F403504

General Info

Members Datasets Scaffolds Average Seq Length
316 190 632 236

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10121014|Ga0070677_101210141
Length 284
Sequence MHASSRRSDRTRASSSESRAADGGEFARKASAVGSSRAPRSSCLPLADVGTASSTTPEPVALSWSGGKDSSLALAVLRADPRYEVVALFTSVTSGYDRISIHGVRRALLDAQVAALGLPLFEIVLEPNCTNDAYEAAFVDTLARLNAEHPSVRHIAFGDLYLADVRAYREKLLARTGHTGLFPLWGSDTASLALDFITAGYRAHLVCVDTQQLAASFAGREFDMALLADLPVTADPCGEGGEFHTFVSAGPIFDKPIGVAVGDVVLRDERFAFCDLLPADILVP

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
172 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
173 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
174 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
175 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
179 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
180 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
183 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
184 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.32
Rhizosphere 99.68
Stem 0
Stem Tuber 0
Unclassified 12.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10121014 3300005333 Bacteria 1182
2 MBSR1b_contig_5321495 2162886012 Bacteria 1515
3 MBSR1b_contig_5845053 2162886012 Bacteria 1800
4 Ga0065715_10093699 3300005293 Bacteria 4596
5 Ga0070658_10013360 3300005327 Bacteria 6589
6 Ga0070683_100027899 3300005329 Bacteria 5096
7 Ga0070683_100078005 3300005329 Bacteria 3098
8 Ga0070690_100067816 3300005330 Bacteria 2312
9 Ga0068869_100016941 3300005334 Bacteria 4926
10 Ga0070680_100064995 3300005336 Bacteria 2990
11 Ga0070680_100150353 3300005336 Bacteria 1955
12 Ga0070682_100007858 3300005337 Bacteria 6003
13 Ga0070682_100060537 3300005337 Unclassified 2395
14 Ga0070682_100069098 3300005337 Bacteria 2255
15 Ga0068868_100023410 3300005338 Bacteria 4674
16 Ga0070660_100017181 3300005339 Bacteria 5269
17 Ga0070660_100026982 3300005339 Unclassified 4282
18 Ga0070660_100077345 3300005339 Bacteria 2607
19 Ga0070689_100030004 3300005340 Bacteria 4124
20 Ga0070689_100282498 3300005340 Bacteria 1377
21 Ga0070691_10000899 3300005341 Bacteria 12064
22 Ga0070691_10012864 3300005341 Unclassified 3834
23 Ga0070661_100028514 3300005344 Unclassified 4027
24 Ga0070661_100039003 3300005344 Unclassified 3459
25 Ga0070661_100073637 3300005344 Bacteria 2515
26 Ga0070661_100364225 3300005344 Unclassified 1137
27 Ga0070692_10008416 3300005345 Bacteria 4603
28 Ga0070692_10042820 3300005345 Unclassified 2327
29 Ga0070692_10140172 3300005345 Bacteria 1368
30 Ga0070668_100095886 3300005347 Bacteria 2344
31 Ga0070669_100008841 3300005353 Bacteria 7187
32 Ga0070669_100288839 3300005353 Unclassified 1316
33 Ga0070675_100116496 3300005354 Bacteria 2266
34 Ga0070675_100253733 3300005354 Bacteria 1540
35 Ga0070673_100223844 3300005364 Bacteria 1629
36 Ga0070673_100578389 3300005364 Bacteria 1022
37 Ga0070688_100237656 3300005365 Bacteria 1292
38 Ga0070659_100001199 3300005366 Bacteria 18890
39 Ga0070659_100070694 3300005366 Bacteria 2773
40 Ga0070659_100275825 3300005366 Bacteria 1398
41 Ga0070667_100057496 3300005367 Bacteria 3288
42 Ga0070714_100017844 3300005435 Bacteria 5754
43 Ga0070714_101162555 3300005435 Bacteria 752
44 Ga0070713_100172588 3300005436 Unclassified 1938
45 Ga0070713_100440912 3300005436 Bacteria 1222
46 Ga0070710_10085327 3300005437 Bacteria 1852
47 Ga0070701_10308872 3300005438 Bacteria 975
48 Ga0070711_100310276 3300005439 Bacteria 1257
49 Ga0070694_100082713 3300005444 Bacteria 2236
50 Ga0070663_100023958 3300005455 Bacteria 4099
51 Ga0070662_100195979 3300005457 Bacteria 1600
52 Ga0070681_10016600 3300005458 Bacteria 7352
53 Ga0070681_10026664 3300005458 Bacteria 5808
54 Ga0070685_10000993 3300005466 Bacteria 15232
55 Ga0070685_10013335 3300005466 Bacteria 4332
56 Ga0070685_10213773 3300005466 Unclassified 1260
57 Ga0070679_100026964 3300005530 Bacteria 5650
58 Ga0070679_100029940 3300005530 Bacteria 5371
59 Ga0070679_100029947 3300005530 Bacteria 5370
60 Ga0070679_100132376 3300005530 Bacteria 2475
61 Ga0070679_100171955 3300005530 Bacteria 2139
62 Ga0070684_100005328 3300005535 Bacteria 9851
63 Ga0070684_100007748 3300005535 Bacteria 8370
64 Ga0070684_100012480 3300005535 Bacteria 6811
65 Ga0070684_100021380 3300005535 Bacteria 5383
66 Ga0070684_100265079 3300005535 Unclassified 1572
67 Ga0070697_100136437 3300005536 Bacteria 2060
68 Ga0070697_100611212 3300005536 Bacteria 958
69 Ga0068853_100169248 3300005539 Bacteria 1976
70 Ga0068853_100205977 3300005539 Bacteria 1791
71 Ga0068853_100404020 3300005539 Bacteria 1279
72 Ga0070672_100305937 3300005543 Bacteria 1348
73 Ga0070686_100347068 3300005544 Unclassified 1114
74 Ga0070693_100007157 3300005547 Bacteria 5442
75 Ga0070693_100017293 3300005547 Bacteria 3745
76 Ga0070693_100059624 3300005547 Bacteria 2213
77 Ga0070693_100211225 3300005547 Bacteria 1266
78 Ga0068855_100016937 3300005563 Bacteria 8764
79 Ga0068855_100071660 3300005563 Bacteria 4029
80 Ga0068855_100092544 3300005563 Bacteria 3487
81 Ga0068855_100104808 3300005563 Bacteria 3252
82 Ga0068855_100116729 3300005563 Unclassified 3059
83 Ga0068855_100294560 3300005563 Unclassified 1798
84 Ga0068855_100547094 3300005563 Bacteria 1253
85 Ga0070664_100000966 3300005564 Bacteria 22497
86 Ga0070664_100479908 3300005564 Bacteria 1144
87 Ga0068857_100009196 3300005577 Bacteria 8573
88 Ga0068857_100011564 3300005577 Bacteria 7677
89 Ga0068854_100070919 3300005578 Bacteria 2547
90 Ga0068854_100507703 3300005578 Bacteria 1016
91 Ga0068856_100028088 3300005614 Bacteria 5491
92 Ga0068856_100449071 3300005614 Bacteria 1310
93 Ga0068856_100492213 3300005614 Bacteria 1247
94 Ga0070702_100009305 3300005615 Bacteria 4805
95 Ga0068852_100061647 3300005616 Bacteria 3260
96 Ga0068852_100083145 3300005616 Bacteria 2847
97 Ga0068859_100019227 3300005617 Bacteria 6862
98 Ga0068859_100127460 3300005617 Bacteria 2615
99 Ga0068864_100173144 3300005618 Bacteria 1969
100 Ga0068866_10130974 3300005718 Bacteria 1426
101 Ga0068870_10279729 3300005840 Bacteria 1046
102 Ga0068863_100004917 3300005841 Bacteria 13170
103 Ga0068860_100019395 3300005843 Bacteria 6596
104 Ga0097621_100324817 3300006237 Bacteria 1364
105 Ga0068871_100345294 3300006358 Bacteria 1315
106 Ga0068871_100706171 3300006358 Bacteria 924
107 Ga0075433_10340410 3300006852 Bacteria 1326
108 Ga0075434_100016315 3300006871 Bacteria 7139
109 Ga0075434_100540924 3300006871 Bacteria 1185
110 Ga0068865_100678034 3300006881 Bacteria 879
111 Ga0097620_100019228 3300006931 Bacteria 6862
112 Ga0097620_100127468 3300006931 Bacteria 2615
113 Ga0075435_100073206 3300007076 Bacteria 2800
114 Ga0099795_10041213 3300007788 Bacteria 1643
115 Ga0105240_10088834 3300009093 Unclassified 3781
116 Ga0105240_10290531 3300009093 Unclassified 1874
117 Ga0105240_10904770 3300009093 Bacteria 949
118 Ga0105245_10009174 3300009098 Bacteria 8623
119 Ga0105245_10054157 3300009098 Bacteria 3603
120 Ga0105245_10149672 3300009098 Bacteria 2206
121 Ga0105245_10301609 3300009098 Bacteria 1572
122 Ga0105245_10481477 3300009098 Bacteria 1254
123 Ga0105241_10009171 3300009174 Bacteria 7282
124 Ga0105241_10041725 3300009174 Bacteria 3468
125 Ga0105242_10033360 3300009176 Bacteria 4121
126 Ga0105248_10004214 3300009177 Bacteria 15907
127 Ga0105248_10673638 3300009177 Unclassified 1167
128 Ga0105237_10245840 3300009545 Bacteria 1791
129 Ga0105238_10018635 3300009551 Bacteria 7067
130 Ga0105238_10031023 3300009551 Bacteria 5441
131 Ga0105238_10092921 3300009551 Bacteria 3005
132 Ga0105238_10157408 3300009551 Bacteria 2247
133 Ga0099796_10013385 3300010159 Bacteria 2342
134 Ga0105239_10021056 3300010375 Bacteria 7196
135 Ga0105239_10798387 3300010375 Bacteria 1081
136 Ga0105246_10001150 3300011119 Bacteria 15343
137 Ga0157373_10006685 3300013100 Bacteria 8587
138 Ga0157373_10191794 3300013100 Bacteria 1440
139 Ga0157371_10010667 3300013102 Bacteria 7135
140 Ga0157371_10126200 3300013102 Bacteria 1820
141 Ga0157370_10110245 3300013104 Bacteria 2573
142 Ga0157370_10122840 3300013104 Bacteria 2424
143 Ga0157370_10124695 3300013104 Bacteria 2404
144 Ga0157370_10175022 3300013104 Unclassified 1995
145 Ga0157370_10331229 3300013104 Bacteria 1404
146 Ga0157369_10123386 3300013105 Bacteria 2748
147 Ga0157369_10311499 3300013105 Unclassified 1637
148 Ga0157374_10111095 3300013296 Bacteria 2636
149 Ga0157378_10578357 3300013297 Unclassified 1132
150 Ga0163162_10576568 3300013306 Bacteria 1252
151 Ga0163162_10793714 3300013306 Bacteria 1064
152 Ga0157372_10000762 3300013307 Bacteria 34920
153 Ga0157372_10007185 3300013307 Bacteria 11853
154 Ga0157372_10011834 3300013307 Bacteria 9294
155 Ga0157372_10029156 3300013307 Bacteria 6023
156 Ga0157372_10030308 3300013307 Bacteria 5918
157 Ga0157372_10148655 3300013307 Unclassified 2702
158 Ga0157372_10314371 3300013307 Bacteria 1823
159 Ga0157375_10080497 3300013308 Unclassified 3295
160 Ga0157375_10297038 3300013308 Bacteria 1779
161 Ga0163163_10023691 3300014325 Bacteria 5830
162 Ga0157377_10350200 3300014745 Bacteria 991
163 Ga0157376_10018578 3300014969 Bacteria 5334
164 Ga0206354_10175939 3300020081 Unclassified 781
165 Ga0207697_10167176 3300025315 Bacteria 961
166 Ga0207647_10121369 3300025904 Bacteria 1541
167 Ga0207699_10194729 3300025906 Bacteria 1370
168 Ga0207645_10407362 3300025907 Bacteria 915
169 Ga0207705_10101825 3300025909 Bacteria 2113
170 Ga0207654_10038913 3300025911 Bacteria 2672
171 Ga0207707_10016387 3300025912 Bacteria 6464
172 Ga0207707_10031654 3300025912 Bacteria 4629
173 Ga0207707_10629949 3300025912 Bacteria 906
174 Ga0207695_10011890 3300025913 Bacteria 10490
175 Ga0207695_10018701 3300025913 Bacteria 8001
176 Ga0207663_10170865 3300025916 Bacteria 1544
177 Ga0207660_10010271 3300025917 Bacteria 6071
178 Ga0207660_10034877 3300025917 Bacteria 3490
179 Ga0207660_10123123 3300025917 Bacteria 1966
180 Ga0207660_10322189 3300025917 Bacteria 1234
181 Ga0207662_10080369 3300025918 Bacteria 1988
182 Ga0207657_10010689 3300025919 Bacteria 9143
183 Ga0207657_10020857 3300025919 Bacteria 6184
184 Ga0207649_10013406 3300025920 Bacteria 4577
185 Ga0207649_10206733 3300025920 Bacteria 1390
186 Ga0207649_10300760 3300025920 Unclassified 1173
187 Ga0207652_10005459 3300025921 Bacteria 10318
188 Ga0207652_10015228 3300025921 Bacteria 6241
189 Ga0207652_10124866 3300025921 Bacteria 2292
190 Ga0207652_10147858 3300025921 Bacteria 2103
191 Ga0207681_10017138 3300025923 Bacteria 4544
192 Ga0207694_10021457 3300025924 Bacteria 4895
193 Ga0207694_10085026 3300025924 Bacteria 2489
194 Ga0207650_10017866 3300025925 Bacteria 4969
195 Ga0207650_10287807 3300025925 Bacteria 1339
196 Ga0207659_10002014 3300025926 Bacteria 12040
197 Ga0207687_10004244 3300025927 Bacteria 9582
198 Ga0207687_10016076 3300025927 Bacteria 4911
199 Ga0207700_10229672 3300025928 Bacteria 1577
200 Ga0207664_10279176 3300025929 Bacteria 1465
201 Ga0207706_10022267 3300025933 Bacteria 5686
202 Ga0207686_10157760 3300025934 Bacteria 1587
203 Ga0207670_10156309 3300025936 Bacteria 1698
204 Ga0207704_10078627 3300025938 Bacteria 2122
205 Ga0207665_10213894 3300025939 Unclassified 1410
206 Ga0207665_10543030 3300025939 Bacteria 902
207 Ga0207691_10005154 3300025940 Bacteria 12621
208 Ga0207711_10110994 3300025941 Unclassified 2439
209 Ga0207661_10001261 3300025944 Bacteria 16929
210 Ga0207661_10001898 3300025944 Bacteria 14342
211 Ga0207661_10046659 3300025944 Bacteria 3435
212 Ga0207661_10258210 3300025944 Bacteria 1551
213 Ga0207679_10002677 3300025945 Bacteria 11002
214 Ga0207667_10005808 3300025949 Bacteria 15049
215 Ga0207667_10063797 3300025949 Bacteria 3849
216 Ga0207667_10252582 3300025949 Unclassified 1804
217 Ga0207667_10294743 3300025949 Unclassified 1657
218 Ga0207667_10305459 3300025949 Bacteria 1625
219 Ga0207667_10562592 3300025949 Bacteria 1152
220 Ga0207667_10567956 3300025949 Bacteria 1146
221 Ga0207651_10190515 3300025960 Bacteria 1635
222 Ga0207651_10366527 3300025960 Bacteria 1217
223 Ga0207668_10212378 3300025972 Bacteria 1549
224 Ga0207640_10036040 3300025981 Bacteria 3102
225 Ga0207640_10192653 3300025981 Unclassified 1538
226 Ga0207658_10077020 3300025986 Bacteria 2543
227 Ga0207677_10023746 3300026023 Bacteria 3794
228 Ga0207677_10041276 3300026023 Bacteria 3050
229 Ga0207639_10081531 3300026041 Bacteria 2563
230 Ga0207639_10238852 3300026041 Bacteria 1579
231 Ga0207678_10000274 3300026067 Bacteria 46691
232 Ga0207702_10290063 3300026078 Bacteria 1550
233 Ga0207648_10525525 3300026089 Bacteria 1084
234 Ga0207676_10108490 3300026095 Unclassified 2317
235 Ga0207674_10000256 3300026116 Bacteria 66474
236 Ga0207674_10025562 3300026116 Bacteria 6292
237 Ga0207675_100055160 3300026118 Bacteria 3707
238 Ga0207675_100584854 3300026118 Unclassified 1118
239 Ga0207683_10052086 3300026121 Bacteria 3586
240 Ga0207698_10041709 3300026142 Bacteria 3422
241 Ga0207698_10927856 3300026142 Bacteria 879
242 Ga0209981_1000946 3300027378 Bacteria 3651
243 Ga0268264_10062606 3300028381 Unclassified 3125
244 Ga0307408_100102147 3300031548 Bacteria 2186
245 Ga0307405_10029210 3300031731 Bacteria 3220
246 Ga0307413_10049327 3300031824 Bacteria 2522
247 Ga0307413_10063242 3300031824 Bacteria 2293
248 Ga0307410_10003235 3300031852 Bacteria 8130
249 Ga0307410_10144852 3300031852 Bacteria 1762
250 Ga0307406_10030344 3300031901 Unclassified 3282
251 Ga0307406_10033452 3300031901 Bacteria 3147
252 Ga0307407_10014180 3300031903 Bacteria 3894
253 Ga0307412_10008108 3300031911 Bacteria 5986
254 Ga0307412_10043278 3300031911 Bacteria 2931
255 Ga0307409_100102430 3300031995 Bacteria 2378
256 Ga0307409_100110857 3300031995 Bacteria 2300
257 Ga0307416_100024520 3300032002 Bacteria 4405
258 Ga0307416_100299886 3300032002 Bacteria 1596
259 Ga0307416_100466888 3300032002 Bacteria 1319
260 Ga0307414_10027665 3300032004 Bacteria 3668
261 Ga0307414_10348396 3300032004 Bacteria 1270
262 Ga0307411_10110188 3300032005 Bacteria 1968
263 Ga0307415_100032066 3300032126 Bacteria 3393
264 Ga0307415_100252606 3300032126 Bacteria 1433
265 Ga0373948_0028564 3300034817 Bacteria 1111
266 Ga0373934_0001272 3300035086 Bacteria 9187
267 Ga0373955_0044733 3300035172 Bacteria 2386
268 Ga0373931_0032047 3300035691 Bacteria 2717
269 Ga0373933_0057820 3300035724 Bacteria 2331
270 Ga0373937_0038197 3300036401 Bacteria 4375
271 Ga0242420_010169 3300038996 Bacteria 1558
272 Ga0466966_0048798 3300044684 Bacteria 2697
273 Ga0466959_0029723 3300045049 Bacteria 4049
274 Ga0451576_0270430 3300045051 Bacteria 1777
275 Ga0466967_0148132 3300045976 Bacteria 2191
276 Ga0495629_0024609 3300046459 Bacteria 4286
277 Ga0495608_0045882 3300046511 Bacteria 2910
278 Ga0495628_0112674 3300046516 Bacteria 2091
279 Ga0495643_0000008 3300046522 Bacteria 367010
280 Ga0495652_0006078 3300046529 Bacteria 11285
281 Ga0495645_0018626 3300046543 Bacteria 4988
282 Ga0495657_0038290 3300046675 Bacteria 3301
283 Ga0495599_0003424 3300046678 Bacteria 9284
284 Ga0495623_0019405 3300046679 Bacteria 4395
285 Ga0495646_0254546 3300046680 Unclassified 939
286 Ga0495658_0027504 3300046683 Bacteria 3062
287 Ga0495613_0100536 3300046689 Unclassified 2089
288 Ga0495675_0014130 3300047444 Bacteria 5047
289 Ga0495684_0002841 3300047471 Bacteria 13642
290 Ga0495684_0003053 3300047471 Bacteria 13170
291 Ga0495602_0031208 3300048088 Bacteria 5041
292 Ga0495602_0092974 3300048088 Bacteria 2497
293 Ga0496112_0002034 3300048915 Bacteria 16027
294 Ga0501292_008814 3300049515 Bacteria 1484
295 Ga0501296_009094 3300049519 Bacteria 1160
296 Ga0501202_000167 3300049652 Bacteria 8027
297 Ga0501217_001964 3300049661 Bacteria 3958
298 Ga0501217_027537 3300049661 Bacteria 1380
299 Ga0501230_006937 3300049667 Bacteria 1662
300 Ga0501233_002521 3300049668 Bacteria 3240
301 Ga0501235_000663 3300049669 Bacteria 6954
302 Ga0501243_007914 3300049675 Bacteria 1632
303 Ga0501259_003792 3300049688 Bacteria 2403
304 Ga0501261_003520 3300049690 Bacteria 1921
305 Ga0501221_021997 3300049704 Bacteria 1260
306 Ga0501225_0009339 3300049705 Bacteria 2794
307 Ga0501234_002415 3300049707 Unclassified 2942
308 Ga0501245_001136 3300049708 Unclassified 3433
309 Ga0501212_006778 3300049851 Bacteria 1553
310 nmdc:mga05p37_18322_c1 3300050507 Bacteria 8456
311 nmdc:mga0rr50_201813_c1 3300050513 Bacteria 1634
312 nmdc:mga0rr50_69682_c1 3300050513 Unclassified 2677
313 nmdc:mga08x19_371644_c1 3300050514 Unclassified 1000
314 Ga0495601_0187227 3300053077 Unclassified 1353
315 Ga0495612_0005826 3300053078 Bacteria 5089
316 Ga0495619_0161204 3300053085 Bacteria 1549
317 Ga0070677_10121014
318 MBSR1b_contig_5321495
319 MBSR1b_contig_5845053
320 Ga0065715_10093699
321 Ga0070658_10013360
322 Ga0070683_100027899
323 Ga0070683_100078005
324 Ga0070690_100067816
325 Ga0068869_100016941
326 Ga0070680_100064995
327 Ga0070680_100150353
328 Ga0070682_100007858
329 Ga0070682_100060537
330 Ga0070682_100069098
331 Ga0068868_100023410
332 Ga0070660_100017181
333 Ga0070660_100026982
334 Ga0070660_100077345
335 Ga0070689_100030004
336 Ga0070689_100282498
337 Ga0070691_10000899
338 Ga0070691_10012864
339 Ga0070661_100028514
340 Ga0070661_100039003
341 Ga0070661_100073637
342 Ga0070661_100364225
343 Ga0070692_10008416
344 Ga0070692_10042820
345 Ga0070692_10140172
346 Ga0070668_100095886
347 Ga0070669_100008841
348 Ga0070669_100288839
349 Ga0070675_100116496
350 Ga0070675_100253733
351 Ga0070673_100223844
352 Ga0070673_100578389
353 Ga0070688_100237656
354 Ga0070659_100001199
355 Ga0070659_100070694
356 Ga0070659_100275825
357 Ga0070667_100057496
358 Ga0070714_100017844
359 Ga0070714_101162555
360 Ga0070713_100172588
361 Ga0070713_100440912
362 Ga0070710_10085327
363 Ga0070701_10308872
364 Ga0070711_100310276
365 Ga0070694_100082713
366 Ga0070663_100023958
367 Ga0070662_100195979
368 Ga0070681_10016600
369 Ga0070681_10026664
370 Ga0070685_10000993
371 Ga0070685_10013335
372 Ga0070685_10213773
373 Ga0070679_100026964
374 Ga0070679_100029940
375 Ga0070679_100029947
376 Ga0070679_100132376
377 Ga0070679_100171955
378 Ga0070684_100005328
379 Ga0070684_100007748
380 Ga0070684_100012480
381 Ga0070684_100021380
382 Ga0070684_100265079
383 Ga0070697_100136437
384 Ga0070697_100611212
385 Ga0068853_100169248
386 Ga0068853_100205977
387 Ga0068853_100404020
388 Ga0070672_100305937
389 Ga0070686_100347068
390 Ga0070693_100007157
391 Ga0070693_100017293
392 Ga0070693_100059624
393 Ga0070693_100211225
394 Ga0068855_100016937
395 Ga0068855_100071660
396 Ga0068855_100092544
397 Ga0068855_100104808
398 Ga0068855_100116729
399 Ga0068855_100294560
400 Ga0068855_100547094
401 Ga0070664_100000966
402 Ga0070664_100479908
403 Ga0068857_100009196
404 Ga0068857_100011564
405 Ga0068854_100070919
406 Ga0068854_100507703
407 Ga0068856_100028088
408 Ga0068856_100449071
409 Ga0068856_100492213
410 Ga0070702_100009305
411 Ga0068852_100061647
412 Ga0068852_100083145
413 Ga0068859_100019227
414 Ga0068859_100127460
415 Ga0068864_100173144
416 Ga0068866_10130974
417 Ga0068870_10279729
418 Ga0068863_100004917
419 Ga0068860_100019395
420 Ga0097621_100324817
421 Ga0068871_100345294
422 Ga0068871_100706171
423 Ga0075433_10340410
424 Ga0075434_100016315
425 Ga0075434_100540924
426 Ga0068865_100678034
427 Ga0097620_100019228
428 Ga0097620_100127468
429 Ga0075435_100073206
430 Ga0099795_10041213
431 Ga0105240_10088834
432 Ga0105240_10290531
433 Ga0105240_10904770
434 Ga0105245_10009174
435 Ga0105245_10054157
436 Ga0105245_10149672
437 Ga0105245_10301609
438 Ga0105245_10481477
439 Ga0105241_10009171
440 Ga0105241_10041725
441 Ga0105242_10033360
442 Ga0105248_10004214
443 Ga0105248_10673638
444 Ga0105237_10245840
445 Ga0105238_10018635
446 Ga0105238_10031023
447 Ga0105238_10092921
448 Ga0105238_10157408
449 Ga0099796_10013385
450 Ga0105239_10021056
451 Ga0105239_10798387
452 Ga0105246_10001150
453 Ga0157373_10006685
454 Ga0157373_10191794
455 Ga0157371_10010667
456 Ga0157371_10126200
457 Ga0157370_10110245
458 Ga0157370_10122840
459 Ga0157370_10124695
460 Ga0157370_10175022
461 Ga0157370_10331229
462 Ga0157369_10123386
463 Ga0157369_10311499
464 Ga0157374_10111095
465 Ga0157378_10578357
466 Ga0163162_10576568
467 Ga0163162_10793714
468 Ga0157372_10000762
469 Ga0157372_10007185
470 Ga0157372_10011834
471 Ga0157372_10029156
472 Ga0157372_10030308
473 Ga0157372_10148655
474 Ga0157372_10314371
475 Ga0157375_10080497
476 Ga0157375_10297038
477 Ga0163163_10023691
478 Ga0157377_10350200
479 Ga0157376_10018578
480 Ga0206354_10175939
481 Ga0207697_10167176
482 Ga0207647_10121369
483 Ga0207699_10194729
484 Ga0207645_10407362
485 Ga0207705_10101825
486 Ga0207654_10038913
487 Ga0207707_10016387
488 Ga0207707_10031654
489 Ga0207707_10629949
490 Ga0207695_10011890
491 Ga0207695_10018701
492 Ga0207663_10170865
493 Ga0207660_10010271
494 Ga0207660_10034877
495 Ga0207660_10123123
496 Ga0207660_10322189
497 Ga0207662_10080369
498 Ga0207657_10010689
499 Ga0207657_10020857
500 Ga0207649_10013406
501 Ga0207649_10206733
502 Ga0207649_10300760
503 Ga0207652_10005459
504 Ga0207652_10015228
505 Ga0207652_10124866
506 Ga0207652_10147858
507 Ga0207681_10017138
508 Ga0207694_10021457
509 Ga0207694_10085026
510 Ga0207650_10017866
511 Ga0207650_10287807
512 Ga0207659_10002014
513 Ga0207687_10004244
514 Ga0207687_10016076
515 Ga0207700_10229672
516 Ga0207664_10279176
517 Ga0207706_10022267
518 Ga0207686_10157760
519 Ga0207670_10156309
520 Ga0207704_10078627
521 Ga0207665_10213894
522 Ga0207665_10543030
523 Ga0207691_10005154
524 Ga0207711_10110994
525 Ga0207661_10001261
526 Ga0207661_10001898
527 Ga0207661_10046659
528 Ga0207661_10258210
529 Ga0207679_10002677
530 Ga0207667_10005808
531 Ga0207667_10063797
532 Ga0207667_10252582
533 Ga0207667_10294743
534 Ga0207667_10305459
535 Ga0207667_10562592
536 Ga0207667_10567956
537 Ga0207651_10190515
538 Ga0207651_10366527
539 Ga0207668_10212378
540 Ga0207640_10036040
541 Ga0207640_10192653
542 Ga0207658_10077020
543 Ga0207677_10023746
544 Ga0207677_10041276
545 Ga0207639_10081531
546 Ga0207639_10238852
547 Ga0207678_10000274
548 Ga0207702_10290063
549 Ga0207648_10525525
550 Ga0207676_10108490
551 Ga0207674_10000256
552 Ga0207674_10025562
553 Ga0207675_100055160
554 Ga0207675_100584854
555 Ga0207683_10052086
556 Ga0207698_10041709
557 Ga0207698_10927856
558 Ga0209981_1000946
559 Ga0268264_10062606
560 Ga0307408_100102147
561 Ga0307405_10029210
562 Ga0307413_10049327
563 Ga0307413_10063242
564 Ga0307410_10003235
565 Ga0307410_10144852
566 Ga0307406_10030344
567 Ga0307406_10033452
568 Ga0307407_10014180
569 Ga0307412_10008108
570 Ga0307412_10043278
571 Ga0307409_100102430
572 Ga0307409_100110857
573 Ga0307416_100024520
574 Ga0307416_100299886
575 Ga0307416_100466888
576 Ga0307414_10027665
577 Ga0307414_10348396
578 Ga0307411_10110188
579 Ga0307415_100032066
580 Ga0307415_100252606
581 Ga0373948_0028564
582 Ga0373934_0001272
583 Ga0373955_0044733
584 Ga0373931_0032047
585 Ga0373933_0057820
586 Ga0373937_0038197
587 Ga0242420_010169
588 Ga0466966_0048798
589 Ga0466959_0029723
590 Ga0451576_0270430
591 Ga0466967_0148132
592 Ga0495629_0024609
593 Ga0495608_0045882
594 Ga0495628_0112674
595 Ga0495643_0000008
596 Ga0495652_0006078
597 Ga0495645_0018626
598 Ga0495657_0038290
599 Ga0495599_0003424
600 Ga0495623_0019405
601 Ga0495646_0254546
602 Ga0495658_0027504
603 Ga0495613_0100536
604 Ga0495675_0014130
605 Ga0495684_0002841
606 Ga0495684_0003053
607 Ga0495602_0031208
608 Ga0495602_0092974
609 Ga0496112_0002034
610 Ga0501292_008814
611 Ga0501296_009094
612 Ga0501202_000167
613 Ga0501217_001964
614 Ga0501217_027537
615 Ga0501230_006937
616 Ga0501233_002521
617 Ga0501235_000663
618 Ga0501243_007914
619 Ga0501259_003792
620 Ga0501261_003520
621 Ga0501221_021997
622 Ga0501225_0009339
623 Ga0501234_002415
624 Ga0501245_001136
625 Ga0501212_006778
626 nmdc:mga05p37_18322_c1
627 nmdc:mga0rr50_201813_c1
628 nmdc:mga0rr50_69682_c1
629 nmdc:mga08x19_371644_c1
630 Ga0495601_0187227
631 Ga0495612_0005826
632 Ga0495619_0161204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01902

Diphthami_syn_2

Diphthamide synthase

59

277

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d13-assembly1.cif.gz_A crystal structure of ph1257 from pyrococcus horikoshii ot3 0.842 1 226
3rjz-assembly1.cif.gz_A-2 x-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23 0.8228 5 224
2d13-assembly1.cif.gz_A crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8166 1 226
2d13-assembly2.cif.gz_B crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8161 1 226
2d13-assembly2.cif.gz_D crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8155 4 226
ID Description Score Start End Superfamily
af_Q12429_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8273 5 138 3.40.50.620
af_Q8I5J0_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8141 4 146 3.40.50.620
af_Q966L4_1_159_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8049 5 146 3.40.50.620
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8038 5 132 3.40.50.620
af_Q4E1Q2_1_161_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7947 5 138 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V7SVM3-F1-model_v4 ATP-binding protein 0.9976 9 225 GO:0005524
AF-A0A359CM52-F1-model_v4 ATP-binding protein 0.9969 142 223 GO:0005524
AF-A0A2V7EZT9-F1-model_v4 ATP-binding protein 0.9914 9 227 GO:0005524
AF-A0A2V7SVM3-F1-model_v4 ATP-binding protein 0.9885 9 225 GO:0005524
AF-A0A534AFB1-F1-model_v4 ATP-binding protein 0.9883 129 225 GO:0005524

Map