F403564

General Info

Members Datasets Scaffolds Average Seq Length
316 216 632 274

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10008514|Ga0070681_100085144
Length 309
Sequence MEDGARSANVTTLMRAVQHSEPPTDGVVPFVRGIMADSLRSYGVREQESADSDLAAHAERVRLAGFTVLLNAFSDAETAEFGTRLDEVLRRQAGEFGTDRLEQIGDGFTARCPLAHDDAFLKLPTYPPLLALVRQLLGDYVVLMQQNGVINPPQEGHTQRAYHRDLPYQHFVSSRPLAVGALFCIDPFRSETGATLVIPGSHHLERFPSPEVAASLEVPVTAEPGSFVVFDAMLFHRAGDNRSGRVRRAVNNVFSLPIIAQQISLPLALNGRHSDDPALARLLGYDSAPSGSVVEWRTRRLRRSRKPNE

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
70 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
193 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
194 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
197 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
198 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
199 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
200 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
204 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
205 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
206 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
207 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
208 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
209 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
210 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
211 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
212 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
213 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
214 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
215 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
216 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 6.01
Rhizoplane 1.58
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 17.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10008514 3300005458 Bacteria 10043
2 JGI24746J21847_1001082 3300001977 Unclassified 4275
3 Ga0065712_10077138 3300005290 Unclassified 3543
4 Ga0065712_10143249 3300005290 Bacteria 1431
5 Ga0065715_10098177 3300005293 Unclassified 3585
6 Ga0065715_10101929 3300005293 Bacteria 3137
7 Ga0065715_10162320 3300005293 Bacteria 1618
8 Ga0065707_10088013 3300005295 Unclassified 4812
9 Ga0065707_10102142 3300005295 Unclassified 2823
10 Ga0070658_10237241 3300005327 Unclassified 1545
11 Ga0070690_100146048 3300005330 Bacteria 1609
12 Ga0070677_10001624 3300005333 Bacteria 7111
13 Ga0070677_10048535 3300005333 Bacteria 1706
14 Ga0070666_10105560 3300005335 Bacteria 1946
15 Ga0068868_100008843 3300005338 Bacteria 7215
16 Ga0070689_100124644 3300005340 Unclassified 2060
17 Ga0070687_100018359 3300005343 Bacteria 3234
18 Ga0070661_100002912 3300005344 Bacteria 11789
19 Ga0070661_100079988 3300005344 Unclassified 2412
20 Ga0070668_100401504 3300005347 Bacteria 1170
21 Ga0070669_100004639 3300005353 Bacteria 9916
22 Ga0070669_100080173 3300005353 Bacteria 2429
23 Ga0070669_100090476 3300005353 Bacteria 2294
24 Ga0070669_100164612 3300005353 Unclassified 1726
25 Ga0070675_100000798 3300005354 Bacteria 22119
26 Ga0070675_100007129 3300005354 Bacteria 8610
27 Ga0070675_100060878 3300005354 Unclassified 3116
28 Ga0070675_100454309 3300005354 Unclassified 1149
29 Ga0070675_100700049 3300005354 Bacteria 923
30 Ga0070671_100014967 3300005355 Bacteria 6265
31 Ga0070673_100020704 3300005364 Unclassified 4748
32 Ga0070673_100160283 3300005364 Bacteria 1913
33 Ga0070673_100302000 3300005364 Bacteria 1409
34 Ga0070667_100194512 3300005367 Bacteria 1798
35 Ga0070714_100015578 3300005435 Bacteria 6116
36 Ga0070700_100088951 3300005441 Bacteria 2011
37 Ga0070700_100106045 3300005441 Bacteria 1859
38 Ga0070708_100115013 3300005445 Unclassified 2476
39 Ga0070663_100197223 3300005455 Bacteria 1569
40 Ga0068867_100020306 3300005459 Bacteria 4733
41 Ga0070685_10000976 3300005466 Bacteria 15407
42 Ga0070685_10357657 3300005466 Bacteria 1000
43 Ga0070706_100267777 3300005467 Unclassified 1594
44 Ga0070698_100306428 3300005471 Unclassified 1519
45 Ga0070699_100133605 3300005518 Bacteria 2188
46 Ga0070679_100038475 3300005530 Unclassified 4755
47 Ga0070679_100082905 3300005530 Bacteria 3196
48 Ga0070679_100140259 3300005530 Bacteria 2397
49 Ga0070684_100191190 3300005535 Bacteria 1863
50 Ga0070684_100192955 3300005535 Bacteria 1854
51 Ga0070697_100093469 3300005536 Unclassified 2490
52 Ga0070672_100099973 3300005543 Bacteria 2352
53 Ga0070672_100103745 3300005543 Bacteria 2310
54 Ga0070672_100183910 3300005543 Bacteria 1742
55 Ga0070686_100107414 3300005544 Bacteria 1895
56 Ga0070665_100159780 3300005548 Bacteria 2255
57 Ga0070704_100270312 3300005549 Bacteria 1404
58 Ga0068855_100020221 3300005563 Bacteria 7993
59 Ga0068855_100150242 3300005563 Bacteria 2649
60 Ga0070664_100036012 3300005564 Bacteria 4156
61 Ga0070664_100060573 3300005564 Unclassified 3223
62 Ga0070664_100325893 3300005564 Bacteria 1393
63 Ga0068857_100169709 3300005577 Bacteria 1983
64 Ga0068856_100191330 3300005614 Bacteria 2060
65 Ga0070702_100029021 3300005615 Bacteria 3004
66 Ga0068852_100134743 3300005616 Unclassified 2280
67 Ga0068852_100302263 3300005616 Unclassified 1549
68 Ga0068852_100350478 3300005616 Bacteria 1441
69 Ga0068852_100507860 3300005616 Bacteria 1201
70 Ga0068859_100208175 3300005617 Unclassified 2042
71 Ga0068859_100467643 3300005617 Bacteria 1357
72 Ga0068864_100157273 3300005618 Unclassified 2064
73 Ga0068864_100446980 3300005618 Bacteria 1236
74 Ga0068861_100101316 3300005719 Bacteria 2290
75 Ga0068870_10084347 3300005840 Bacteria 1763
76 Ga0068863_100007751 3300005841 Bacteria 10498
77 Ga0068858_100005995 3300005842 Bacteria 11867
78 Ga0068858_100016170 3300005842 Bacteria 7009
79 Ga0068860_100009379 3300005843 Bacteria 9728
80 Ga0068860_100012100 3300005843 Bacteria 8498
81 Ga0068862_100542628 3300005844 Bacteria 1109
82 Ga0075366_10025454 3300006195 Bacteria 3456
83 Ga0097621_100015021 3300006237 Bacteria 5814
84 Ga0075370_10184284 3300006353 Bacteria 1229
85 Ga0075428_100027325 3300006844 Bacteria 6315
86 Ga0075428_100427965 3300006844 Unclassified 1418
87 Ga0075430_100015947 3300006846 Bacteria 6399
88 Ga0075430_100025591 3300006846 Bacteria 5023
89 Ga0075431_100000286 3300006847 Bacteria 39644
90 Ga0075433_10001301 3300006852 Bacteria 18258
91 Ga0075433_10006189 3300006852 Bacteria 9440
92 Ga0075433_10022541 3300006852 Bacteria 5286
93 Ga0075433_10068952 3300006852 Bacteria 3105
94 Ga0075433_10169785 3300006852 Bacteria 1941
95 Ga0075434_100000533 3300006871 Bacteria 29056
96 Ga0075434_100027550 3300006871 Bacteria 5581
97 Ga0075434_100134793 3300006871 Bacteria 2489
98 Ga0075434_100741494 3300006871 Unclassified 999
99 Ga0075429_100004174 3300006880 Bacteria 12370
100 Ga0075429_100009869 3300006880 Bacteria 8276
101 Ga0068865_100034572 3300006881 Bacteria 3392
102 Ga0068865_100317608 3300006881 Bacteria 1252
103 Ga0097620_100208162 3300006931 Unclassified 2042
104 Ga0097620_100467641 3300006931 Bacteria 1357
105 Ga0099822_1010543 3300006943 Bacteria 11446
106 Ga0099826_10001485 3300006948 Bacteria 14139
107 Ga0075435_100007887 3300007076 Bacteria 7620
108 Ga0075435_100013416 3300007076 Bacteria 6096
109 Ga0111539_10005211 3300009094 Bacteria 16834
110 Ga0111539_10028004 3300009094 Bacteria 6882
111 Ga0111539_10202887 3300009094 Bacteria 2312
112 Ga0105245_10690020 3300009098 Bacteria 1054
113 Ga0114129_10020415 3300009147 Bacteria 9423
114 Ga0114129_10036488 3300009147 Bacteria 6940
115 Ga0114129_10039416 3300009147 Bacteria 6660
116 Ga0114129_10042824 3300009147 Bacteria 6371
117 Ga0114129_10072880 3300009147 Bacteria 4786
118 Ga0114129_10074238 3300009147 Bacteria 4737
119 Ga0105248_10042050 3300009177 Bacteria 5125
120 Ga0105248_10121709 3300009177 Bacteria 2944
121 Ga0105249_10001188 3300009553 Bacteria 22995
122 Ga0123340_1058224 3300009763 Bacteria 1184
123 Ga0123341_1049326 3300009765 Bacteria 2425
124 Ga0105246_10018208 3300011119 Bacteria 4475
125 Ga0157373_10000368 3300013100 Bacteria 36141
126 Ga0157378_10177791 3300013297 Bacteria 2000
127 Ga0157372_10691804 3300013307 Unclassified 1187
128 Ga0157375_10057314 3300013308 Bacteria 3850
129 Ga0157375_10334453 3300013308 Bacteria 1680
130 Ga0163163_10127009 3300014325 Bacteria 2588
131 Ga0157380_10017337 3300014326 Bacteria 5329
132 Ga0157380_10177695 3300014326 Bacteria 1867
133 Ga0157377_10001992 3300014745 Bacteria 8945
134 Ga0157377_10144712 3300014745 Bacteria 1464
135 Ga0157379_10024659 3300014968 Bacteria 5338
136 Ga0157376_10069708 3300014969 Bacteria 2982
137 Ga0213875_10000447 3300021388 Bacteria 35914
138 Ga0209148_1001324 3300025254 Bacteria 13158
139 Ga0209455_1000616 3300025272 Bacteria 22469
140 Ga0207697_10000434 3300025315 Bacteria 23564
141 Ga0207682_10006537 3300025893 Bacteria 4690
142 Ga0207682_10105109 3300025893 Bacteria 1238
143 Ga0207688_10000794 3300025901 Bacteria 15758
144 Ga0207645_10001297 3300025907 Bacteria 20562
145 Ga0207643_10004020 3300025908 Bacteria 7914
146 Ga0207643_10074548 3300025908 Unclassified 1957
147 Ga0207643_10098658 3300025908 Bacteria 1711
148 Ga0207705_10237420 3300025909 Unclassified 1388
149 Ga0207684_10115041 3300025910 Unclassified 2304
150 Ga0207662_10069005 3300025918 Bacteria 2136
151 Ga0207662_10078382 3300025918 Unclassified 2011
152 Ga0207649_10010735 3300025920 Bacteria 5036
153 Ga0207652_10027229 3300025921 Unclassified 4763
154 Ga0207646_10058007 3300025922 Bacteria 3459
155 Ga0207681_10014746 3300025923 Bacteria 4865
156 Ga0207681_10047097 3300025923 Bacteria 2903
157 Ga0207659_10008533 3300025926 Bacteria 6368
158 Ga0207659_10014171 3300025926 Bacteria 5133
159 Ga0207659_10148251 3300025926 Unclassified 1829
160 Ga0207659_10187133 3300025926 Bacteria 1645
161 Ga0207659_10377951 3300025926 Bacteria 1181
162 Ga0207659_10389228 3300025926 Unclassified 1164
163 Ga0207687_10519963 3300025927 Unclassified 995
164 Ga0207644_10088839 3300025931 Bacteria 2299
165 Ga0207706_10003175 3300025933 Bacteria 15790
166 Ga0207706_10185921 3300025933 Bacteria 1824
167 Ga0207670_10066095 3300025936 Unclassified 2483
168 Ga0207691_10003720 3300025940 Bacteria 14797
169 Ga0207691_10050539 3300025940 Bacteria 3805
170 Ga0207691_10065355 3300025940 Bacteria 3293
171 Ga0207691_10109207 3300025940 Bacteria 2461
172 Ga0207689_10001619 3300025942 Bacteria 21322
173 Ga0207679_10002168 3300025945 Bacteria 12141
174 Ga0207679_10552532 3300025945 Unclassified 1033
175 Ga0207712_10041349 3300025961 Bacteria 3168
176 Ga0207668_10028796 3300025972 Bacteria 3636
177 Ga0207658_10075429 3300025986 Bacteria 2566
178 Ga0207677_10015263 3300026023 Bacteria 4511
179 Ga0207677_10084702 3300026023 Unclassified 2286
180 Ga0207703_10067537 3300026035 Bacteria 2942
181 Ga0207678_10134900 3300026067 Bacteria 2106
182 Ga0207708_10033438 3300026075 Bacteria 3906
183 Ga0207708_10035090 3300026075 Bacteria 3816
184 Ga0207708_10048204 3300026075 Bacteria 3243
185 Ga0207708_10529889 3300026075 Bacteria 991
186 Ga0207702_10217276 3300026078 Bacteria 1780
187 Ga0207641_10011427 3300026088 Bacteria 7288
188 Ga0207641_10778029 3300026088 Unclassified 946
189 Ga0207648_10066031 3300026089 Bacteria 3155
190 Ga0207648_10254956 3300026089 Bacteria 1564
191 Ga0207676_10140741 3300026095 Unclassified 2065
192 Ga0207674_10185110 3300026116 Bacteria 2033
193 Ga0207675_100494573 3300026118 Bacteria 1217
194 Ga0207698_10327830 3300026142 Unclassified 1437
195 Ga0209589_1001229 3300027357 Bacteria 41464
196 Ga0209282_1011671 3300027666 Bacteria 5580
197 Ga0209998_10014314 3300027717 Bacteria 1655
198 Ga0207428_10000739 3300027907 Bacteria 37468
199 Ga0207428_10003639 3300027907 Bacteria 14859
200 Ga0268266_10033662 3300028379 Bacteria 4356
201 Ga0268265_10029100 3300028380 Bacteria 3962
202 Ga0268265_10396701 3300028380 Bacteria 1274
203 Ga0268264_10010347 3300028381 Bacteria 7714
204 Ga0307508_10099352 3300031616 Bacteria 2504
205 Ga0373936_0010716 3300035113 Unclassified 3462
206 Ga0373962_0021592 3300035242 Bacteria 1700
207 Ga0395898_0114326 3300037466 Bacteria 2586
208 Ga0395905_0017441 3300037471 Bacteria 6815
209 Ga0436364_0427662 3300037853 Bacteria 43052
210 Ga0436364_1235642 3300037853 Bacteria 1537
211 Ga0395901_0330711 3300038443 Bacteria 1575
212 Ga0436365_0770967 3300039437 Bacteria 1167
213 Ga0439435_0020288 3300042436 Bacteria 1713
214 Ga0451577_0374284 3300042876 Bacteria 1292
215 Ga0453683_0165038 3300044673 Bacteria 1402
216 Ga0451576_0003272 3300045051 Bacteria 22488
217 Ga0451576_0169407 3300045051 Bacteria 2279
218 Ga0451576_0172392 3300045051 Bacteria 2258
219 Ga0451576_0276744 3300045051 Unclassified 1755
220 Ga0495603_0017344 3300046455 Bacteria 4359
221 Ga0495629_0003754 3300046459 Bacteria 11443
222 Ga0495585_0000356 3300046492 Bacteria 44409
223 Ga0495594_0021805 3300046499 Bacteria 3421
224 Ga0495606_0023641 3300046507 Bacteria 4446
225 Ga0495608_0026641 3300046511 Bacteria 3939
226 Ga0495648_0005434 3300046524 Bacteria 10585
227 Ga0495598_0020726 3300046537 Unclassified 1739
228 Ga0495621_0016188 3300046539 Unclassified 2390
229 Ga0495667_0050574 3300046559 Bacteria 2743
230 Ga0495656_0018497 3300046615 Bacteria 2676
231 Ga0495635_0054981 3300046663 Bacteria 2742
232 Ga0495588_0043329 3300046674 Bacteria 2303
233 Ga0495657_0049779 3300046675 Bacteria 2821
234 Ga0495646_0010076 3300046680 Bacteria 6010
235 Ga0495658_0120017 3300046683 Bacteria 1589
236 Ga0495669_0117124 3300046684 Bacteria 1247
237 Ga0495649_0036624 3300046694 Bacteria 2695
238 Ga0495604_0085097 3300047317 Bacteria 2360
239 Ga0495636_0087102 3300047318 Bacteria 1351
240 Ga0495675_0068250 3300047444 Bacteria 2246
241 Ga0496105_0127217 3300048908 Bacteria 2100
242 Ga0496108_0202924 3300048911 Unclassified 1721
243 Ga0496109_0461279 3300048912 Bacteria 1200
244 Ga0496112_0089425 3300048915 Bacteria 3048
245 Ga0496113_0170831 3300048916 Unclassified 1722
246 Ga0496118_0242026 3300048921 Bacteria 1032
247 Ga0496124_0001127 3300048927 Bacteria 42030
248 Ga0501034_0265448 3300049571 Bacteria 1659
249 Ga0501036_0056216 3300049572 Bacteria 3334
250 Ga0501037_0231272 3300049573 Bacteria 1298
251 Ga0501040_0017423 3300049576 Bacteria 4768
252 Ga0501041_0041473 3300049577 Bacteria 2796
253 Ga0501042_0005484 3300049578 Bacteria 8175
254 Ga0501046_0040788 3300049580 Bacteria 3708
255 Ga0501067_0008860 3300049583 Bacteria 5574
256 Ga0501068_0178300 3300049584 Bacteria 1343
257 Ga0501071_0016988 3300049587 Bacteria 5010
258 Ga0501075_0004757 3300049591 Bacteria 9231
259 Ga0501076_0241766 3300049592 Bacteria 1477
260 Ga0501077_0064817 3300049593 Bacteria 2317
261 Ga0501245_027000 3300049708 Unclassified 930
262 Ga0501080_0039360 3300049742 Bacteria 4413
263 Ga0501080_0410303 3300049742 Bacteria 1218
264 Ga0501081_0024946 3300049743 Bacteria 4019
265 nmdc:mga00v17_44573_c1 3300050491 Bacteria 2675
266 nmdc:mga0k408_5107_c1 3300050493 Bacteria 6951
267 nmdc:mga05p37_111614_c1 3300050507 Unclassified 3362
268 nmdc:mga05p37_11483_c1 3300050507 Bacteria 10550
269 nmdc:mga05p37_14381_c1 3300050507 Bacteria 9503
270 nmdc:mga05p37_17767_c1 3300050507 Bacteria 8582
271 nmdc:mga05p37_32504_c1 3300050507 Bacteria 6381
272 nmdc:mga05p37_86492_c1 3300050507 Bacteria 3863
273 nmdc:mga09592_135834_c1 3300050508 Unclassified 2118
274 nmdc:mga09592_40891_c1 3300050508 Bacteria 3896
275 nmdc:mga09592_6174_c1 3300050508 Bacteria 9753
276 nmdc:mga09592_82403_c1 3300050508 Bacteria 2741
277 nmdc:mga0qj67_620_c1 3300050509 Bacteria 24336
278 nmdc:mga06r32_611_c1 3300050510 Bacteria 31147
279 nmdc:mga08y16_120_c1 3300050511 Bacteria 67446
280 nmdc:mga08y16_18156_c1 3300050511 Bacteria 7412
281 nmdc:mga0n895_1839_c1 3300050512 Bacteria 16182
282 nmdc:mga0n895_443174_c1 3300050512 Bacteria 1312
283 nmdc:mga0rr50_15017_c1 3300050513 Bacteria 5101
284 nmdc:mga0rr50_25561_c2 3300050513 Bacteria 1158
285 nmdc:mga0rr50_66086_c1 3300050513 Unclassified 2742
286 nmdc:mga0a205_1176_c1 3300050515 Bacteria 21834
287 nmdc:mga0a205_1312_c1 3300050515 Bacteria 20925
288 nmdc:mga0a205_21454_c1 3300050515 Bacteria 6110
289 nmdc:mga0a205_4306_c1 3300050515 Bacteria 12776
290 nmdc:mga0a205_89987_c1 3300050515 Bacteria 2966
291 nmdc:mga0sz30_10458_c1 3300050516 Bacteria 3558
292 Ga0500640_073208 3300053095 Unclassified 1466
293 Ga0500572_006467 3300053111 Unclassified 2683
294 Ga0500614_008628 3300053123 Unclassified 2163
295 Ga0500559_0006850 3300053136 Bacteria 5108
296 Ga0500624_001133 3300053157 Bacteria 4929
297 Ga0500630_042015 3300053159 Unclassified 2231
298 Ga0500639_000974 3300053163 Bacteria 14659
299 Ga0500576_117068 3300053725 Bacteria 1057
300 Ga0500596_000461 3300053735 Bacteria 7560
301 Ga0501084_0010077 3300054114 Bacteria 7809
302 Ga0501082_0124289 3300060353 Bacteria 2237
303 2841850087 2841846520 Bacteria 5345850
304 2842128559 2842124991 Bacteria 5346824
305 2876769449 2876761206 Bacteria 10111113
306 2926764691 2926760298 Bacteria 5505990
307 2932824525 2932818245 Bacteria 9955613
308 2935684400 2935675223 Bacteria 9928132
309 2935804876 2935801545 Bacteria 9301974
310 2935979772 2935975950 Bacteria 8347125
311 8019580392 8019576017 Bacteria 10049540
312 8019588118 8019586578 Bacteria 10212056
313 8019603223 8019597564 Bacteria 10041141
314 8019615309 8019608314 Bacteria 10042931
315 8019673731 8019668869 Bacteria 8791617
316 8056694404 8056689827 Bacteria 6712655
317 Ga0070681_10008514
318 JGI24746J21847_1001082
319 Ga0065712_10077138
320 Ga0065712_10143249
321 Ga0065715_10098177
322 Ga0065715_10101929
323 Ga0065715_10162320
324 Ga0065707_10088013
325 Ga0065707_10102142
326 Ga0070658_10237241
327 Ga0070690_100146048
328 Ga0070677_10001624
329 Ga0070677_10048535
330 Ga0070666_10105560
331 Ga0068868_100008843
332 Ga0070689_100124644
333 Ga0070687_100018359
334 Ga0070661_100002912
335 Ga0070661_100079988
336 Ga0070668_100401504
337 Ga0070669_100004639
338 Ga0070669_100080173
339 Ga0070669_100090476
340 Ga0070669_100164612
341 Ga0070675_100000798
342 Ga0070675_100007129
343 Ga0070675_100060878
344 Ga0070675_100454309
345 Ga0070675_100700049
346 Ga0070671_100014967
347 Ga0070673_100020704
348 Ga0070673_100160283
349 Ga0070673_100302000
350 Ga0070667_100194512
351 Ga0070714_100015578
352 Ga0070700_100088951
353 Ga0070700_100106045
354 Ga0070708_100115013
355 Ga0070663_100197223
356 Ga0068867_100020306
357 Ga0070685_10000976
358 Ga0070685_10357657
359 Ga0070706_100267777
360 Ga0070698_100306428
361 Ga0070699_100133605
362 Ga0070679_100038475
363 Ga0070679_100082905
364 Ga0070679_100140259
365 Ga0070684_100191190
366 Ga0070684_100192955
367 Ga0070697_100093469
368 Ga0070672_100099973
369 Ga0070672_100103745
370 Ga0070672_100183910
371 Ga0070686_100107414
372 Ga0070665_100159780
373 Ga0070704_100270312
374 Ga0068855_100020221
375 Ga0068855_100150242
376 Ga0070664_100036012
377 Ga0070664_100060573
378 Ga0070664_100325893
379 Ga0068857_100169709
380 Ga0068856_100191330
381 Ga0070702_100029021
382 Ga0068852_100134743
383 Ga0068852_100302263
384 Ga0068852_100350478
385 Ga0068852_100507860
386 Ga0068859_100208175
387 Ga0068859_100467643
388 Ga0068864_100157273
389 Ga0068864_100446980
390 Ga0068861_100101316
391 Ga0068870_10084347
392 Ga0068863_100007751
393 Ga0068858_100005995
394 Ga0068858_100016170
395 Ga0068860_100009379
396 Ga0068860_100012100
397 Ga0068862_100542628
398 Ga0075366_10025454
399 Ga0097621_100015021
400 Ga0075370_10184284
401 Ga0075428_100027325
402 Ga0075428_100427965
403 Ga0075430_100015947
404 Ga0075430_100025591
405 Ga0075431_100000286
406 Ga0075433_10001301
407 Ga0075433_10006189
408 Ga0075433_10022541
409 Ga0075433_10068952
410 Ga0075433_10169785
411 Ga0075434_100000533
412 Ga0075434_100027550
413 Ga0075434_100134793
414 Ga0075434_100741494
415 Ga0075429_100004174
416 Ga0075429_100009869
417 Ga0068865_100034572
418 Ga0068865_100317608
419 Ga0097620_100208162
420 Ga0097620_100467641
421 Ga0099822_1010543
422 Ga0099826_10001485
423 Ga0075435_100007887
424 Ga0075435_100013416
425 Ga0111539_10005211
426 Ga0111539_10028004
427 Ga0111539_10202887
428 Ga0105245_10690020
429 Ga0114129_10020415
430 Ga0114129_10036488
431 Ga0114129_10039416
432 Ga0114129_10042824
433 Ga0114129_10072880
434 Ga0114129_10074238
435 Ga0105248_10042050
436 Ga0105248_10121709
437 Ga0105249_10001188
438 Ga0123340_1058224
439 Ga0123341_1049326
440 Ga0105246_10018208
441 Ga0157373_10000368
442 Ga0157378_10177791
443 Ga0157372_10691804
444 Ga0157375_10057314
445 Ga0157375_10334453
446 Ga0163163_10127009
447 Ga0157380_10017337
448 Ga0157380_10177695
449 Ga0157377_10001992
450 Ga0157377_10144712
451 Ga0157379_10024659
452 Ga0157376_10069708
453 Ga0213875_10000447
454 Ga0209148_1001324
455 Ga0209455_1000616
456 Ga0207697_10000434
457 Ga0207682_10006537
458 Ga0207682_10105109
459 Ga0207688_10000794
460 Ga0207645_10001297
461 Ga0207643_10004020
462 Ga0207643_10074548
463 Ga0207643_10098658
464 Ga0207705_10237420
465 Ga0207684_10115041
466 Ga0207662_10069005
467 Ga0207662_10078382
468 Ga0207649_10010735
469 Ga0207652_10027229
470 Ga0207646_10058007
471 Ga0207681_10014746
472 Ga0207681_10047097
473 Ga0207659_10008533
474 Ga0207659_10014171
475 Ga0207659_10148251
476 Ga0207659_10187133
477 Ga0207659_10377951
478 Ga0207659_10389228
479 Ga0207687_10519963
480 Ga0207644_10088839
481 Ga0207706_10003175
482 Ga0207706_10185921
483 Ga0207670_10066095
484 Ga0207691_10003720
485 Ga0207691_10050539
486 Ga0207691_10065355
487 Ga0207691_10109207
488 Ga0207689_10001619
489 Ga0207679_10002168
490 Ga0207679_10552532
491 Ga0207712_10041349
492 Ga0207668_10028796
493 Ga0207658_10075429
494 Ga0207677_10015263
495 Ga0207677_10084702
496 Ga0207703_10067537
497 Ga0207678_10134900
498 Ga0207708_10033438
499 Ga0207708_10035090
500 Ga0207708_10048204
501 Ga0207708_10529889
502 Ga0207702_10217276
503 Ga0207641_10011427
504 Ga0207641_10778029
505 Ga0207648_10066031
506 Ga0207648_10254956
507 Ga0207676_10140741
508 Ga0207674_10185110
509 Ga0207675_100494573
510 Ga0207698_10327830
511 Ga0209589_1001229
512 Ga0209282_1011671
513 Ga0209998_10014314
514 Ga0207428_10000739
515 Ga0207428_10003639
516 Ga0268266_10033662
517 Ga0268265_10029100
518 Ga0268265_10396701
519 Ga0268264_10010347
520 Ga0307508_10099352
521 Ga0373936_0010716
522 Ga0373962_0021592
523 Ga0395898_0114326
524 Ga0395905_0017441
525 Ga0436364_0427662
526 Ga0436364_1235642
527 Ga0395901_0330711
528 Ga0436365_0770967
529 Ga0439435_0020288
530 Ga0451577_0374284
531 Ga0453683_0165038
532 Ga0451576_0003272
533 Ga0451576_0169407
534 Ga0451576_0172392
535 Ga0451576_0276744
536 Ga0495603_0017344
537 Ga0495629_0003754
538 Ga0495585_0000356
539 Ga0495594_0021805
540 Ga0495606_0023641
541 Ga0495608_0026641
542 Ga0495648_0005434
543 Ga0495598_0020726
544 Ga0495621_0016188
545 Ga0495667_0050574
546 Ga0495656_0018497
547 Ga0495635_0054981
548 Ga0495588_0043329
549 Ga0495657_0049779
550 Ga0495646_0010076
551 Ga0495658_0120017
552 Ga0495669_0117124
553 Ga0495649_0036624
554 Ga0495604_0085097
555 Ga0495636_0087102
556 Ga0495675_0068250
557 Ga0496105_0127217
558 Ga0496108_0202924
559 Ga0496109_0461279
560 Ga0496112_0089425
561 Ga0496113_0170831
562 Ga0496118_0242026
563 Ga0496124_0001127
564 Ga0501034_0265448
565 Ga0501036_0056216
566 Ga0501037_0231272
567 Ga0501040_0017423
568 Ga0501041_0041473
569 Ga0501042_0005484
570 Ga0501046_0040788
571 Ga0501067_0008860
572 Ga0501068_0178300
573 Ga0501071_0016988
574 Ga0501075_0004757
575 Ga0501076_0241766
576 Ga0501077_0064817
577 Ga0501245_027000
578 Ga0501080_0039360
579 Ga0501080_0410303
580 Ga0501081_0024946
581 nmdc:mga00v17_44573_c1
582 nmdc:mga0k408_5107_c1
583 nmdc:mga05p37_111614_c1
584 nmdc:mga05p37_11483_c1
585 nmdc:mga05p37_14381_c1
586 nmdc:mga05p37_17767_c1
587 nmdc:mga05p37_32504_c1
588 nmdc:mga05p37_86492_c1
589 nmdc:mga09592_135834_c1
590 nmdc:mga09592_40891_c1
591 nmdc:mga09592_6174_c1
592 nmdc:mga09592_82403_c1
593 nmdc:mga0qj67_620_c1
594 nmdc:mga06r32_611_c1
595 nmdc:mga08y16_120_c1
596 nmdc:mga08y16_18156_c1
597 nmdc:mga0n895_1839_c1
598 nmdc:mga0n895_443174_c1
599 nmdc:mga0rr50_15017_c1
600 nmdc:mga0rr50_25561_c2
601 nmdc:mga0rr50_66086_c1
602 nmdc:mga0a205_1176_c1
603 nmdc:mga0a205_1312_c1
604 nmdc:mga0a205_21454_c1
605 nmdc:mga0a205_4306_c1
606 nmdc:mga0a205_89987_c1
607 nmdc:mga0sz30_10458_c1
608 Ga0500640_073208
609 Ga0500572_006467
610 Ga0500614_008628
611 Ga0500559_0006850
612 Ga0500624_001133
613 Ga0500630_042015
614 Ga0500639_000974
615 Ga0500576_117068
616 Ga0500596_000461
617 Ga0501084_0010077
618 Ga0501082_0124289
619 2841850087
620 2842128559
621 2876769449
622 2926764691
623 2932824525
624 2935684400
625 2935804876
626 2935979772
627 8019580392
628 8019588118
629 8019603223
630 8019615309
631 8019673731
632 8056694404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

61

249

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eyw-assembly2.cif.gz_D-3 fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf with terretonin c 0.8405 16 230
5ybs-assembly1.cif.gz_A fe(ii)/(alpha)ketoglutarate-dependent dioxygenase prha-v150l/a232s in complex with berkeleyone a 0.8251 15 251
7eyr-assembly1.cif.gz_D-2 fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf apo 0.8246 16 230
7eyw-assembly1.cif.gz_B fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf with terretonin c 0.8208 16 251
7wsb-assembly3.cif.gz_E the ternary complex structure of ftmox1 with a-ketoglutarate and 13-oxo-fumitremorgin b 0.8208 16 230
ID Description Score Start End Superfamily
af_P9WI91_4_259_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9079 11 261 2.60.120.620
af_P9WI91_4_259_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8876 11 261 2.60.120.620
af_A0A1R3LVS2_5_190_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.804 74 222 2.60.120.620
af_A4HS32_63_336_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7934 21 223 2.60.120.620
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7913 75 220 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A533JAL8-F1-model_v4 deleted 0.9809 6 269
AF-A0A4Q1K0U5-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.977 4 268 GO:0005506
GO:0016706
AF-A0A2E6UPY5-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9757 8 266 GO:0005506
GO:0016706
AF-A0A382JUF7-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9744 6 269 GO:0016706
AF-A0A7I8CA78-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9731 7 269 GO:0005506
GO:0016706

Map