F403411

General Info

Members Datasets Scaffolds Average Seq Length
315 182 630 162

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0029033|Ga0500641_0029033_1115_1714
Length 181
Sequence MLADAIDALLPQTQCTRCGYAGCRPYAEAIERGEAEINQCPPGGAQTIEVLATFLHRDVRPLNPANGIEAPPTVAFIDESRCIGCAKCLPPCPVDAIVGAARRMHTVVASMIPSSAPIIPEPQLNRQRYEAHNARITRRVQERAALLDARKDAAHGANSTTGVNNAQRTVSSAALDLSEQT

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
176 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
177 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 0
Rhizoplane 2.86
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0029033 3300053096 Bacteria 2164
2 Ga0070690_100003154 3300005330 Bacteria 8981
3 Ga0070670_100042631 3300005331 Bacteria 3902
4 Ga0070670_100212611 3300005331 Bacteria 1681
5 Ga0070677_10007292 3300005333 Bacteria 3687
6 Ga0070677_10031142 3300005333 Bacteria 2036
7 Ga0068869_100307011 3300005334 Bacteria 1283
8 Ga0070682_100029128 3300005337 Bacteria 3324
9 Ga0070682_100083352 3300005337 Bacteria 2075
10 Ga0070682_100090984 3300005337 Bacteria 1996
11 Ga0070689_100023508 3300005340 Bacteria 4614
12 Ga0070689_100260331 3300005340 Bacteria 1434
13 Ga0070691_10346078 3300005341 Bacteria 824
14 Ga0070668_100173363 3300005347 Bacteria 1757
15 Ga0070669_100145783 3300005353 Bacteria 1829
16 Ga0070669_100212859 3300005353 Bacteria 1526
17 Ga0070669_100252059 3300005353 Bacteria 1406
18 Ga0070675_100019317 3300005354 Bacteria 5428
19 Ga0070675_100218086 3300005354 Bacteria 1660
20 Ga0070675_100408347 3300005354 Bacteria 1212
21 Ga0070675_100849292 3300005354 Bacteria 835
22 Ga0070671_100392815 3300005355 Bacteria 1186
23 Ga0070674_100037441 3300005356 Bacteria 3263
24 Ga0070674_100145881 3300005356 Bacteria 1781
25 Ga0070674_100257859 3300005356 Bacteria 1372
26 Ga0070673_100051355 3300005364 Bacteria 3228
27 Ga0070688_100054847 3300005365 Bacteria 2498
28 Ga0070688_100086283 3300005365 Bacteria 2042
29 Ga0070710_10058082 3300005437 Bacteria 2194
30 Ga0070710_10384428 3300005437 Bacteria 937
31 Ga0070701_10004830 3300005438 Bacteria 5508
32 Ga0070711_100128873 3300005439 Bacteria 1882
33 Ga0070705_100006890 3300005440 Bacteria 5581
34 Ga0070700_100106165 3300005441 Bacteria 1859
35 Ga0070700_100556377 3300005441 Bacteria 892
36 Ga0070700_100794308 3300005441 Bacteria 761
37 Ga0070694_100008277 3300005444 Bacteria 6361
38 Ga0070678_100025275 3300005456 Bacteria 3992
39 Ga0070678_100263838 3300005456 Bacteria 1450
40 Ga0070678_100657414 3300005456 Bacteria 941
41 Ga0070662_100169172 3300005457 Bacteria 1715
42 Ga0070681_10015740 3300005458 Bacteria 7539
43 Ga0070681_10642204 3300005458 Bacteria 976
44 Ga0068867_101234077 3300005459 Bacteria 688
45 Ga0070685_10184111 3300005466 Bacteria 1347
46 Ga0070685_10250536 3300005466 Bacteria 1173
47 Ga0070685_10962401 3300005466 Bacteria 638
48 Ga0070698_100253555 3300005471 Bacteria 1692
49 Ga0070699_100078860 3300005518 Bacteria 2868
50 Ga0070679_100006129 3300005530 Bacteria 11184
51 Ga0070679_100135481 3300005530 Bacteria 2444
52 Ga0070672_100018483 3300005543 Bacteria 5040
53 Ga0070672_100020502 3300005543 Bacteria 4822
54 Ga0070672_100455828 3300005543 Bacteria 1102
55 Ga0070672_101373371 3300005543 Bacteria 632
56 Ga0070686_100015151 3300005544 Bacteria 4458
57 Ga0070686_100049873 3300005544 Bacteria 2658
58 Ga0070696_100001337 3300005546 Bacteria 16067
59 Ga0070665_100016215 3300005548 Bacteria 7476
60 Ga0070665_100018545 3300005548 Bacteria 6973
61 Ga0070665_100065067 3300005548 Bacteria 3658
62 Ga0070704_100319343 3300005549 Bacteria 1301
63 Ga0068855_100396203 3300005563 Bacteria 1514
64 Ga0070664_100697035 3300005564 Bacteria 946
65 Ga0068857_100103568 3300005577 Bacteria 2555
66 Ga0068857_100187358 3300005577 Bacteria 1884
67 Ga0068857_100550184 3300005577 Bacteria 1087
68 Ga0068854_101019329 3300005578 Bacteria 734
69 Ga0070702_100031796 3300005615 Bacteria 2891
70 Ga0070702_100414010 3300005615 Bacteria 968
71 Ga0068859_100026706 3300005617 Bacteria 5791
72 Ga0068864_100124360 3300005618 Bacteria 2310
73 Ga0068864_101102163 3300005618 Bacteria 790
74 Ga0068861_100043460 3300005719 Bacteria 3373
75 Ga0068861_100198391 3300005719 Bacteria 1683
76 Ga0068870_10001522 3300005840 Bacteria 9402
77 Ga0068870_10040163 3300005840 Bacteria 2425
78 Ga0068870_10107963 3300005840 Bacteria 1584
79 Ga0068863_100074871 3300005841 Bacteria 3203
80 Ga0068863_100404106 3300005841 Bacteria 1336
81 Ga0068863_100502039 3300005841 Bacteria 1195
82 Ga0068863_101283177 3300005841 Bacteria 739
83 Ga0068860_100120908 3300005843 Bacteria 2507
84 Ga0068862_100055447 3300005844 Bacteria 3395
85 Ga0068862_100062279 3300005844 Bacteria 3208
86 Ga0068862_100806447 3300005844 Unclassified 917
87 Ga0097621_100006015 3300006237 Bacteria 8577
88 Ga0097621_100414476 3300006237 Bacteria 1208
89 Ga0068871_100024749 3300006358 Bacteria 4659
90 Ga0068871_100079250 3300006358 Bacteria 2717
91 Ga0068871_100174794 3300006358 Bacteria 1843
92 Ga0068865_100158545 3300006881 Bacteria 1724
93 Ga0068865_100471209 3300006881 Bacteria 1042
94 Ga0068865_100515691 3300006881 Bacteria 999
95 Ga0097620_100026702 3300006931 Bacteria 5791
96 Ga0099795_10000592 3300007788 Bacteria 6921
97 Ga0099795_10126952 3300007788 Bacteria 1025
98 Ga0105240_10366027 3300009093 Bacteria 1632
99 Ga0111539_10554544 3300009094 Bacteria 1338
100 Ga0111539_10800353 3300009094 Bacteria 1097
101 Ga0105245_10522411 3300009098 Bacteria 1206
102 Ga0105243_10837604 3300009148 Bacteria 910
103 Ga0105242_10535357 3300009176 Bacteria 1120
104 Ga0105249_10831326 3300009553 Bacteria 988
105 Ga0157369_10032288 3300013105 Bacteria 5760
106 Ga0163162_10352176 3300013306 Bacteria 1605
107 Ga0157375_10367261 3300013308 Bacteria 1605
108 Ga0157375_10685390 3300013308 Bacteria 1179
109 Ga0157375_11193477 3300013308 Bacteria 892
110 Ga0163163_10660174 3300014325 Bacteria 1109
111 Ga0157380_10038380 3300014326 Bacteria 3718
112 Ga0157380_10041564 3300014326 Bacteria 3588
113 Ga0157380_10042337 3300014326 Bacteria 3560
114 Ga0157380_10056154 3300014326 Bacteria 3130
115 Ga0157380_10184026 3300014326 Bacteria 1838
116 Ga0157380_10293009 3300014326 Bacteria 1495
117 Ga0157380_10365981 3300014326 Bacteria 1355
118 Ga0157380_10536333 3300014326 Bacteria 1145
119 Ga0157380_10568021 3300014326 Bacteria 1116
120 Ga0157380_10923291 3300014326 Bacteria 901
121 Ga0157377_10319585 3300014745 Bacteria 1031
122 Ga0157379_10419249 3300014968 Bacteria 1232
123 Ga0157376_10227551 3300014969 Bacteria 1731
124 Ga0207682_10003326 3300025893 Bacteria 7014
125 Ga0207682_10061173 3300025893 Bacteria 1576
126 Ga0207692_10052213 3300025898 Bacteria 2077
127 Ga0207645_10758947 3300025907 Bacteria 659
128 Ga0207643_10010744 3300025908 Bacteria 4934
129 Ga0207707_10559293 3300025912 Bacteria 971
130 Ga0207663_10116094 3300025916 Bacteria 1824
131 Ga0207652_10237294 3300025921 Bacteria 1643
132 Ga0207652_10372669 3300025921 Bacteria 1289
133 Ga0207681_10150507 3300025923 Bacteria 1743
134 Ga0207681_10154915 3300025923 Bacteria 1721
135 Ga0207659_10252052 3300025926 Bacteria 1433
136 Ga0207687_10939143 3300025927 Bacteria 741
137 Ga0207706_10078757 3300025933 Bacteria 2898
138 Ga0207670_10013986 3300025936 Bacteria 4751
139 Ga0207669_10049395 3300025937 Bacteria 2507
140 Ga0207704_10125373 3300025938 Bacteria 1767
141 Ga0207704_10307922 3300025938 Bacteria 1216
142 Ga0207691_10010683 3300025940 Bacteria 8812
143 Ga0207691_10021706 3300025940 Bacteria 6059
144 Ga0207691_10039556 3300025940 Bacteria 4362
145 Ga0207691_10173880 3300025940 Bacteria 1885
146 Ga0207689_10075753 3300025942 Bacteria 2766
147 Ga0207679_10446208 3300025945 Bacteria 1147
148 Ga0207679_10465724 3300025945 Bacteria 1123
149 Ga0207668_10075822 3300025972 Bacteria 2419
150 Ga0207640_10095331 3300025981 Bacteria 2072
151 Ga0207658_10423286 3300025986 Bacteria 1175
152 Ga0207703_10464540 3300026035 Bacteria 1184
153 Ga0207678_10434226 3300026067 Bacteria 1140
154 Ga0207708_10005974 3300026075 Bacteria 9017
155 Ga0207708_10027884 3300026075 Bacteria 4275
156 Ga0207708_10213514 3300026075 Bacteria 1543
157 Ga0207708_10821091 3300026075 Bacteria 801
158 Ga0207641_10132022 3300026088 Bacteria 2243
159 Ga0207641_10171413 3300026088 Bacteria 1981
160 Ga0207648_10049128 3300026089 Bacteria 3693
161 Ga0207676_10325220 3300026095 Bacteria 1413
162 Ga0207674_10175682 3300026116 Bacteria 2094
163 Ga0207675_100008026 3300026118 Bacteria 9945
164 Ga0207675_100101011 3300026118 Bacteria 2717
165 Ga0207675_100102965 3300026118 Bacteria 2690
166 Ga0207675_100204653 3300026118 Bacteria 1897
167 Ga0207675_100301819 3300026118 Bacteria 1560
168 Ga0207675_100306190 3300026118 Bacteria 1548
169 Ga0207675_100412232 3300026118 Bacteria 1333
170 Ga0207683_10084049 3300026121 Bacteria 2829
171 Ga0209179_1001770 3300027512 Bacteria 2752
172 Ga0207428_10611058 3300027907 Bacteria 785
173 Ga0268266_10005612 3300028379 Bacteria 11651
174 Ga0268266_10119325 3300028379 Bacteria 2345
175 Ga0268266_10440530 3300028379 Bacteria 1237
176 Ga0268266_11653881 3300028379 Bacteria 616
177 Ga0268265_10017166 3300028380 Bacteria 4988
178 Ga0268265_10124401 3300028380 Bacteria 2131
179 Ga0268265_10979404 3300028380 Bacteria 834
180 Ga0268265_11437838 3300028380 Bacteria 692
181 Ga0307515_10011189 3300028794 Bacteria 17061
182 Ga0265762_1026615 3300030760 Bacteria 1083
183 Ga0265770_1000555 3300030878 Bacteria 5177
184 Ga0265330_10089339 3300031235 Bacteria 1323
185 Ga0265340_10011859 3300031247 Bacteria 4617
186 Ga0265340_10059174 3300031247 Bacteria 1838
187 Ga0265339_10203639 3300031249 Bacteria 975
188 Ga0307513_10006471 3300031456 Bacteria 15294
189 Ga0307513_10020809 3300031456 Bacteria 7765
190 Ga0307513_10028436 3300031456 Bacteria 6393
191 Ga0307509_10076748 3300031507 Bacteria 3466
192 Ga0307509_10259347 3300031507 Bacteria 1515
193 Ga0307509_10456896 3300031507 Bacteria 970
194 Ga0265313_10110648 3300031595 Bacteria 1208
195 Ga0307508_10310475 3300031616 Bacteria 1169
196 Ga0307516_10002541 3300031730 Bacteria 24287
197 Ga0307405_10087835 3300031731 Bacteria 2050
198 Ga0307405_10349684 3300031731 Bacteria 1140
199 Ga0307405_10468317 3300031731 Bacteria 1003
200 Ga0307413_10006723 3300031824 Bacteria 5280
201 Ga0307413_10006746 3300031824 Bacteria 5272
202 Ga0307407_10104711 3300031903 Bacteria 1764
203 Ga0307407_10415115 3300031903 Bacteria 969
204 Ga0307409_100005443 3300031995 Bacteria 7329
205 Ga0307409_100064532 3300031995 Bacteria 2877
206 Ga0307409_101773703 3300031995 Bacteria 646
207 Ga0307416_100194748 3300032002 Bacteria 1916
208 Ga0307411_10008922 3300032005 Bacteria 5232
209 Ga0307411_10148478 3300032005 Bacteria 1739
210 Ga0307411_10435794 3300032005 Bacteria 1092
211 Ga0307415_100014895 3300032126 Bacteria 4589
212 Ga0373954_0191408 3300035118 Bacteria 1004
213 Ga0373956_0099187 3300035119 Bacteria 1350
214 Ga0373935_0079575 3300035692 Bacteria 2128
215 Ga0373933_0399394 3300035724 Bacteria 897
216 Ga0436363_0752909 3300039450 Bacteria 1334
217 Ga0436363_1010716 3300039450 Bacteria 870
218 Ga0439453_0056822 3300041408 Bacteria 802
219 Ga0451791_0329718 3300041451 Bacteria 4013
220 Ga0451791_1268287 3300041451 Bacteria 731
221 Ga0451793_1523312 3300041452 Bacteria 893
222 Ga0451797_0285029 3300041453 Bacteria 1572
223 Ga0451795_1672608 3300041456 Bacteria 870
224 Ga0451807_1073673 3300041486 Bacteria 2827
225 Ga0451833_0248770 3300041491 Bacteria 1190
226 Ga0451843_0681477 3300041509 Bacteria 1501
227 Ga0439435_0021091 3300042436 Bacteria 1687
228 Ga0453684_0480206 3300044712 Bacteria 1379
229 Ga0451576_0100643 3300045051 Bacteria 3005
230 Ga0495616_0013334 3300046513 Bacteria 4639
231 Ga0495630_0436803 3300046517 Bacteria 1003
232 Ga0495630_0872657 3300046517 Bacteria 686
233 Ga0495632_0060958 3300046519 Bacteria 1832
234 Ga0495632_0084702 3300046519 Bacteria 1508
235 Ga0495668_0024971 3300046616 Bacteria 3397
236 Ga0495625_0006321 3300046660 Bacteria 10590
237 Ga0495625_0073194 3300046660 Bacteria 2402
238 Ga0495625_0168368 3300046660 Bacteria 1464
239 Ga0495658_0295319 3300046683 Bacteria 1024
240 Ga0495671_0425525 3300046692 Bacteria 635
241 Ga0495649_0055467 3300046694 Bacteria 2141
242 Ga0496104_0004955 3300048907 Bacteria 11620
243 Ga0496105_0000824 3300048908 Bacteria 21051
244 Ga0496115_0010784 3300048918 Bacteria 6835
245 Ga0501031_0082292 3300049568 Bacteria 2099
246 Ga0501033_0503251 3300049570 Bacteria 838
247 Ga0501036_0010288 3300049572 Bacteria 7717
248 Ga0501036_0052826 3300049572 Bacteria 3442
249 Ga0501036_0404781 3300049572 Bacteria 1138
250 Ga0501037_0134283 3300049573 Bacteria 1773
251 Ga0501038_0007961 3300049574 Bacteria 9764
252 Ga0501039_0073595 3300049575 Bacteria 2654
253 Ga0501040_0000506 3300049576 Bacteria 23308
254 Ga0501041_0001039 3300049577 Bacteria 15205
255 Ga0501041_0064544 3300049577 Bacteria 2242
256 Ga0501042_0010924 3300049578 Bacteria 6113
257 Ga0501042_0016388 3300049578 Bacteria 5085
258 Ga0501043_0565216 3300049579 Bacteria 843
259 Ga0501046_0061697 3300049580 Bacteria 2930
260 Ga0501048_0012928 3300049582 Bacteria 6201
261 Ga0501067_0006151 3300049583 Bacteria 6654
262 Ga0501068_0016354 3300049584 Bacteria 4275
263 Ga0501068_0053281 3300049584 Bacteria 2449
264 Ga0501068_0645675 3300049584 Bacteria 691
265 Ga0501070_0045552 3300049586 Bacteria 3648
266 Ga0501070_0454251 3300049586 Bacteria 1033
267 Ga0501071_0005318 3300049587 Bacteria 8262
268 Ga0501071_0008201 3300049587 Bacteria 6893
269 Ga0501071_0010322 3300049587 Bacteria 6255
270 Ga0501072_0000762 3300049588 Bacteria 23505
271 Ga0501073_0076384 3300049589 Bacteria 2331
272 Ga0501074_0006201 3300049590 Bacteria 8628
273 Ga0501074_0048227 3300049590 Bacteria 3077
274 Ga0501075_0028698 3300049591 Bacteria 4108
275 Ga0501075_0033579 3300049591 Bacteria 3818
276 Ga0501076_0000455 3300049592 Bacteria 25918
277 Ga0501076_0040291 3300049592 Bacteria 3670
278 Ga0501076_0157836 3300049592 Bacteria 1847
279 Ga0501076_0243975 3300049592 Bacteria 1470
280 Ga0501077_0003704 3300049593 Bacteria 9194
281 Ga0501077_0006453 3300049593 Bacteria 7198
282 Ga0501077_0100963 3300049593 Bacteria 1828
283 Ga0501079_0029154 3300049741 Bacteria 4235
284 Ga0501079_0174675 3300049741 Bacteria 1675
285 Ga0501079_0307826 3300049741 Bacteria 1240
286 Ga0501080_0003588 3300049742 Bacteria 13662
287 Ga0501080_0007991 3300049742 Bacteria 9585
288 Ga0501081_0004707 3300049743 Bacteria 8773
289 Ga0501081_0142606 3300049743 Bacteria 1717
290 Ga0501035_0013438 3300049822 Bacteria 7557
291 Ga0501035_0775503 3300049822 Bacteria 768
292 Ga0501044_0398680 3300049823 Bacteria 1289
293 Ga0501045_0015566 3300049824 Bacteria 5396
294 nmdc:mga08y16_465474_c1 3300050511 Bacteria 1288
295 nmdc:mga08y16_534046_c1 3300050511 Bacteria 1188
296 nmdc:mga08y16_793592_c1 3300050511 Bacteria 940
297 Ga0495601_0187354 3300053077 Bacteria 1353
298 Ga0500583_0007248 3300053092 Bacteria 3887
299 Ga0500583_0023402 3300053092 Bacteria 2603
300 Ga0500641_0017201 3300053096 Bacteria 2701
301 Ga0500617_017139 3300053124 Bacteria 3137
302 Ga0500642_0042080 3300053130 Bacteria 1979
303 Ga0500658_0086698 3300053134 Bacteria 1347
304 Ga0500568_0032726 3300053139 Bacteria 2137
305 Ga0500616_0000030 3300053153 Bacteria 415224
306 Ga0501084_0002663 3300054114 Bacteria 14372
307 Ga0501084_0049981 3300054114 Bacteria 3500
308 Ga0501084_0050137 3300054114 Bacteria 3494
309 Ga0501084_0438846 3300054114 Bacteria 1104
310 Ga0501082_0000946 3300060353 Bacteria 25732
311 Ga0501082_0023652 3300060353 Bacteria 5299
312 Ga0501082_0195033 3300060353 Bacteria 1762
313 Ga0530510_0000123 3300061734 Bacteria 44505
314 Ga0530510_0013861 3300061734 Bacteria 5676
315 Ga0530510_0118829 3300061734 Bacteria 1940
316 Ga0500641_0029033
317 Ga0070690_100003154
318 Ga0070670_100042631
319 Ga0070670_100212611
320 Ga0070677_10007292
321 Ga0070677_10031142
322 Ga0068869_100307011
323 Ga0070682_100029128
324 Ga0070682_100083352
325 Ga0070682_100090984
326 Ga0070689_100023508
327 Ga0070689_100260331
328 Ga0070691_10346078
329 Ga0070668_100173363
330 Ga0070669_100145783
331 Ga0070669_100212859
332 Ga0070669_100252059
333 Ga0070675_100019317
334 Ga0070675_100218086
335 Ga0070675_100408347
336 Ga0070675_100849292
337 Ga0070671_100392815
338 Ga0070674_100037441
339 Ga0070674_100145881
340 Ga0070674_100257859
341 Ga0070673_100051355
342 Ga0070688_100054847
343 Ga0070688_100086283
344 Ga0070710_10058082
345 Ga0070710_10384428
346 Ga0070701_10004830
347 Ga0070711_100128873
348 Ga0070705_100006890
349 Ga0070700_100106165
350 Ga0070700_100556377
351 Ga0070700_100794308
352 Ga0070694_100008277
353 Ga0070678_100025275
354 Ga0070678_100263838
355 Ga0070678_100657414
356 Ga0070662_100169172
357 Ga0070681_10015740
358 Ga0070681_10642204
359 Ga0068867_101234077
360 Ga0070685_10184111
361 Ga0070685_10250536
362 Ga0070685_10962401
363 Ga0070698_100253555
364 Ga0070699_100078860
365 Ga0070679_100006129
366 Ga0070679_100135481
367 Ga0070672_100018483
368 Ga0070672_100020502
369 Ga0070672_100455828
370 Ga0070672_101373371
371 Ga0070686_100015151
372 Ga0070686_100049873
373 Ga0070696_100001337
374 Ga0070665_100016215
375 Ga0070665_100018545
376 Ga0070665_100065067
377 Ga0070704_100319343
378 Ga0068855_100396203
379 Ga0070664_100697035
380 Ga0068857_100103568
381 Ga0068857_100187358
382 Ga0068857_100550184
383 Ga0068854_101019329
384 Ga0070702_100031796
385 Ga0070702_100414010
386 Ga0068859_100026706
387 Ga0068864_100124360
388 Ga0068864_101102163
389 Ga0068861_100043460
390 Ga0068861_100198391
391 Ga0068870_10001522
392 Ga0068870_10040163
393 Ga0068870_10107963
394 Ga0068863_100074871
395 Ga0068863_100404106
396 Ga0068863_100502039
397 Ga0068863_101283177
398 Ga0068860_100120908
399 Ga0068862_100055447
400 Ga0068862_100062279
401 Ga0068862_100806447
402 Ga0097621_100006015
403 Ga0097621_100414476
404 Ga0068871_100024749
405 Ga0068871_100079250
406 Ga0068871_100174794
407 Ga0068865_100158545
408 Ga0068865_100471209
409 Ga0068865_100515691
410 Ga0097620_100026702
411 Ga0099795_10000592
412 Ga0099795_10126952
413 Ga0105240_10366027
414 Ga0111539_10554544
415 Ga0111539_10800353
416 Ga0105245_10522411
417 Ga0105243_10837604
418 Ga0105242_10535357
419 Ga0105249_10831326
420 Ga0157369_10032288
421 Ga0163162_10352176
422 Ga0157375_10367261
423 Ga0157375_10685390
424 Ga0157375_11193477
425 Ga0163163_10660174
426 Ga0157380_10038380
427 Ga0157380_10041564
428 Ga0157380_10042337
429 Ga0157380_10056154
430 Ga0157380_10184026
431 Ga0157380_10293009
432 Ga0157380_10365981
433 Ga0157380_10536333
434 Ga0157380_10568021
435 Ga0157380_10923291
436 Ga0157377_10319585
437 Ga0157379_10419249
438 Ga0157376_10227551
439 Ga0207682_10003326
440 Ga0207682_10061173
441 Ga0207692_10052213
442 Ga0207645_10758947
443 Ga0207643_10010744
444 Ga0207707_10559293
445 Ga0207663_10116094
446 Ga0207652_10237294
447 Ga0207652_10372669
448 Ga0207681_10150507
449 Ga0207681_10154915
450 Ga0207659_10252052
451 Ga0207687_10939143
452 Ga0207706_10078757
453 Ga0207670_10013986
454 Ga0207669_10049395
455 Ga0207704_10125373
456 Ga0207704_10307922
457 Ga0207691_10010683
458 Ga0207691_10021706
459 Ga0207691_10039556
460 Ga0207691_10173880
461 Ga0207689_10075753
462 Ga0207679_10446208
463 Ga0207679_10465724
464 Ga0207668_10075822
465 Ga0207640_10095331
466 Ga0207658_10423286
467 Ga0207703_10464540
468 Ga0207678_10434226
469 Ga0207708_10005974
470 Ga0207708_10027884
471 Ga0207708_10213514
472 Ga0207708_10821091
473 Ga0207641_10132022
474 Ga0207641_10171413
475 Ga0207648_10049128
476 Ga0207676_10325220
477 Ga0207674_10175682
478 Ga0207675_100008026
479 Ga0207675_100101011
480 Ga0207675_100102965
481 Ga0207675_100204653
482 Ga0207675_100301819
483 Ga0207675_100306190
484 Ga0207675_100412232
485 Ga0207683_10084049
486 Ga0209179_1001770
487 Ga0207428_10611058
488 Ga0268266_10005612
489 Ga0268266_10119325
490 Ga0268266_10440530
491 Ga0268266_11653881
492 Ga0268265_10017166
493 Ga0268265_10124401
494 Ga0268265_10979404
495 Ga0268265_11437838
496 Ga0307515_10011189
497 Ga0265762_1026615
498 Ga0265770_1000555
499 Ga0265330_10089339
500 Ga0265340_10011859
501 Ga0265340_10059174
502 Ga0265339_10203639
503 Ga0307513_10006471
504 Ga0307513_10020809
505 Ga0307513_10028436
506 Ga0307509_10076748
507 Ga0307509_10259347
508 Ga0307509_10456896
509 Ga0265313_10110648
510 Ga0307508_10310475
511 Ga0307516_10002541
512 Ga0307405_10087835
513 Ga0307405_10349684
514 Ga0307405_10468317
515 Ga0307413_10006723
516 Ga0307413_10006746
517 Ga0307407_10104711
518 Ga0307407_10415115
519 Ga0307409_100005443
520 Ga0307409_100064532
521 Ga0307409_101773703
522 Ga0307416_100194748
523 Ga0307411_10008922
524 Ga0307411_10148478
525 Ga0307411_10435794
526 Ga0307415_100014895
527 Ga0373954_0191408
528 Ga0373956_0099187
529 Ga0373935_0079575
530 Ga0373933_0399394
531 Ga0436363_0752909
532 Ga0436363_1010716
533 Ga0439453_0056822
534 Ga0451791_0329718
535 Ga0451791_1268287
536 Ga0451793_1523312
537 Ga0451797_0285029
538 Ga0451795_1672608
539 Ga0451807_1073673
540 Ga0451833_0248770
541 Ga0451843_0681477
542 Ga0439435_0021091
543 Ga0453684_0480206
544 Ga0451576_0100643
545 Ga0495616_0013334
546 Ga0495630_0436803
547 Ga0495630_0872657
548 Ga0495632_0060958
549 Ga0495632_0084702
550 Ga0495668_0024971
551 Ga0495625_0006321
552 Ga0495625_0073194
553 Ga0495625_0168368
554 Ga0495658_0295319
555 Ga0495671_0425525
556 Ga0495649_0055467
557 Ga0496104_0004955
558 Ga0496105_0000824
559 Ga0496115_0010784
560 Ga0501031_0082292
561 Ga0501033_0503251
562 Ga0501036_0010288
563 Ga0501036_0052826
564 Ga0501036_0404781
565 Ga0501037_0134283
566 Ga0501038_0007961
567 Ga0501039_0073595
568 Ga0501040_0000506
569 Ga0501041_0001039
570 Ga0501041_0064544
571 Ga0501042_0010924
572 Ga0501042_0016388
573 Ga0501043_0565216
574 Ga0501046_0061697
575 Ga0501048_0012928
576 Ga0501067_0006151
577 Ga0501068_0016354
578 Ga0501068_0053281
579 Ga0501068_0645675
580 Ga0501070_0045552
581 Ga0501070_0454251
582 Ga0501071_0005318
583 Ga0501071_0008201
584 Ga0501071_0010322
585 Ga0501072_0000762
586 Ga0501073_0076384
587 Ga0501074_0006201
588 Ga0501074_0048227
589 Ga0501075_0028698
590 Ga0501075_0033579
591 Ga0501076_0000455
592 Ga0501076_0040291
593 Ga0501076_0157836
594 Ga0501076_0243975
595 Ga0501077_0003704
596 Ga0501077_0006453
597 Ga0501077_0100963
598 Ga0501079_0029154
599 Ga0501079_0174675
600 Ga0501079_0307826
601 Ga0501080_0003588
602 Ga0501080_0007991
603 Ga0501081_0004707
604 Ga0501081_0142606
605 Ga0501035_0013438
606 Ga0501035_0775503
607 Ga0501044_0398680
608 Ga0501045_0015566
609 nmdc:mga08y16_465474_c1
610 nmdc:mga08y16_534046_c1
611 nmdc:mga08y16_793592_c1
612 Ga0495601_0187354
613 Ga0500583_0007248
614 Ga0500583_0023402
615 Ga0500641_0017201
616 Ga0500617_017139
617 Ga0500642_0042080
618 Ga0500658_0086698
619 Ga0500568_0032726
620 Ga0500616_0000030
621 Ga0501084_0002663
622 Ga0501084_0049981
623 Ga0501084_0050137
624 Ga0501084_0438846
625 Ga0501082_0000946
626 Ga0501082_0023652
627 Ga0501082_0195033
628 Ga0530510_0000123
629 Ga0530510_0013861
630 Ga0530510_0118829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04060

FeS

Putative Fe-S cluster

10

42

0.99

PF00037

Fer4

4Fe-4S binding domain

75

98

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c1n-assembly2.cif.gz_G corrinoid protein reactivation complex with activator 0.9424 5 59
4djf-assembly1.cif.gz_E crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant 0.7522 4 56
4aue-assembly1.cif.gz_C crystal structure, recombinant expression and mutagenesis studies of the bifunctional catalase-phenol oxidase from scytalidium thermophilum 0.3543 7 73
4c1n-assembly2.cif.gz_G corrinoid protein reactivation complex with activator 0.3361 5 59
4djf-assembly1.cif.gz_E crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant 0.2741 4 56
ID Description Score Start End Superfamily
4c1nC01 Mainly Alpha;Orthogonal Bundle;3-methyladenine DNA Glycosylase II; Chain A, domain 3;Electron transport complex subunit B, putative Fe-S cluster 0.9144 5 57 1.10.15.40
2yclA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.8856 5 57 3.20.20.20
4c1nC01 Mainly Alpha;Orthogonal Bundle;3-methyladenine DNA Glycosylase II; Chain A, domain 3;Electron transport complex subunit B, putative Fe-S cluster 0.8414 5 57 1.10.15.40
2yclA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.3168 5 57 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A2P0QLG7-F1-model_v4 Acetyl-CoA synthase gamma subunit (EC 2.1.1.245) 0.9781 4 45 GO:0008168
GO:0032259
GO:0046872
GO:0051539
AF-A0A536TKX1-F1-model_v4 RnfABCDGE type electron transport complex subunit B 0.9776 7 58 GO:0009055
GO:0046872
GO:0051539
AF-A0A7U9IDU1-F1-model_v4 deleted 0.9752 7 66
AF-A0A3D0M7F5-F1-model_v4 Ion-translocating oxidoreductase complex subunit B (EC 7.-.-.-) (Rnf electron transport complex subunit B) 0.9744 7 63 GO:0005886
GO:0009055
GO:0022900
GO:0046872
GO:0051539
AF-A0A388TD98-F1-model_v4 Ion-translocating oxidoreductase complex subunit B (EC 7.-.-.-) (Rnf electron transport complex subunit B) 0.9734 7 64 GO:0005886
GO:0009055
GO:0022900
GO:0046872
GO:0051539

Map