F403402

General Info

Members Datasets Scaffolds Average Seq Length
315 187 315 133

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_38482_c1|nmdc:mga06r32_38482_c1_1569_2021
Length 150
Sequence MPRAFDVPRGAPAVRLRTPVSDYAIKRLEEIPDVLGDYPGEMRMTAASDLGTEQISFTWRRMPPQTGGKGSYGHRHKTQEEIYFVASGELLFKLEDEVIEVPAGSIVRIAPQVVRSVWNDGPEDAVLIMCSIKSDDPSGDHETVPDFWPE

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 9.21
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10082559 3300002077 Bacteria 588
2 JGI25406J46586_10027831 3300003203 Bacteria 2161
3 JGI25407J50210_10003224 3300003373 Bacteria 3882
4 JGI25407J50210_10021618 3300003373 Bacteria 1672
5 JGI25407J50210_10044627 3300003373 Unclassified 1131
6 JGI25407J50210_10054744 3300003373 Bacteria 1008
7 Ga0070682_100041021 3300005337 Bacteria 2851
8 Ga0068868_100183955 3300005338 Bacteria 1735
9 Ga0068868_100748614 3300005338 Bacteria 878
10 Ga0070692_10065799 3300005345 Bacteria 1920
11 Ga0070668_100396931 3300005347 Bacteria 1177
12 Ga0070668_100982294 3300005347 Unclassified 758
13 Ga0070675_100786720 3300005354 Bacteria 869
14 Ga0070671_100545022 3300005355 Bacteria 1000
15 Ga0070674_100350619 3300005356 Bacteria 1192
16 Ga0070688_100272043 3300005365 Bacteria 1214
17 Ga0070659_100048395 3300005366 Bacteria 3340
18 Ga0070667_100537895 3300005367 Bacteria 1073
19 Ga0070709_10607048 3300005434 Bacteria 843
20 Ga0070709_10928740 3300005434 Unclassified 689
21 Ga0070710_10218083 3300005437 Unclassified 1212
22 Ga0070705_100195650 3300005440 Bacteria 1382
23 Ga0070694_100386072 3300005444 Bacteria 1093
24 Ga0070694_100573892 3300005444 Bacteria 905
25 Ga0070663_100111751 3300005455 Bacteria 2054
26 Ga0070678_100033949 3300005456 Bacteria 3548
27 Ga0068867_100681588 3300005459 Unclassified 905
28 Ga0070679_100585663 3300005530 Bacteria 1059
29 Ga0070684_100311309 3300005535 Bacteria 1446
30 Ga0068853_101958836 3300005539 Bacteria 568
31 Ga0070695_100613590 3300005545 Unclassified 855
32 Ga0068857_100463077 3300005577 Bacteria 1187
33 Ga0068854_100630949 3300005578 Bacteria 918
34 Ga0070702_100255909 3300005615 Bacteria 1189
35 Ga0070702_101373559 3300005615 Unclassified 576
36 Ga0068852_100700649 3300005616 Bacteria 1023
37 Ga0068866_10978217 3300005718 Bacteria 600
38 Ga0068861_100520718 3300005719 Bacteria 1078
39 Ga0068861_101300763 3300005719 Unclassified 707
40 Ga0081455_10097521 3300005937 Bacteria 2368
41 Ga0081538_10000173 3300005981 Bacteria 69480
42 Ga0081538_10000206 3300005981 Bacteria 65455
43 Ga0081538_10000500 3300005981 Bacteria 43814
44 Ga0081538_10001017 3300005981 Bacteria 29941
45 Ga0081538_10012481 3300005981 Bacteria 6807
46 Ga0081538_10037987 3300005981 Bacteria 3113
47 Ga0081538_10044259 3300005981 Bacteria 2780
48 Ga0081538_10066181 3300005981 Bacteria 2028
49 Ga0081538_10122155 3300005981 Unclassified 1248
50 Ga0081538_10270595 3300005981 Unclassified 636
51 Ga0081539_10003833 3300005985 Bacteria 17661
52 Ga0081539_10109602 3300005985 Bacteria 1392
53 Ga0075363_100109899 3300006048 Bacteria 1532
54 Ga0075364_10096035 3300006051 Bacteria 1971
55 Ga0070716_100038698 3300006173 Bacteria 2642
56 Ga0070712_100010878 3300006175 Bacteria 5756
57 Ga0070712_100531485 3300006175 Bacteria 989
58 Ga0075367_10453937 3300006178 Bacteria 812
59 Ga0075428_100137137 3300006844 Bacteria 2660
60 Ga0075428_100218049 3300006844 Bacteria 2061
61 Ga0075428_100675854 3300006844 Unclassified 1100
62 Ga0075430_100141444 3300006846 Bacteria 2004
63 Ga0075430_100346013 3300006846 Unclassified 1228
64 Ga0075431_100091594 3300006847 Bacteria 3138
65 Ga0075431_100389286 3300006847 Unclassified 1397
66 Ga0068865_100637552 3300006881 Bacteria 904
67 Ga0068865_101460950 3300006881 Bacteria 612
68 Ga0075435_100764898 3300007076 Unclassified 840
69 Ga0111539_10262012 3300009094 Bacteria 2012
70 Ga0111539_12115485 3300009094 Bacteria 653
71 Ga0105245_10030532 3300009098 Bacteria 4766
72 Ga0114129_10012136 3300009147 Bacteria 12266
73 Ga0114129_10218514 3300009147 Bacteria 2573
74 Ga0114129_11428616 3300009147 Bacteria 853
75 Ga0114129_11648882 3300009147 Bacteria 784
76 Ga0105243_10141833 3300009148 Bacteria 2051
77 Ga0105243_10861881 3300009148 Bacteria 898
78 Ga0105248_11260099 3300009177 Bacteria 836
79 Ga0105238_10890055 3300009551 Bacteria 908
80 Ga0105249_10275274 3300009553 Bacteria 1678
81 Ga0105239_10476002 3300010375 Bacteria 1418
82 Ga0105239_12209337 3300010375 Bacteria 640
83 Ga0157374_10173368 3300013296 Bacteria 2105
84 Ga0157375_10039830 3300013308 Bacteria 4525
85 Ga0157380_10955201 3300014326 Bacteria 887
86 Ga0157380_12367077 3300014326 Unclassified 596
87 Ga0157376_10169107 3300014969 Bacteria 1989
88 Ga0213875_10150978 3300021388 Bacteria 1089
89 Ga0207699_10722764 3300025906 Unclassified 730
90 Ga0207693_10012159 3300025915 Bacteria 6954
91 Ga0207693_10905346 3300025915 Bacteria 677
92 Ga0207657_10430062 3300025919 Bacteria 1037
93 Ga0207646_10620052 3300025922 Bacteria 970
94 Ga0207694_10849301 3300025924 Bacteria 772
95 Ga0207687_10033328 3300025927 Bacteria 3493
96 Ga0207687_10384598 3300025927 Bacteria 1150
97 Ga0207644_10269512 3300025931 Bacteria 1364
98 Ga0207690_10085377 3300025932 Bacteria 2216
99 Ga0207709_10247675 3300025935 Bacteria 1300
100 Ga0207709_10275227 3300025935 Bacteria 1241
101 Ga0207709_10397783 3300025935 Bacteria 1052
102 Ga0207704_10119946 3300025938 Bacteria 1797
103 Ga0207704_10534124 3300025938 Bacteria 951
104 Ga0207704_10769521 3300025938 Bacteria 802
105 Ga0207661_10834072 3300025944 Bacteria 849
106 Ga0207661_10939399 3300025944 Unclassified 797
107 Ga0207661_11803646 3300025944 Unclassified 557
108 Ga0207679_10335987 3300025945 Unclassified 1312
109 Ga0207668_10846605 3300025972 Bacteria 812
110 Ga0207668_10939024 3300025972 Unclassified 771
111 Ga0207640_10732797 3300025981 Bacteria 851
112 Ga0207658_10562262 3300025986 Bacteria 1022
113 Ga0207677_10173111 3300026023 Bacteria 1690
114 Ga0207708_10092418 3300026075 Bacteria 2335
115 Ga0207702_11665376 3300026078 Bacteria 631
116 Ga0207648_10683558 3300026089 Bacteria 950
117 Ga0207675_101495251 3300026118 Bacteria 696
118 Ga0207698_10950657 3300026142 Bacteria 868
119 Ga0207698_12707242 3300026142 Bacteria 505
120 Ga0207428_10315219 3300027907 Bacteria 1156
121 Ga0265326_10000028 3300028558 Bacteria 107913
122 Ga0265319_1012823 3300028563 Bacteria 3367
123 Ga0265334_10000040 3300028573 Bacteria 100264
124 Ga0265336_10010521 3300028666 Bacteria 3168
125 Ga0265338_10005183 3300028800 Bacteria 17113
126 Ga0265338_10093927 3300028800 Bacteria 2469
127 Ga0265324_10000572 3300029957 Bacteria 25178
128 Ga0265327_10026759 3300031251 Bacteria 3334
129 Ga0307408_100078364 3300031548 Bacteria 2463
130 Ga0307405_10616577 3300031731 Bacteria 888
131 Ga0307405_12083045 3300031731 Bacteria 509
132 Ga0307413_10354481 3300031824 Bacteria 1133
133 Ga0307410_10142828 3300031852 Bacteria 1773
134 Ga0307410_10497055 3300031852 Bacteria 1003
135 Ga0326468_10029944 3300031889 Unclassified 714
136 Ga0307406_10583615 3300031901 Unclassified 919
137 Ga0307406_10617095 3300031901 Bacteria 896
138 Ga0307406_11747435 3300031901 Bacteria 552
139 Ga0307407_10160896 3300031903 Unclassified 1469
140 Ga0307407_10338949 3300031903 Bacteria 1061
141 Ga0307412_10131137 3300031911 Bacteria 1821
142 Ga0307409_100051006 3300031995 Bacteria 3164
143 Ga0307409_100231858 3300031995 Unclassified 1674
144 Ga0307409_100292314 3300031995 Bacteria 1511
145 Ga0307409_100440534 3300031995 Bacteria 1255
146 Ga0307409_100858548 3300031995 Unclassified 919
147 Ga0307409_102785905 3300031995 Bacteria 517
148 Ga0307416_100001564 3300032002 Bacteria 12539
149 Ga0307416_100394903 3300032002 Unclassified 1418
150 Ga0307414_10685923 3300032004 Bacteria 926
151 Ga0307411_10188598 3300032005 Bacteria 1572
152 Ga0307411_10204952 3300032005 Bacteria 1518
153 Ga0307411_10321899 3300032005 Bacteria 1249
154 Ga0307411_10527835 3300032005 Bacteria 1003
155 Ga0307415_100101705 3300032126 Bacteria 2110
156 Ga0307415_100406750 3300032126 Bacteria 1164
157 Ga0307415_100534772 3300032126 Bacteria 1031
158 Ga0307415_100581398 3300032126 Bacteria 993
159 Ga0307415_100879448 3300032126 Unclassified 824
160 Ga0307415_102568373 3300032126 Bacteria 502
161 Ga0373945_0270243 3300035116 Bacteria 722
162 Ga0373943_0021208 3300035170 Bacteria 2998
163 Ga0373946_0258189 3300035171 Bacteria 852
164 Ga0373935_0092716 3300035692 Bacteria 1980
165 Ga0373935_1006864 3300035692 Bacteria 619
166 Ga0373927_0072659 3300035695 Bacteria 2227
167 Ga0373947_0553814 3300035725 Bacteria 783
168 Ga0316584_0162721 3300036712 Bacteria 1657
169 Ga0373925_0008758 3300037068 Bacteria 7370
170 Ga0395898_1665168 3300037466 Bacteria 561
171 Ga0395905_1898762 3300037471 Bacteria 502
172 Ga0436364_0859422 3300037853 Unclassified 942
173 Ga0436364_1106798 3300037853 Unclassified 1494
174 Ga0451789_0079003 3300041443 Bacteria 501
175 Ga0451853_0624638 3300041512 Unclassified 914
176 Ga0451853_2993449 3300041512 Unclassified 507
177 Ga0439459_0037377 3300042438 Bacteria 1017
178 Ga0466963_0017632 3300044694 Bacteria 4453
179 Ga0466963_0036193 3300044694 Bacteria 3219
180 Ga0466963_0109319 3300044694 Bacteria 1897
181 Ga0466963_0303945 3300044694 Bacteria 1122
182 Ga0466963_0528053 3300044694 Unclassified 833
183 Ga0466971_0423093 3300044719 Bacteria 651
184 Ga0466957_0401559 3300044842 Unclassified 937
185 Ga0466957_0932702 3300044842 Bacteria 621
186 Ga0466960_0084385 3300044901 Bacteria 1607
187 Ga0466958_0280673 3300045836 Bacteria 1067
188 Ga0466958_1018299 3300045836 Unclassified 540
189 Ga0466967_0072059 3300045976 Bacteria 3095
190 Ga0466967_0100289 3300045976 Bacteria 2645
191 Ga0466967_0190083 3300045976 Bacteria 1940
192 Ga0466967_0224367 3300045976 Bacteria 1787
193 Ga0466967_0311205 3300045976 Bacteria 1517
194 Ga0466967_0334237 3300045976 Bacteria 1463
195 Ga0466967_0507654 3300045976 Bacteria 1184
196 Ga0466967_0533790 3300045976 Bacteria 1154
197 Ga0466967_0601132 3300045976 Bacteria 1086
198 Ga0466967_0687345 3300045976 Unclassified 1013
199 Ga0466967_0791658 3300045976 Bacteria 941
200 Ga0466967_1423651 3300045976 Bacteria 690
201 Ga0495603_0135237 3300046455 Unclassified 1435
202 Ga0495641_0487923 3300046461 Bacteria 561
203 Ga0495580_0151086 3300046472 Bacteria 1609
204 Ga0495582_0212929 3300046473 Bacteria 1105
205 Ga0495582_0565844 3300046473 Bacteria 658
206 Ga0495584_0135343 3300046491 Bacteria 1251
207 Ga0495584_0380872 3300046491 Unclassified 717
208 Ga0495594_0053156 3300046499 Bacteria 2231
209 Ga0495596_0016288 3300046500 Bacteria 3091
210 Ga0495596_0119329 3300046500 Unclassified 1024
211 Ga0495607_0520451 3300046501 Unclassified 525
212 Ga0495630_0363036 3300046517 Unclassified 1109
213 Ga0495609_0304932 3300046538 Unclassified 648
214 Ga0495622_0243810 3300046557 Bacteria 792
215 Ga0495635_0377947 3300046663 Unclassified 943
216 Ga0495588_0607311 3300046674 Bacteria 573
217 Ga0495658_0175432 3300046683 Bacteria 1328
218 Ga0495671_0572818 3300046692 Unclassified 537
219 Ga0495581_0390083 3300047315 Bacteria 813
220 Ga0495676_0037312 3300047321 Bacteria 4046
221 Ga0495614_0625719 3300048089 Bacteria 518
222 Ga0496100_0145375 3300048903 Bacteria 1685
223 Ga0496100_0767349 3300048903 Bacteria 755
224 Ga0496101_0000699 3300048904 Bacteria 20164
225 Ga0496101_0028349 3300048904 Bacteria 3908
226 Ga0496102_0002436 3300048905 Bacteria 15872
227 Ga0496102_0053934 3300048905 Bacteria 3665
228 Ga0496102_0687245 3300048905 Bacteria 946
229 Ga0496103_0002655 3300048906 Bacteria 11191
230 Ga0496104_0025483 3300048907 Bacteria 5451
231 Ga0496105_0002713 3300048908 Bacteria 12912
232 Ga0496106_0006628 3300048909 Bacteria 8572
233 Ga0496106_0026494 3300048909 Bacteria 4318
234 Ga0496107_0007914 3300048910 Bacteria 7333
235 Ga0496108_1033618 3300048911 Bacteria 700
236 Ga0496108_1409752 3300048911 Unclassified 582
237 Ga0496108_1414146 3300048911 Bacteria 581
238 Ga0496109_1329808 3300048912 Bacteria 654
239 Ga0496110_0021684 3300048913 Bacteria 5443
240 Ga0496110_0138248 3300048913 Bacteria 2202
241 Ga0496111_0001594 3300048914 Bacteria 13116
242 Ga0496111_0100855 3300048914 Bacteria 2121
243 Ga0496112_0102671 3300048915 Bacteria 2829
244 Ga0496112_0156387 3300048915 Bacteria 2247
245 Ga0496112_1342056 3300048915 Bacteria 630
246 Ga0496112_1423294 3300048915 Bacteria 608
247 Ga0496114_0005778 3300048917 Bacteria 9716
248 Ga0496114_0642737 3300048917 Bacteria 934
249 Ga0496115_0006079 3300048918 Bacteria 8817
250 Ga0501031_0260769 3300049568 Bacteria 1126
251 Ga0501032_0461561 3300049569 Bacteria 813
252 Ga0501036_0098897 3300049572 Bacteria 2467
253 Ga0501036_0117413 3300049572 Bacteria 2247
254 Ga0501036_1659775 3300049572 Bacteria 515
255 Ga0501038_0207347 3300049574 Bacteria 1570
256 Ga0501038_1383106 3300049574 Unclassified 506
257 Ga0501039_0182938 3300049575 Bacteria 1648
258 Ga0501039_1195105 3300049575 Bacteria 588
259 Ga0501040_0019875 3300049576 Bacteria 4470
260 Ga0501040_0037855 3300049576 Bacteria 3279
261 Ga0501040_0840863 3300049576 Bacteria 664
262 Ga0501041_0191841 3300049577 Bacteria 1280
263 Ga0501042_0012899 3300049578 Bacteria 5676
264 Ga0501042_0059806 3300049578 Bacteria 2721
265 Ga0501042_0924598 3300049578 Bacteria 635
266 Ga0501046_0151557 3300049580 Bacteria 1749
267 Ga0501046_0647670 3300049580 Bacteria 747
268 Ga0501048_0106596 3300049582 Bacteria 1978
269 Ga0501048_0368996 3300049582 Bacteria 1024
270 Ga0501067_0040957 3300049583 Bacteria 2573
271 Ga0501067_0233842 3300049583 Bacteria 1023
272 Ga0501068_0085203 3300049584 Bacteria 1945
273 Ga0501068_0419346 3300049584 Bacteria 864
274 Ga0501068_0927364 3300049584 Bacteria 573
275 Ga0501071_0052321 3300049587 Bacteria 2945
276 Ga0501071_0085756 3300049587 Bacteria 2309
277 Ga0501071_1311193 3300049587 Unclassified 559
278 Ga0501072_0397518 3300049588 Bacteria 1093
279 Ga0501072_0779477 3300049588 Bacteria 749
280 Ga0501075_0038373 3300049591 Bacteria 3581
281 Ga0501075_0219934 3300049591 Bacteria 1449
282 Ga0501076_0006605 3300049592 Bacteria 8411
283 Ga0501077_0130383 3300049593 Bacteria 1594
284 Ga0501079_0071626 3300049741 Bacteria 2678
285 Ga0501079_0109805 3300049741 Bacteria 2142
286 Ga0501079_0161516 3300049741 Bacteria 1747
287 Ga0501079_0824959 3300049741 Bacteria 730
288 Ga0501080_0183496 3300049742 Bacteria 1925
289 Ga0501081_0021974 3300049743 Bacteria 4264
290 Ga0501081_0055792 3300049743 Bacteria 2730
291 Ga0501083_0520791 3300049744 Bacteria 774
292 Ga0501035_0084998 3300049822 Bacteria 2790
293 Ga0501035_0925397 3300049822 Bacteria 689
294 Ga0501044_0930945 3300049823 Bacteria 743
295 Ga0501045_0053733 3300049824 Bacteria 2944
296 Ga0501045_0083336 3300049824 Bacteria 2359
297 Ga0501045_1084895 3300049824 Bacteria 586
298 nmdc:mga03n38_719314_c1 3300050490 Unclassified 576
299 nmdc:mga03n38_79911_c1 3300050490 Bacteria 1534
300 nmdc:mga06z11_489858_c1 3300050494 Bacteria 744
301 nmdc:mga05p37_53604_c1 3300050507 Bacteria 4960
302 nmdc:mga05p37_551777_c1 3300050507 Bacteria 1311
303 nmdc:mga0qj67_132068_c1 3300050509 Bacteria 2022
304 nmdc:mga06r32_38482_c1 3300050510 Bacteria 4532
305 nmdc:mga06r32_517018_c1 3300050510 Unclassified 1170
306 nmdc:mga08y16_106108_c1 3300050511 Bacteria 2924
307 nmdc:mga0rr50_738527_c1 3300050513 Unclassified 840
308 Ga0495612_0333078 3300053078 Bacteria 684
309 Ga0495655_0192802 3300053083 Bacteria 663
310 Ga0501084_0216872 3300054114 Bacteria 1614
311 Ga0501084_0368975 3300054114 Bacteria 1213
312 Ga0501084_0623692 3300054114 Bacteria 911
313 Ga0501082_0027534 3300060353 Bacteria 4893
314 Ga0501082_1144558 3300060353 Bacteria 680
315 Ga0530510_0036238 3300061734 Bacteria 3556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10607048 Ga0070709_106070482 106
2 3300026078 Ga0207702_11665376 Ga0207702_116653761 115
3 3300005530 Ga0070679_100585663 Ga0070679_1005856631 116
4 3300005981 Ga0081538_10066181 Ga0081538_100661812 122
5 3300026142 Ga0207698_12707242 Ga0207698_127072421 127
6 3300003203 JGI25406J46586_10027831 JGI25406J46586_100278315 129
7 3300005338 Ga0068868_100748614 Ga0068868_1007486141 129
8 3300005535 Ga0070684_100311309 Ga0070684_1003113091 129
9 3300005578 Ga0068854_100630949 Ga0068854_1006309492 129
10 3300005981 Ga0081538_10012481 Ga0081538_100124815 129
11 3300005981 Ga0081538_10037987 Ga0081538_100379876 129
12 3300005981 Ga0081538_10122155 Ga0081538_101221551 129
13 3300005985 Ga0081539_10003833 Ga0081539_1000383314 129
14 3300005985 Ga0081539_10109602 Ga0081539_101096023 129
15 3300009148 Ga0105243_10861881 Ga0105243_108618811 129
16 3300009551 Ga0105238_10890055 Ga0105238_108900552 129
17 3300010375 Ga0105239_12209337 Ga0105239_122093372 129
18 3300014326 Ga0157380_10955201 Ga0157380_109552011 129
19 3300014326 Ga0157380_12367077 Ga0157380_123670772 129
20 3300021388 Ga0213875_10150978 Ga0213875_101509782 129
21 3300025924 Ga0207694_10849301 Ga0207694_108493011 129
22 3300025981 Ga0207640_10732797 Ga0207640_107327971 129
23 3300031852 Ga0307410_10497055 Ga0307410_104970551 129
24 3300031889 Ga0326468_10029944 Ga0326468_100299441 129
25 3300031901 Ga0307406_11747435 Ga0307406_117474351 129
26 3300031995 Ga0307409_100440534 Ga0307409_1004405342 129
27 3300032005 Ga0307411_10204952 Ga0307411_102049522 129
28 3300032126 Ga0307415_100101705 Ga0307415_1001017051 129
29 3300032126 Ga0307415_100406750 Ga0307415_1004067502 129
30 3300037853 Ga0436364_0859422 Ga0436364_0859422_495_899 129
31 3300037853 Ga0436364_1106798 Ga0436364_1106798_1011_1415 129
32 3300041443 Ga0451789_0079003 Ga0451789_0079003_13_402 129
33 3300041512 Ga0451853_0624638 Ga0451853_0624638_174_578 129
34 3300042438 Ga0439459_0037377 Ga0439459_0037377_246_650 129
35 3300044694 Ga0466963_0528053 Ga0466963_0528053_186_602 129
36 3300044842 Ga0466957_0932702 Ga0466957_0932702_186_593 129
37 3300044901 Ga0466960_0084385 Ga0466960_0084385_975_1388 129
38 3300045836 Ga0466958_1018299 Ga0466958_1018299_56_463 129
39 3300045976 Ga0466967_0072059 Ga0466967_0072059_2209_2613 129
40 3300045976 Ga0466967_0224367 Ga0466967_0224367_920_1333 129
41 3300045976 Ga0466967_0533790 Ga0466967_0533790_120_515 129
42 3300047321 Ga0495676_0037312 Ga0495676_0037312_2317_2730 129
43 3300048903 Ga0496100_0767349 Ga0496100_0767349_204_614 129
44 3300048905 Ga0496102_0053934 Ga0496102_0053934_2025_2435 129
45 3300048909 Ga0496106_0026494 Ga0496106_0026494_2692_3102 129
46 3300048911 Ga0496108_1033618 Ga0496108_1033618_183_593 129
47 3300048913 Ga0496110_0138248 Ga0496110_0138248_1771_2181 129
48 3300048914 Ga0496111_0100855 Ga0496111_0100855_505_915 129
49 3300048915 Ga0496112_1423294 Ga0496112_1423294_92_502 129
50 3300048917 Ga0496114_0642737 Ga0496114_0642737_400_810 129
51 3300049568 Ga0501031_0260769 Ga0501031_0260769_474_866 129
52 3300049569 Ga0501032_0461561 Ga0501032_0461561_282_674 129
53 3300049572 Ga0501036_0098897 Ga0501036_0098897_933_1337 129
54 3300049572 Ga0501036_0117413 Ga0501036_0117413_1312_1704 129
55 3300049572 Ga0501036_1659775 Ga0501036_1659775_99_491 129
56 3300049574 Ga0501038_0207347 Ga0501038_0207347_315_707 129
57 3300049575 Ga0501039_0182938 Ga0501039_0182938_326_718 129
58 3300049576 Ga0501040_0019875 Ga0501040_0019875_1240_1632 129
59 3300049576 Ga0501040_0037855 Ga0501040_0037855_1781_2185 129
60 3300049576 Ga0501040_0840863 Ga0501040_0840863_37_429 129
61 3300049577 Ga0501041_0191841 Ga0501041_0191841_445_837 129
62 3300049578 Ga0501042_0012899 Ga0501042_0012899_1726_2130 129
63 3300049578 Ga0501042_0059806 Ga0501042_0059806_1317_1709 129
64 3300049580 Ga0501046_0151557 Ga0501046_0151557_1230_1634 129
65 3300049582 Ga0501048_0106596 Ga0501048_0106596_949_1341 129
66 3300049582 Ga0501048_0368996 Ga0501048_0368996_89_481 129
67 3300049584 Ga0501068_0085203 Ga0501068_0085203_850_1254 129
68 3300049584 Ga0501068_0419346 Ga0501068_0419346_208_600 129
69 3300049587 Ga0501071_0052321 Ga0501071_0052321_1574_1966 129
70 3300049587 Ga0501071_0085756 Ga0501071_0085756_1160_1564 129
71 3300049588 Ga0501072_0397518 Ga0501072_0397518_24_416 129
72 3300049588 Ga0501072_0779477 Ga0501072_0779477_226_618 129
73 3300049591 Ga0501075_0038373 Ga0501075_0038373_2087_2491 129
74 3300049591 Ga0501075_0219934 Ga0501075_0219934_947_1339 129
75 3300049592 Ga0501076_0006605 Ga0501076_0006605_3310_3714 129
76 3300049593 Ga0501077_0130383 Ga0501077_0130383_81_473 129
77 3300049741 Ga0501079_0071626 Ga0501079_0071626_1268_1660 129
78 3300049741 Ga0501079_0109805 Ga0501079_0109805_1360_1764 129
79 3300049742 Ga0501080_0183496 Ga0501080_0183496_84_488 129
80 3300049743 Ga0501081_0021974 Ga0501081_0021974_996_1400 129
81 3300049743 Ga0501081_0055792 Ga0501081_0055792_1330_1722 129
82 3300049744 Ga0501083_0520791 Ga0501083_0520791_84_488 129
83 3300049822 Ga0501035_0084998 Ga0501035_0084998_987_1391 129
84 3300049822 Ga0501035_0925397 Ga0501035_0925397_253_645 129
85 3300049823 Ga0501044_0930945 Ga0501044_0930945_326_730 129
86 3300049824 Ga0501045_0053733 Ga0501045_0053733_1441_1845 129
87 3300049824 Ga0501045_1084895 Ga0501045_1084895_80_472 129
88 3300054114 Ga0501084_0216872 Ga0501084_0216872_935_1339 129
89 3300054114 Ga0501084_0368975 Ga0501084_0368975_73_465 129
90 3300060353 Ga0501082_0027534 Ga0501082_0027534_1142_1546 129
91 3300060353 Ga0501082_1144558 Ga0501082_1144558_88_480 129
92 3300061734 Ga0530510_0036238 Ga0530510_0036238_3070_3462 129
93 3300003373 JGI25407J50210_10003224 JGI25407J50210_100032244 130
94 3300003373 JGI25407J50210_10021618 JGI25407J50210_100216184 130
95 3300003373 JGI25407J50210_10044627 JGI25407J50210_100446272 130
96 3300003373 JGI25407J50210_10054744 JGI25407J50210_100547442 130
97 3300005345 Ga0070692_10065799 Ga0070692_100657993 130
98 3300005347 Ga0070668_100396931 Ga0070668_1003969312 130
99 3300005355 Ga0070671_100545022 Ga0070671_1005450221 130
100 3300005356 Ga0070674_100350619 Ga0070674_1003506192 130
101 3300005366 Ga0070659_100048395 Ga0070659_1000483953 130
102 3300005367 Ga0070667_100537895 Ga0070667_1005378952 130
103 3300005437 Ga0070710_10218083 Ga0070710_102180832 130
104 3300005444 Ga0070694_100573892 Ga0070694_1005738921 130
105 3300005455 Ga0070663_100111751 Ga0070663_1001117512 130
106 3300005459 Ga0068867_100681588 Ga0068867_1006815882 130
107 3300005577 Ga0068857_100463077 Ga0068857_1004630773 130
108 3300005615 Ga0070702_101373559 Ga0070702_1013735591 130
109 3300005616 Ga0068852_100700649 Ga0068852_1007006492 130
110 3300005718 Ga0068866_10978217 Ga0068866_109782172 130
111 3300005719 Ga0068861_100520718 Ga0068861_1005207182 130
112 3300005719 Ga0068861_101300763 Ga0068861_1013007631 130
113 3300005937 Ga0081455_10097521 Ga0081455_100975213 130
114 3300005981 Ga0081538_10000173 Ga0081538_1000017319 130
115 3300005981 Ga0081538_10000206 Ga0081538_1000020621 130
116 3300005981 Ga0081538_10000500 Ga0081538_1000050026 130
117 3300005981 Ga0081538_10001017 Ga0081538_100010175 130
118 3300005981 Ga0081538_10044259 Ga0081538_100442594 130
119 3300005981 Ga0081538_10270595 Ga0081538_102705951 130
120 3300006175 Ga0070712_100531485 Ga0070712_1005314852 130
121 3300006178 Ga0075367_10453937 Ga0075367_104539372 130
122 3300006844 Ga0075428_100137137 Ga0075428_1001371372 130
123 3300006844 Ga0075428_100218049 Ga0075428_1002180493 130
124 3300006844 Ga0075428_100675854 Ga0075428_1006758542 130
125 3300006846 Ga0075430_100141444 Ga0075430_1001414443 130
126 3300006846 Ga0075430_100346013 Ga0075430_1003460132 130
127 3300006847 Ga0075431_100091594 Ga0075431_1000915943 130
128 3300006847 Ga0075431_100389286 Ga0075431_1003892863 130
129 3300006881 Ga0068865_101460950 Ga0068865_1014609502 130
130 3300009094 Ga0111539_10262012 Ga0111539_102620122 130
131 3300009094 Ga0111539_12115485 Ga0111539_121154851 130
132 3300009147 Ga0114129_10012136 Ga0114129_100121366 130
133 3300009147 Ga0114129_10218514 Ga0114129_102185143 130
134 3300009147 Ga0114129_11428616 Ga0114129_114286162 130
135 3300009147 Ga0114129_11648882 Ga0114129_116488821 130
136 3300009148 Ga0105243_10141833 Ga0105243_101418332 130
137 3300009177 Ga0105248_11260099 Ga0105248_112600992 130
138 3300009553 Ga0105249_10275274 Ga0105249_102752741 130
139 3300025915 Ga0207693_10905346 Ga0207693_109053461 130
140 3300025919 Ga0207657_10430062 Ga0207657_104300622 130
141 3300025922 Ga0207646_10620052 Ga0207646_106200522 130
142 3300025927 Ga0207687_10384598 Ga0207687_103845982 130
143 3300025931 Ga0207644_10269512 Ga0207644_102695122 130
144 3300025932 Ga0207690_10085377 Ga0207690_100853772 130
145 3300025935 Ga0207709_10247675 Ga0207709_102476752 130
146 3300025935 Ga0207709_10275227 Ga0207709_102752272 130
147 3300025935 Ga0207709_10397783 Ga0207709_103977832 130
148 3300025938 Ga0207704_10119946 Ga0207704_101199462 130
149 3300025938 Ga0207704_10769521 Ga0207704_107695211 130
150 3300025944 Ga0207661_10834072 Ga0207661_108340721 130
151 3300025944 Ga0207661_10939399 Ga0207661_109393991 130
152 3300025944 Ga0207661_11803646 Ga0207661_118036461 130
153 3300025945 Ga0207679_10335987 Ga0207679_103359873 130
154 3300025972 Ga0207668_10846605 Ga0207668_108466052 130
155 3300025986 Ga0207658_10562262 Ga0207658_105622622 130
156 3300026075 Ga0207708_10092418 Ga0207708_100924184 130
157 3300026089 Ga0207648_10683558 Ga0207648_106835582 130
158 3300026118 Ga0207675_101495251 Ga0207675_1014952512 130
159 3300026142 Ga0207698_10950657 Ga0207698_109506572 130
160 3300027907 Ga0207428_10315219 Ga0207428_103152192 130
161 3300028558 Ga0265326_10000028 Ga0265326_1000002853 130
162 3300028563 Ga0265319_1012823 Ga0265319_10128235 130
163 3300028573 Ga0265334_10000040 Ga0265334_1000004082 130
164 3300028666 Ga0265336_10010521 Ga0265336_100105213 130
165 3300028800 Ga0265338_10005183 Ga0265338_1000518312 130
166 3300028800 Ga0265338_10093927 Ga0265338_100939272 130
167 3300029957 Ga0265324_10000572 Ga0265324_1000057221 130
168 3300031251 Ga0265327_10026759 Ga0265327_100267595 130
169 3300031548 Ga0307408_100078364 Ga0307408_1000783643 130
170 3300031731 Ga0307405_10616577 Ga0307405_106165772 130
171 3300031731 Ga0307405_12083045 Ga0307405_120830451 130
172 3300031824 Ga0307413_10354481 Ga0307413_103544812 130
173 3300031852 Ga0307410_10142828 Ga0307410_101428283 130
174 3300031901 Ga0307406_10583615 Ga0307406_105836152 130
175 3300031901 Ga0307406_10617095 Ga0307406_106170952 130
176 3300031903 Ga0307407_10160896 Ga0307407_101608962 130
177 3300031911 Ga0307412_10131137 Ga0307412_101311373 130
178 3300031995 Ga0307409_100231858 Ga0307409_1002318583 130
179 3300031995 Ga0307409_100292314 Ga0307409_1002923143 130
180 3300031995 Ga0307409_100858548 Ga0307409_1008585481 130
181 3300032002 Ga0307416_100394903 Ga0307416_1003949031 130
182 3300032004 Ga0307414_10685923 Ga0307414_106859232 130
183 3300032005 Ga0307411_10188598 Ga0307411_101885982 130
184 3300032005 Ga0307411_10527835 Ga0307411_105278352 130
185 3300032126 Ga0307415_100534772 Ga0307415_1005347722 130
186 3300032126 Ga0307415_100581398 Ga0307415_1005813981 130
187 3300032126 Ga0307415_100879448 Ga0307415_1008794482 130
188 3300032126 Ga0307415_102568373 Ga0307415_1025683731 130
189 3300035116 Ga0373945_0270243 Ga0373945_0270243_70_465 130
190 3300035170 Ga0373943_0021208 Ga0373943_0021208_459_854 130
191 3300035171 Ga0373946_0258189 Ga0373946_0258189_388_783 130
192 3300035692 Ga0373935_0092716 Ga0373935_0092716_849_1244 130
193 3300035695 Ga0373927_0072659 Ga0373927_0072659_859_1254 130
194 3300036712 Ga0316584_0162721 Ga0316584_0162721_300_713 130
195 3300037068 Ga0373925_0008758 Ga0373925_0008758_2189_2584 130
196 3300037466 Ga0395898_1665168 Ga0395898_1665168_61_456 130
197 3300037471 Ga0395905_1898762 Ga0395905_1898762_25_420 130
198 3300041512 Ga0451853_2993449 Ga0451853_2993449_54_449 130
199 3300044694 Ga0466963_0017632 Ga0466963_0017632_831_1232 130
200 3300044694 Ga0466963_0036193 Ga0466963_0036193_234_635 130
201 3300044694 Ga0466963_0109319 Ga0466963_0109319_205_615 130
202 3300044694 Ga0466963_0303945 Ga0466963_0303945_561_968 130
203 3300044719 Ga0466971_0423093 Ga0466971_0423093_47_457 130
204 3300044842 Ga0466957_0401559 Ga0466957_0401559_474_884 130
205 3300045836 Ga0466958_0280673 Ga0466958_0280673_381_776 130
206 3300045976 Ga0466967_0100289 Ga0466967_0100289_681_1082 130
207 3300045976 Ga0466967_0190083 Ga0466967_0190083_1399_1809 130
208 3300045976 Ga0466967_0311205 Ga0466967_0311205_60_455 130
209 3300045976 Ga0466967_0334237 Ga0466967_0334237_303_704 130
210 3300045976 Ga0466967_0507654 Ga0466967_0507654_663_1133 130
211 3300045976 Ga0466967_0601132 Ga0466967_0601132_309_719 130
212 3300045976 Ga0466967_0687345 Ga0466967_0687345_490_900 130
213 3300045976 Ga0466967_0791658 Ga0466967_0791658_448_858 130
214 3300045976 Ga0466967_1423651 Ga0466967_1423651_204_614 130
215 3300046461 Ga0495641_0487923 Ga0495641_0487923_39_434 130
216 3300046472 Ga0495580_0151086 Ga0495580_0151086_615_1010 130
217 3300046473 Ga0495582_0212929 Ga0495582_0212929_263_658 130
218 3300046473 Ga0495582_0565844 Ga0495582_0565844_228_620 130
219 3300046491 Ga0495584_0135343 Ga0495584_0135343_144_539 130
220 3300046491 Ga0495584_0380872 Ga0495584_0380872_83_478 130
221 3300046500 Ga0495596_0016288 Ga0495596_0016288_2110_2505 130
222 3300046500 Ga0495596_0119329 Ga0495596_0119329_267_662 130
223 3300046501 Ga0495607_0520451 Ga0495607_0520451_99_494 130
224 3300046517 Ga0495630_0363036 Ga0495630_0363036_78_470 130
225 3300046538 Ga0495609_0304932 Ga0495609_0304932_189_584 130
226 3300046557 Ga0495622_0243810 Ga0495622_0243810_42_437 130
227 3300046663 Ga0495635_0377947 Ga0495635_0377947_531_923 130
228 3300046674 Ga0495588_0607311 Ga0495588_0607311_89_484 130
229 3300046683 Ga0495658_0175432 Ga0495658_0175432_109_504 130
230 3300046692 Ga0495671_0572818 Ga0495671_0572818_69_464 130
231 3300048904 Ga0496101_0000699 Ga0496101_0000699_13127_13522 130
232 3300048905 Ga0496102_0687245 Ga0496102_0687245_400_810 130
233 3300048911 Ga0496108_1414146 Ga0496108_1414146_164_556 130
234 3300048915 Ga0496112_0156387 Ga0496112_0156387_1497_1967 130
235 3300048915 Ga0496112_1342056 Ga0496112_1342056_28_423 130
236 3300049574 Ga0501038_1383106 Ga0501038_1383106_88_483 130
237 3300049575 Ga0501039_1195105 Ga0501039_1195105_169_564 130
238 3300049578 Ga0501042_0924598 Ga0501042_0924598_196_591 130
239 3300049580 Ga0501046_0647670 Ga0501046_0647670_291_686 130
240 3300049583 Ga0501067_0040957 Ga0501067_0040957_314_712 130
241 3300049583 Ga0501067_0233842 Ga0501067_0233842_22_417 130
242 3300049587 Ga0501071_1311193 Ga0501071_1311193_155_547 130
243 3300049741 Ga0501079_0161516 Ga0501079_0161516_969_1364 130
244 3300049741 Ga0501079_0824959 Ga0501079_0824959_128_523 130
245 3300049824 Ga0501045_0083336 Ga0501045_0083336_467_862 130
246 3300050494 nmdc:mga06z11_489858_c1 nmdc:mga06z11_489858_c1_212_604 130
247 3300050507 nmdc:mga05p37_53604_c1 nmdc:mga05p37_53604_c1_3864_4265 130
248 3300050507 nmdc:mga05p37_551777_c1 nmdc:mga05p37_551777_c1_278_673 130
249 3300050509 nmdc:mga0qj67_132068_c1 nmdc:mga0qj67_132068_c1_789_1184 130
250 3300050510 nmdc:mga06r32_38482_c1 nmdc:mga06r32_38482_c1_1569_2021 130
251 3300050510 nmdc:mga06r32_517018_c1 nmdc:mga06r32_517018_c1_393_815 130
252 3300050511 nmdc:mga08y16_106108_c1 nmdc:mga08y16_106108_c1_775_1176 130
253 3300053078 Ga0495612_0333078 Ga0495612_0333078_84_476 130
254 3300053083 Ga0495655_0192802 Ga0495655_0192802_177_572 130
255 3300054114 Ga0501084_0623692 Ga0501084_0623692_44_436 130
256 3300005337 Ga0070682_100041021 Ga0070682_1000410214 132
257 3300005338 Ga0068868_100183955 Ga0068868_1001839551 132
258 3300005347 Ga0070668_100982294 Ga0070668_1009822942 132
259 3300005354 Ga0070675_100786720 Ga0070675_1007867201 132
260 3300005365 Ga0070688_100272043 Ga0070688_1002720432 132
261 3300005434 Ga0070709_10928740 Ga0070709_109287401 132
262 3300005440 Ga0070705_100195650 Ga0070705_1001956502 132
263 3300005444 Ga0070694_100386072 Ga0070694_1003860722 132
264 3300005456 Ga0070678_100033949 Ga0070678_1000339494 132
265 3300005539 Ga0068853_101958836 Ga0068853_1019588361 132
266 3300005545 Ga0070695_100613590 Ga0070695_1006135902 132
267 3300005615 Ga0070702_100255909 Ga0070702_1002559092 132
268 3300006048 Ga0075363_100109899 Ga0075363_1001098992 132
269 3300006051 Ga0075364_10096035 Ga0075364_100960352 132
270 3300006173 Ga0070716_100038698 Ga0070716_1000386983 132
271 3300006175 Ga0070712_100010878 Ga0070712_1000108787 132
272 3300006881 Ga0068865_100637552 Ga0068865_1006375521 132
273 3300007076 Ga0075435_100764898 Ga0075435_1007648981 132
274 3300009098 Ga0105245_10030532 Ga0105245_100305324 132
275 3300010375 Ga0105239_10476002 Ga0105239_104760021 132
276 3300013296 Ga0157374_10173368 Ga0157374_101733683 132
277 3300013308 Ga0157375_10039830 Ga0157375_100398302 132
278 3300014969 Ga0157376_10169107 Ga0157376_101691074 132
279 3300025906 Ga0207699_10722764 Ga0207699_107227641 132
280 3300025915 Ga0207693_10012159 Ga0207693_100121598 132
281 3300025927 Ga0207687_10033328 Ga0207687_100333283 132
282 3300025938 Ga0207704_10534124 Ga0207704_105341241 132
283 3300025972 Ga0207668_10939024 Ga0207668_109390242 132
284 3300026023 Ga0207677_10173111 Ga0207677_101731112 132
285 3300031903 Ga0307407_10338949 Ga0307407_103389491 132
286 3300031995 Ga0307409_100051006 Ga0307409_1000510065 132
287 3300031995 Ga0307409_102785905 Ga0307409_1027859051 132
288 3300032002 Ga0307416_100001564 Ga0307416_1000015645 132
289 3300032005 Ga0307411_10321899 Ga0307411_103218992 132
290 3300035692 Ga0373935_1006864 Ga0373935_1006864_154_558 132
291 3300035725 Ga0373947_0553814 Ga0373947_0553814_280_684 132
292 3300046455 Ga0495603_0135237 Ga0495603_0135237_73_477 132
293 3300046499 Ga0495594_0053156 Ga0495594_0053156_1398_1802 132
294 3300047315 Ga0495581_0390083 Ga0495581_0390083_310_714 132
295 3300048089 Ga0495614_0625719 Ga0495614_0625719_90_494 132
296 3300048903 Ga0496100_0145375 Ga0496100_0145375_1204_1608 132
297 3300048904 Ga0496101_0028349 Ga0496101_0028349_2105_2509 132
298 3300048905 Ga0496102_0002436 Ga0496102_0002436_12462_12866 132
299 3300048906 Ga0496103_0002655 Ga0496103_0002655_5584_5988 132
300 3300048907 Ga0496104_0025483 Ga0496104_0025483_18_422 132
301 3300048908 Ga0496105_0002713 Ga0496105_0002713_6457_6861 132
302 3300048909 Ga0496106_0006628 Ga0496106_0006628_3117_3521 132
303 3300048910 Ga0496107_0007914 Ga0496107_0007914_1900_2304 132
304 3300048911 Ga0496108_1409752 Ga0496108_1409752_17_421 132
305 3300048912 Ga0496109_1329808 Ga0496109_1329808_16_420 132
306 3300048913 Ga0496110_0021684 Ga0496110_0021684_395_799 132
307 3300048914 Ga0496111_0001594 Ga0496111_0001594_4242_4646 132
308 3300048915 Ga0496112_0102671 Ga0496112_0102671_2032_2436 132
309 3300048917 Ga0496114_0005778 Ga0496114_0005778_2048_2452 132
310 3300048918 Ga0496115_0006079 Ga0496115_0006079_5889_6293 132
311 3300049584 Ga0501068_0927364 Ga0501068_0927364_44_442 132
312 3300050490 nmdc:mga03n38_719314_c1 nmdc:mga03n38_719314_c1_154_558 132
313 3300050490 nmdc:mga03n38_79911_c1 nmdc:mga03n38_79911_c1_252_659 132
314 3300050513 nmdc:mga0rr50_738527_c1 nmdc:mga0rr50_738527_c1_42_443 132
315 3300002077 JGI24744J21845_10082559 JGI24744J21845_100825591 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

59

131

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9222 34 117
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8988 34 119
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8873 21 117
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.8855 37 119
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.881 35 119
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8977 23 127 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8966 34 118 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8855 34 118 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8768 25 119 2.60.120.10
af_A0A1D6PR44_1_254_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8671 79 129 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7Y6CEB3-F1-model_v4 Cupin domain-containing protein 0.9606 2 133
AF-A0A538HT46-F1-model_v4 Cupin domain-containing protein 0.96 1 135
AF-A0A538HT46-F1-model_v4 Cupin domain-containing protein 0.9529 1 135
AF-A0A538IYE5-F1-model_v4 Cupin domain-containing protein 0.9515 3 123
AF-A0A538G8F5-F1-model_v4 Cupin domain-containing protein 0.9512 1 135

Feature Viewer

pLDDT pTM Quality
93.97 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map