 Ga0268264_10034126 3300028381 Bacteria 4184
233 Ga0268264_10295873 3300028381 Unclassified 1522
234 Ga0268264_10351111 3300028381 Bacteria 1404
235 Ga0268264_11093117 3300028381 Unclassified 806
236 Ga0268264_11460655 3300028381 Bacteria 694
237 Ga0307513_10510175 3300031456 Unclassified 919
238 Ga0373930_0015817 3300034816 Unclassified 1420
239 Ga0373958_0001213 3300034819 Bacteria 3439
240 Ga0373959_0043199 3300034820 Unclassified 952
241 Ga0373959_0078862 3300034820 Bacteria 756
242 Ga0373928_0011249 3300035084 Unclassified 1769
243 Ga0373929_0000376 3300035085 Bacteria 8379
244 Ga0373940_0028600 3300035088 Unclassified 1472
245 Ga0373949_0180144 3300035090 Bacteria 625
246 Ga0373951_0000499 3300035091 Bacteria 11154
247 Ga0373952_0000831 3300035092 Bacteria 5586
248 Ga0373932_0067627 3300035112 Bacteria 1100
249 Ga0373939_0060578 3300035114 Bacteria 1203
250 Ga0373941_0000172 3300035115 Bacteria 11961
251 Ga0373941_0024612 3300035115 Bacteria 1731
252 Ga0373960_0000080 3300035121 Bacteria 14103
253 Ga0373942_0001155 3300035207 Bacteria 7000
254 Ga0373961_0116600 3300035241 Unclassified 880
255 Ga0373962_0054976 3300035242 Unclassified 1155
256 Ga0373931_0028205 3300035691 Bacteria 2871
257 Ga0395905_1254070 3300037471 Bacteria 645
258 Ga0439464_0013682 3300042439 Unclassified 2176
259 Ga0439460_0088126 3300042461 Bacteria 983
260 Ga0451576_0023721 3300045051 Bacteria 6637
261 Ga0451576_0382690 3300045051 Unclassified 1475
262 Ga0451576_0420093 3300045051 Unclassified 1403
263 Ga0495618_0590212 3300046514 Unclassified 662
264 Ga0495640_0275208 3300046533 Bacteria 1049
265 Ga0495586_0077940 3300046535 Unclassified 1818
266 Ga0495656_0061179 3300046615 Bacteria 1644
267 Ga0495669_0109328 3300046684 Bacteria 1290
268 Ga0496102_0373525 3300048905 Bacteria 1342
269 Ga0496107_0769283 3300048910 Bacteria 706
270 Ga0496108_0370754 3300048911 Unclassified 1250
271 Ga0496109_0115814 3300048912 Bacteria 2494
272 Ga0496110_0125694 3300048913 Bacteria 2314
273 Ga0496112_0980379 3300048915 Bacteria 765
274 Ga0496113_1068054 3300048916 Bacteria 634
275 Ga0496114_0013207 3300048917 Bacteria 6620
276 Ga0501046_0321787 3300049580 Unclassified 1127
277 Ga0501083_0326764 3300049744 Unclassified 997
278 nmdc:mga05p37_1478_c1 3300050507 Bacteria 27321
279 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
280 nmdc:mga05p37_2204_c1 3300050507 Bacteria 22685
281 nmdc:mga05p37_48400_c1 3300050507 Bacteria 5229
282 nmdc:mga05p37_651018_c1 3300050507 Bacteria 1180
283 nmdc:mga09592_544174_c1 3300050508 Bacteria 997
284 nmdc:mga06r32_461552_c1 3300050510 Unclassified 1249
285 nmdc:mga08y16_1959_c1 3300050511 Bacteria 20984
286 nmdc:mga08y16_672650_c1 3300050511 Unclassified 1037
287 nmdc:mga08y16_9897_c1 3300050511 Bacteria 10008
288 nmdc:mga0n895_109_c1 3300050512 Bacteria 48376
289 nmdc:mga0n895_522210_c1 3300050512 Bacteria 1195
290 nmdc:mga0n895_668480_c1 3300050512 Bacteria 1036
291 nmdc:mga0n895_81117_c1 3300050512 Bacteria 3233
292 nmdc:mga0n895_84422_c1 3300050512 Unclassified 3169
293 nmdc:mga0n895_96144_c1 3300050512 Bacteria 2967
294 nmdc:mga0n895_99929_c1 3300050512 Bacteria 2910
295 nmdc:mga0rr50_152667_c1 3300050513 Bacteria 1868
296 nmdc:mga0rr50_187638_c1 3300050513 Bacteria 1693
297 nmdc:mga0rr50_36185_c1 3300050513 Bacteria 3553
298 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
299 nmdc:mga0rr50_399549_c1 3300050513 Bacteria 1161
300 nmdc:mga0rr50_83956_c1 3300050513 Bacteria 2464
301 nmdc:mga08x19_145329_c1 3300050514 Unclassified 1604
302 nmdc:mga08x19_183530_c1 3300050514 Bacteria 1429
303 nmdc:mga08x19_223_c1 3300050514 Bacteria 43405
304 nmdc:mga08x19_304028_c1 3300050514 Bacteria 1108
305 nmdc:mga08x19_437215_c1 3300050514 Bacteria 920
306 nmdc:mga08x19_611286_c1 3300050514 Unclassified 773
307 nmdc:mga0a205_1240696_c1 3300050515 Bacteria 593
308 nmdc:mga0a205_216809_c1 3300050515 Bacteria 1801
309 nmdc:mga0a205_27412_c1 3300050515 Bacteria 5441
310 nmdc:mga0a205_340061_c1 3300050515 Unclassified 1369
311 nmdc:mga0a205_366711_c1 3300050515 Unclassified 1306
312 nmdc:mga0a205_8291_c1 3300050515 Bacteria 7789
313 nmdc:mga0a205_829400_c1 3300050515 Bacteria 772
314 Ga0495601_0389257 3300053077 Unclassified 904
315 Ga0495619_0097818 3300053085 Bacteria 1995
316 Ga0501082_0626013 3300060353 Unclassified 942
317 Ga0075434_100045659
318 Ga0065707_10129282
319 Ga0065707_10378909
320 Ga0070690_100007110
321 Ga0070670_100454941
322 Ga0068869_100414097
323 Ga0070666_10007203
324 Ga0070666_10081950
325 Ga0070666_10194274
326 Ga0068868_100027260
327 Ga0068868_100707122
328 Ga0070689_100786535
329 Ga0070691_10005466
330 Ga0070687_100072813
331 Ga0070669_100003902
332 Ga0070669_100059386
333 Ga0070669_100412524
334 Ga0070675_100035361
335 Ga0070674_100002747
336 Ga0070674_100206583
337 Ga0070674_100478973
338 Ga0070673_100009257
339 Ga0070673_100242027
340 Ga0070667_100034944
341 Ga0070701_10030559
342 Ga0070701_10484285
343 Ga0070705_100004058
344 Ga0070705_100379231
345 Ga0070705_100775830
346 Ga0070700_100002871
347 Ga0070700_100781700
348 Ga0070694_100056688
349 Ga0070708_100183522
350 Ga0068867_100031902
351 Ga0068867_100032309
352 Ga0070707_100159193
353 Ga0070707_101406573
354 Ga0070698_100040015
355 Ga0070698_100490736
356 Ga0070699_100002968
357 Ga0070699_100743407
358 Ga0070697_100049694
359 Ga0070697_100153119
360 Ga0070697_100256956
361 Ga0070672_100051287
362 Ga0070672_100124940
363 Ga0070672_100346450
364 Ga0070686_100001050
365 Ga0070686_100131375
366 Ga0070686_100799155
367 Ga0070695_100014633
368 Ga0070695_100027845
369 Ga0070695_100512330
370 Ga0070695_100664800
371 Ga0070696_100034174
372 Ga0070696_100278520
373 Ga0070696_100490000
374 Ga0070696_100843403
375 Ga0070665_100107786
376 Ga0070704_100103064
377 Ga0070704_100146514
378 Ga0068855_100221893
379 Ga0068857_100994262
380 Ga0068854_100010917
381 Ga0068854_100266617
382 Ga0070702_100076648
383 Ga0068859_100449265
384 Ga0068859_100477468
385 Ga0068859_100500621
386 Ga0068859_100742163
387 Ga0068864_100657106
388 Ga0068861_100004175
389 Ga0068861_100029068
390 Ga0068861_100521087
391 Ga0068861_100845944
392 Ga0068863_100019394
393 Ga0068863_100170700
394 Ga0068863_100662649
395 Ga0068858_100033393
396 Ga0068858_100109684
397 Ga0068860_100146557
398 Ga0068860_100197415
399 Ga0068860_100375900
400 Ga0068860_100694739
401 Ga0068860_101783304
402 Ga0068860_101797206
403 Ga0068860_101902556
404 Ga0068862_100053552
405 Ga0068862_100109389
406 Ga0068862_100476668
407 Ga0068862_100510122
408 Ga0075432_10076592
409 Ga0070716_100060529
410 Ga0070716_100141470
411 Ga0097621_100176367
412 Ga0068871_100108461
413 Ga0068871_100260089
414 Ga0075428_100027444
415 Ga0075433_10017098
416 Ga0075433_10108456
417 Ga0075434_100000505
418 Ga0075434_100061083
419 Ga0075434_100117131
420 Ga0075434_100165444
421 Ga0075434_100537168
422 Ga0075429_100596380
423 Ga0075436_100001003
424 Ga0075436_100015009
425 Ga0075436_100123478
426 Ga0075436_100246653
427 Ga0075436_100249889
428 Ga0075436_100272880
429 Ga0097620_100449310
430 Ga0097620_100477455
431 Ga0097620_100500633
432 Ga0097620_100742096
433 Ga0075435_100000129
434 Ga0075435_100000566
435 Ga0075435_100027379
436 Ga0075435_100032243
437 Ga0075435_100127962
438 Ga0075435_100224668
439 Ga0075435_100361989
440 Ga0105240_10195967
441 Ga0111539_10003171
442 Ga0111539_10057320
443 Ga0111539_10866208
444 Ga0105245_10015807
445 Ga0114129_10003029
446 Ga0114129_10016552
447 Ga0114129_10018443
448 Ga0114129_10027029
449 Ga0114129_10101698
450 Ga0114129_10205119
451 Ga0114129_10511258
452 Ga0114129_10589042
453 Ga0114129_11097789
454 Ga0105243_10098774
455 Ga0105243_11293442
456 Ga0105242_10013301
457 Ga0105242_10399859
458 Ga0105248_10017587
459 Ga0105248_10133609
460 Ga0105248_10286881
461 Ga0105248_10324950
462 Ga0105249_10219033
463 Ga0157374_10019334
464 Ga0157374_10643058
465 Ga0157378_10499425
466 Ga0157378_10877705
467 Ga0157378_11957601
468 Ga0163162_10156549
469 Ga0157375_10325692
470 Ga0157375_10436576
471 Ga0157375_10469120
472 Ga0157375_10752080
473 Ga0157380_10514872
474 Ga0157377_10155448
475 Ga0157379_10009861
476 Ga0157379_10018670
477 Ga0157379_10040096
478 Ga0163161_10157806
479 Ga0163161_10543003
480 Ga0207680_10019156
481 Ga0207680_10140958
482 Ga0207680_10302397
483 Ga0207645_10003237
484 Ga0207645_10188473
485 Ga0207645_10683850
486 Ga0207684_10347520
487 Ga0207684_10418989
488 Ga0207684_10444226
489 Ga0207662_10013380
490 Ga0207646_10049213
491 Ga0207681_10003393
492 Ga0207681_10274245
493 Ga0207681_10293830
494 Ga0207681_10989291
495 Ga0207650_10562340
496 Ga0207650_10579406
497 Ga0207659_10276486
498 Ga0207687_10318963
499 Ga0207644_10002532
500 Ga0207644_10676676
501 Ga0207706_10120370
502 Ga0207686_10428250
503 Ga0207709_10415818
504 Ga0207670_10509166
505 Ga0207669_10264913
506 Ga0207704_10209050
507 Ga0207691_10061359
508 Ga0207691_10570197
509 Ga0207711_10167720
510 Ga0207711_10241103
511 Ga0207711_10358154
512 Ga0207689_10170546
513 Ga0207689_11086930
514 Ga0207667_10382164
515 Ga0207651_10073513
516 Ga0207651_10168158
517 Ga0207651_10274057
518 Ga0207712_10366521
519 Ga0207668_10048763
520 Ga0207640_10038610
521 Ga0207640_10115182
522 Ga0207658_10038424
523 Ga0207677_10129477
524 Ga0207677_10295044
525 Ga0207677_10607464
526 Ga0207703_10006395
527 Ga0207703_10038885
528 Ga0207703_10059702
529 Ga0207703_10097636
530 Ga0207703_10314703
531 Ga0207708_10002255
532 Ga0207708_10075272
533 Ga0207708_10131599
534 Ga0207708_10782723
535 Ga0207641_10002052
536 Ga0207641_10340616
537 Ga0207648_10010838
538 Ga0207676_10598948
539 Ga0207675_100001401
540 Ga0207675_100047829
541 Ga0207675_100218745
542 Ga0207675_100715592
543 Ga0207428_10085790
544 Ga0207428_10500042
545 Ga0268266_10092503
546 Ga0268265_10004373
547 Ga0268265_10601953
548 Ga0268264_10034126
549 Ga0268264_10295873
550 Ga0268264_10351111
551 Ga0268264_11093117
552 Ga0268264_11460655
553 Ga0307513_10510175
554 Ga0373930_0015817
555 Ga0373958_0001213
556 Ga0373959_0043199
557 Ga0373959_0078862
558 Ga0373928_0011249
559 Ga0373929_0000376
560 Ga0373940_0028600
561 Ga0373949_0180144
562 Ga0373951_0000499
563 Ga0373952_0000831
564 Ga0373932_0067627
565 Ga0373939_0060578
566 Ga0373941_0000172
567 Ga0373941_0024612
568 Ga0373960_0000080
569 Ga0373942_0001155
570 Ga0373961_0116600
571 Ga0373962_0054976
572 Ga0373931_0028205
573 Ga0395905_1254070
574 Ga0439464_0013682
575 Ga0439460_0088126
576 Ga0451576_0023721
577 Ga0451576_0382690
578 Ga0451576_0420093
579 Ga0495618_0590212
580 Ga0495640_0275208
581 Ga0495586_0077940
582 Ga0495656_0061179
583 Ga0495669_0109328
584 Ga0496102_0373525
585 Ga0496107_0769283
586 Ga0496108_0370754
587 Ga0496109_0115814
588 Ga0496110_0125694
589 Ga0496112_0980379
590 Ga0496113_1068054
591 Ga0496114_0013207
592 Ga0501046_0321787
593 Ga0501083_0326764
594 nmdc:mga05p37_1478_c1
595 nmdc:mga05p37_1909_c1
596 nmdc:mga05p37_2204_c1
597 nmdc:mga05p37_48400_c1
598 nmdc:mga05p37_651018_c1
599 nmdc:mga09592_544174_c1
600 nmdc:mga06r32_461552_c1
601 nmdc:mga08y16_1959_c1
602 nmdc:mga08y16_672650_c1
603 nmdc:mga08y16_9897_c1
604 nmdc:mga0n895_109_c1
605 nmdc:mga0n895_522210_c1
606 nmdc:mga0n895_668480_c1
607 nmdc:mga0n895_81117_c1
608 nmdc:mga0n895_84422_c1
609 nmdc:mga0n895_96144_c1
610 nmdc:mga0n895_99929_c1
611 nmdc:mga0rr50_152667_c1
612 nmdc:mga0rr50_187638_c1
613 nmdc:mga0rr50_36185_c1
614 nmdc:mga0rr50_36_c1
615 nmdc:mga0rr50_399549_c1
616 nmdc:mga0rr50_83956_c1
617 nmdc:mga08x19_145329_c1
618 nmdc:mga08x19_183530_c1
619 nmdc:mga08x19_223_c1
620 nmdc:mga08x19_304028_c1
621 nmdc:mga08x19_437215_c1
622 nmdc:mga08x19_611286_c1
623 nmdc:mga0a205_1240696_c1
624 nmdc:mga0a205_216809_c1
625 nmdc:mga0a205_27412_c1
626 nmdc:mga0a205_340061_c1
627 nmdc:mga0a205_366711_c1
628 nmdc:mga0a205_8291_c1
629 nmdc:mga0a205_829400_c1
630 Ga0495601_0389257
631 Ga0495619_0097818
632 Ga0501082_0626013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01871

AMMECR1

AMMECR1

37

201

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vaj-assembly1.cif.gz_A crystal structure of uncharacterized protein ph0010 from pyrococcus horikoshii 0.9176 10 178
1vaj-assembly1.cif.gz_A crystal structure of uncharacterized protein ph0010 from pyrococcus horikoshii 0.8604 10 178
1zq7-assembly1.cif.gz_A x-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9. 0.8227 1 179
1zq7-assembly1.cif.gz_D x-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9. 0.8221 1 179
1zq7-assembly1.cif.gz_A x-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9. 0.8148 1 179
ID Description Score Start End Superfamily
1wscA02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Hypothetical protein ph0010; domain 2 0.9422 105 171 3.30.1490.150
af_Q58220_8_105_3.30.700.20 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Hypothetical protein ph0010; domain 1 0.9402 8 100 3.30.700.20
1zq7D02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Hypothetical protein ph0010; domain 2 0.925 105 171 3.30.1490.150
af_Q58220_12_136_3.30.700.20 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Hypothetical protein ph0010; domain 1 0.9237 11 125 3.30.700.20
af_Q4DBB6_69_156_3.30.700.20 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Hypothetical protein ph0010; domain 1 0.9123 11 96 3.30.700.20
ID Description Score Start End GO Terms
AF-A0A7X7VF38-F1-model_v4 MEMO1 family protein GX465_12275 0.9834 2 177
AF-A0A831PQF5-F1-model_v4 AmmeMemoRadiSam system protein B 0.983 1 177
AF-A0A523ZKA2-F1-model_v4 AmmeMemoRadiSam system protein B 0.9754 1 174
AF-A0A7C3MGJ7-F1-model_v4 MEMO1 family protein ENW40_10620 0.9737 1 179
AF-A0A1F2S7E2-F1-model_v4 AMMECR1 domain-containing protein 0.9727 1 177

Map