F403264

General Info

Members Datasets Scaffolds Average Seq Length
315 232 315 147

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0259341|Ga0316574_0259341_52_570
Length 172
Sequence VDRGDDHPRRLPPRLDRDRGDEALVNDEELMRLALAAAASAPEHDDVPIGAVLARGGEPLATAANERELRRDPTAHAEILAIREGAELLGGWRLPDTTLYVTLEPCAMCAGAIVLARVPRVVYAAPDPKAGAAGSVLDVLGEPLLNHRPEVVGGVLGADAAELLRSFFRLRR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
210 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
222 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 8.57
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000015 3300001977 Bacteria 16109
2 Ga0070658_10074234 3300005327 Bacteria 2789
3 Ga0070676_10891745 3300005328 Bacteria 662
4 Ga0070683_100002371 3300005329 Bacteria 14965
5 Ga0070683_100032357 3300005329 Bacteria 4762
6 Ga0070683_100084948 3300005329 Bacteria 2966
7 Ga0070683_100221687 3300005329 Bacteria 1797
8 Ga0070683_100222135 3300005329 Bacteria 1795
9 Ga0068869_100363146 3300005334 Bacteria 1183
10 Ga0070666_10016968 3300005335 Bacteria 4662
11 Ga0070680_100317630 3300005336 Bacteria 1322
12 Ga0070682_100010603 3300005337 Bacteria 5234
13 Ga0070682_100456723 3300005337 Bacteria 980
14 Ga0068868_100000314 3300005338 Bacteria 32538
15 Ga0068868_100009531 3300005338 Bacteria 6996
16 Ga0068868_100117937 3300005338 Bacteria 2163
17 Ga0070660_100026522 3300005339 Bacteria 4314
18 Ga0070691_10239312 3300005341 Bacteria 969
19 Ga0070661_100101294 3300005344 Bacteria 2142
20 Ga0070692_10007304 3300005345 Bacteria 4862
21 Ga0070668_100045876 3300005347 Bacteria 3354
22 Ga0070675_100055766 3300005354 Bacteria 3254
23 Ga0070674_100012881 3300005356 Bacteria 5149
24 Ga0070673_100317255 3300005364 Bacteria 1376
25 Ga0070659_100006808 3300005366 Bacteria 8274
26 Ga0070659_100008246 3300005366 Bacteria 7606
27 Ga0070659_100026053 3300005366 Bacteria 4498
28 Ga0070703_10070063 3300005406 Bacteria 1169
29 Ga0070714_100007897 3300005435 Bacteria 8286
30 Ga0070713_100000061 3300005436 Bacteria 68662
31 Ga0070710_10391836 3300005437 Bacteria 929
32 Ga0070700_100026747 3300005441 Bacteria 3412
33 Ga0070663_100020966 3300005455 Bacteria 4337
34 Ga0070663_100034273 3300005455 Bacteria 3515
35 Ga0070663_100071918 3300005455 Bacteria 2518
36 Ga0070678_100123282 3300005456 Bacteria 2047
37 Ga0070662_100000079 3300005457 Bacteria 53583
38 Ga0070662_100104982 3300005457 Bacteria 2144
39 Ga0068867_100049641 3300005459 Bacteria 3090
40 Ga0070679_100073737 3300005530 Bacteria 3404
41 Ga0070679_100237933 3300005530 Bacteria 1779
42 Ga0070684_100017290 3300005535 Bacteria 5914
43 Ga0070684_100025825 3300005535 Bacteria 4941
44 Ga0070684_100051265 3300005535 Bacteria 3585
45 Ga0070684_100068139 3300005535 Bacteria 3127
46 Ga0070684_100432266 3300005535 Bacteria 1216
47 Ga0068853_100071480 3300005539 Bacteria 3022
48 Ga0068853_100484249 3300005539 Bacteria 1166
49 Ga0070672_100000018 3300005543 Bacteria 70205
50 Ga0070672_100052463 3300005543 Bacteria 3184
51 Ga0070686_100208873 3300005544 Bacteria 1404
52 Ga0070693_100002093 3300005547 Bacteria 9134
53 Ga0070693_100081036 3300005547 Bacteria 1935
54 Ga0070665_100110065 3300005548 Bacteria 2757
55 Ga0070704_100461701 3300005549 Bacteria 1096
56 Ga0070664_100022138 3300005564 Bacteria 5242
57 Ga0070664_101103575 3300005564 Bacteria 747
58 Ga0068857_100298840 3300005577 Bacteria 1484
59 Ga0068857_100335098 3300005577 Bacteria 1399
60 Ga0068854_100050001 3300005578 Bacteria 2989
61 Ga0068856_101368186 3300005614 Bacteria 722
62 Ga0070702_100175445 3300005615 Bacteria 1398
63 Ga0070702_100603920 3300005615 Bacteria 823
64 Ga0068852_100002716 3300005616 Bacteria 12233
65 Ga0068859_100082740 3300005617 Bacteria 3253
66 Ga0068864_100162143 3300005618 Bacteria 2033
67 Ga0068866_10233675 3300005718 Bacteria 1116
68 Ga0068870_10099162 3300005840 Bacteria 1643
69 Ga0068858_100000178 3300005842 Bacteria 67760
70 Ga0068858_100106051 3300005842 Bacteria 2623
71 Ga0081455_10022386 3300005937 Bacteria 5908
72 Ga0081455_10474385 3300005937 Bacteria 848
73 Ga0081540_1000503 3300005983 Bacteria 38494
74 Ga0081539_10063061 3300005985 Bacteria 2024
75 Ga0075365_10018953 3300006038 Bacteria 4238
76 Ga0075363_100067463 3300006048 Bacteria 1938
77 Ga0075363_100177568 3300006048 Bacteria 1211
78 Ga0075363_100512940 3300006048 Bacteria 713
79 Ga0075364_10068343 3300006051 Bacteria 2336
80 Ga0070716_100862254 3300006173 Bacteria 706
81 Ga0075431_100152670 3300006847 Bacteria 2378
82 Ga0075433_10063671 3300006852 Bacteria 3231
83 Ga0075434_100002798 3300006871 Bacteria 15457
84 Ga0068865_100117702 3300006881 Bacteria 1970
85 Ga0075436_100225679 3300006914 Bacteria 1330
86 Ga0097620_100082738 3300006931 Bacteria 3253
87 Ga0075435_100448115 3300007076 Bacteria 1113
88 Ga0111539_10177230 3300009094 Bacteria 2490
89 Ga0105245_10000012 3300009098 Bacteria 267151
90 Ga0105245_10073844 3300009098 Bacteria 3102
91 Ga0105245_11996910 3300009098 Bacteria 633
92 Ga0114129_10003248 3300009147 Bacteria 22815
93 Ga0105243_10005188 3300009148 Bacteria 10198
94 Ga0105243_10022821 3300009148 Bacteria 4758
95 Ga0105249_10000039 3300009553 Bacteria 196325
96 Ga0105249_10054170 3300009553 Bacteria 3667
97 Ga0105239_10090385 3300010375 Bacteria 3378
98 Ga0105239_10312019 3300010375 Bacteria 1773
99 Ga0157372_10097670 3300013307 Bacteria 3350
100 Ga0157372_10359094 3300013307 Bacteria 1697
101 Ga0157372_10426601 3300013307 Bacteria 1545
102 Ga0157375_10077397 3300013308 Bacteria 3356
103 Ga0163163_10078229 3300014325 Bacteria 3304
104 Ga0163163_10844670 3300014325 Bacteria 979
105 Ga0157380_10000009 3300014326 Bacteria 142155
106 Ga0157380_10000277 3300014326 Bacteria 30723
107 Ga0157380_10017839 3300014326 Bacteria 5260
108 Ga0157377_10021854 3300014745 Bacteria 3371
109 Ga0157379_10069180 3300014968 Bacteria 3157
110 Ga0157379_10776417 3300014968 Bacteria 903
111 Ga0157376_10014432 3300014969 Bacteria 5932
112 Ga0157376_10020413 3300014969 Bacteria 5124
113 Ga0207682_10000007 3300025893 Bacteria 88967
114 Ga0207692_10189824 3300025898 Bacteria 1202
115 Ga0207692_10368722 3300025898 Bacteria 889
116 Ga0207642_10199028 3300025899 Bacteria 1105
117 Ga0207710_10000365 3300025900 Bacteria 31650
118 Ga0207688_10019077 3300025901 Bacteria 3733
119 Ga0207680_10129382 3300025903 Bacteria 1662
120 Ga0207643_10081993 3300025908 Bacteria 1870
121 Ga0207705_10016873 3300025909 Bacteria 5230
122 Ga0207671_10203968 3300025914 Bacteria 1545
123 Ga0207657_10003009 3300025919 Bacteria 18060
124 Ga0207649_10236085 3300025920 Bacteria 1310
125 Ga0207659_10079939 3300025926 Bacteria 2414
126 Ga0207687_10000011 3300025927 Bacteria 388349
127 Ga0207687_10031499 3300025927 Bacteria 3584
128 Ga0207687_10105065 3300025927 Bacteria 2086
129 Ga0207700_10000016 3300025928 Bacteria 202434
130 Ga0207664_10002111 3300025929 Bacteria 13080
131 Ga0207690_10004245 3300025932 Bacteria 8465
132 Ga0207690_10022473 3300025932 Bacteria 3925
133 Ga0207690_10126999 3300025932 Bacteria 1861
134 Ga0207706_10000302 3300025933 Bacteria 53541
135 Ga0207706_10012441 3300025933 Bacteria 7753
136 Ga0207686_10003881 3300025934 Bacteria 8020
137 Ga0207709_10024049 3300025935 Bacteria 3474
138 Ga0207709_10028292 3300025935 Bacteria 3240
139 Ga0207669_10097214 3300025937 Bacteria 1935
140 Ga0207704_10000009 3300025938 Bacteria 198266
141 Ga0207704_10133003 3300025938 Bacteria 1726
142 Ga0207665_10197650 3300025939 Bacteria 1464
143 Ga0207691_10000121 3300025940 Bacteria 70558
144 Ga0207691_10005127 3300025940 Bacteria 12642
145 Ga0207689_10252786 3300025942 Bacteria 1457
146 Ga0207661_10000275 3300025944 Bacteria 33001
147 Ga0207661_10007508 3300025944 Bacteria 7753
148 Ga0207661_10074623 3300025944 Bacteria 2780
149 Ga0207661_10681030 3300025944 Bacteria 945
150 Ga0207679_10017962 3300025945 Bacteria 4727
151 Ga0207712_10000003 3300025961 Bacteria 615314
152 Ga0207712_10066444 3300025961 Bacteria 2578
153 Ga0207668_10106674 3300025972 Bacteria 2093
154 Ga0207640_10010938 3300025981 Bacteria 5121
155 Ga0207658_11040058 3300025986 Bacteria 747
156 Ga0207677_10000218 3300026023 Bacteria 45820
157 Ga0207677_10003912 3300026023 Bacteria 7930
158 Ga0207677_10101584 3300026023 Bacteria 2118
159 Ga0207703_10000381 3300026035 Bacteria 47426
160 Ga0207703_10565401 3300026035 Bacteria 1073
161 Ga0207639_10085502 3300026041 Bacteria 2508
162 Ga0207639_10452360 3300026041 Bacteria 1166
163 Ga0207678_10004621 3300026067 Bacteria 12368
164 Ga0207708_10004311 3300026075 Bacteria 10472
165 Ga0207702_11601522 3300026078 Bacteria 644
166 Ga0207648_10071665 3300026089 Bacteria 3020
167 Ga0207428_10652817 3300027907 Bacteria 755
168 Ga0265337_1000074 3300028556 Bacteria 46897
169 Ga0265326_10000035 3300028558 Bacteria 89561
170 Ga0265323_10094192 3300028653 Bacteria 997
171 Ga0265322_10000009 3300028654 Bacteria 170768
172 Ga0265336_10109224 3300028666 Bacteria 824
173 Ga0265324_10000168 3300029957 Bacteria 50622
174 Ga0265328_10000939 3300031239 Bacteria 13426
175 Ga0265320_10000024 3300031240 Bacteria 170768
176 Ga0265329_10004276 3300031242 Bacteria 5988
177 Ga0265339_10011049 3300031249 Bacteria 5578
178 Ga0265331_10005065 3300031250 Bacteria 8052
179 Ga0265327_10000227 3300031251 Bacteria 114777
180 Ga0265316_10018834 3300031344 Bacteria 5927
181 Ga0265314_10000647 3300031711 Bacteria 42707
182 Ga0265342_10138236 3300031712 Bacteria 1360
183 Ga0316576_10149306 3300031727 Bacteria 1761
184 Ga0316578_10075298 3300031728 Bacteria 2002
185 Ga0307410_10771122 3300031852 Bacteria 816
186 Ga0307410_11235118 3300031852 Bacteria 652
187 Ga0307406_10035028 3300031901 Bacteria 3084
188 Ga0307406_10793594 3300031901 Bacteria 798
189 Ga0307409_101384881 3300031995 Bacteria 729
190 Ga0307416_100348316 3300032002 Bacteria 1498
191 Ga0307415_100079329 3300032126 Bacteria 2338
192 Ga0316583_10108680 3300032133 Bacteria 967
193 Ga0316585_10053823 3300032137 Bacteria 1294
194 Ga0316580_10069223 3300032139 Bacteria 1081
195 Ga0316574_0033156 3300035398 Bacteria 3143
196 Ga0316574_0259341 3300035398 Bacteria 1110
197 Ga0373937_1651679 3300036401 Bacteria 588
198 Ga0316582_0005652 3300036647 Bacteria 6471
199 Ga0395905_0026420 3300037471 Bacteria 5474
200 Ga0395901_0763342 3300038443 Bacteria 959
201 Ga0466957_0561130 3300044842 Bacteria 796
202 Ga0466967_0081203 3300045976 Bacteria 2928
203 Ga0495603_0000054 3300046455 Bacteria 49027
204 Ga0495653_0715024 3300046463 Bacteria 607
205 Ga0495662_0004031 3300046476 Bacteria 7400
206 Ga0495594_0000007 3300046499 Bacteria 160047
207 Ga0495596_0274175 3300046500 Bacteria 655
208 Ga0495608_0102509 3300046511 Bacteria 1844
209 Ga0495608_0772730 3300046511 Bacteria 568
210 Ga0495618_0630975 3300046514 Bacteria 635
211 Ga0495640_0436369 3300046533 Bacteria 801
212 Ga0495587_0129099 3300046536 Bacteria 1445
213 Ga0495598_0003049 3300046537 Bacteria 3518
214 Ga0495645_0484763 3300046543 Bacteria 775
215 Ga0495622_0000437 3300046557 Bacteria 27136
216 Ga0495656_0034656 3300046615 Bacteria 2068
217 Ga0495668_0306469 3300046616 Bacteria 871
218 Ga0495635_0036986 3300046663 Bacteria 3380
219 Ga0495635_0759371 3300046663 Bacteria 626
220 Ga0495588_0000278 3300046674 Bacteria 38709
221 Ga0495613_0018352 3300046689 Bacteria 5218
222 Ga0495624_0003396 3300046690 Bacteria 11814
223 Ga0495600_0009512 3300046809 Bacteria 6008
224 Ga0495604_0000078 3300047317 Bacteria 83632
225 Ga0495674_0001786 3300047319 Bacteria 21206
226 Ga0496100_0000004 3300048903 Bacteria 321778
227 Ga0496100_0359315 3300048903 Bacteria 1102
228 Ga0496101_0000007 3300048904 Bacteria 321778
229 Ga0496102_0161367 3300048905 Bacteria 2109
230 Ga0496102_0243689 3300048905 Bacteria 1695
231 Ga0496103_0299680 3300048906 Bacteria 1034
232 Ga0496103_0816650 3300048906 Bacteria 587
233 Ga0496104_0000003 3300048907 Bacteria 669219
234 Ga0496104_0000307 3300048907 Bacteria 43626
235 Ga0496105_0000003 3300048908 Bacteria 713251
236 Ga0496105_0000070 3300048908 Bacteria 80117
237 Ga0496106_0000004 3300048909 Bacteria 279896
238 Ga0496107_0000001 3300048910 Bacteria 321778
239 Ga0496107_0849986 3300048910 Bacteria 667
240 Ga0496108_0000002 3300048911 Bacteria 700890
241 Ga0496108_0000202 3300048911 Bacteria 55115
242 Ga0496108_0047000 3300048911 Bacteria 3607
243 Ga0496109_0000001 3300048912 Bacteria 700852
244 Ga0496109_0000106 3300048912 Bacteria 86550
245 Ga0496109_0000131 3300048912 Bacteria 76860
246 Ga0496109_0038060 3300048912 Bacteria 4348
247 Ga0496109_0248293 3300048912 Bacteria 1676
248 Ga0496110_0098235 3300048913 Bacteria 2623
249 Ga0496111_0003706 3300048914 Bacteria 9504
250 Ga0496113_0023287 3300048916 Bacteria 4391
251 Ga0496113_1297707 3300048916 Bacteria 566
252 Ga0496115_0024022 3300048918 Bacteria 4735
253 Ga0496118_0279205 3300048921 Bacteria 931
254 Ga0496121_0289667 3300048924 Bacteria 1116
255 Ga0496125_0460075 3300048928 Bacteria 726
256 Ga0501031_0002389 3300049568 Bacteria 11926
257 Ga0501032_0002564 3300049569 Bacteria 14222
258 Ga0501033_0085780 3300049570 Bacteria 2305
259 Ga0501034_0019089 3300049571 Bacteria 7019
260 Ga0501036_0006591 3300049572 Bacteria 9431
261 Ga0501037_0003409 3300049573 Bacteria 11558
262 Ga0501038_0109525 3300049574 Bacteria 2288
263 Ga0501039_0092234 3300049575 Bacteria 2361
264 Ga0501042_0080329 3300049578 Bacteria 2336
265 Ga0501042_0145106 3300049578 Bacteria 1711
266 Ga0501043_0085553 3300049579 Bacteria 2477
267 Ga0501046_0002906 3300049580 Bacteria 15882
268 Ga0501047_0004514 3300049581 Bacteria 13090
269 Ga0501048_0002887 3300049582 Bacteria 13115
270 Ga0501067_0039235 3300049583 Bacteria 2630
271 Ga0501068_0030303 3300049584 Bacteria 3208
272 Ga0501068_0091630 3300049584 Bacteria 1876
273 Ga0501068_0094640 3300049584 Bacteria 1846
274 Ga0501069_0052689 3300049585 Bacteria 2266
275 Ga0501069_0126089 3300049585 Bacteria 1464
276 Ga0501069_0459380 3300049585 Bacteria 757
277 Ga0501070_0004138 3300049586 Bacteria 12491
278 Ga0501071_0091086 3300049587 Bacteria 2240
279 Ga0501073_0064789 3300049589 Bacteria 2548
280 Ga0501074_0010118 3300049590 Bacteria 6847
281 Ga0501075_0016038 3300049591 Bacteria 5390
282 Ga0501209_003280 3300049656 Bacteria 2644
283 Ga0501242_000255 3300049674 Bacteria 4268
284 Ga0501243_001894 3300049675 Bacteria 3048
285 Ga0501249_016928 3300049679 Bacteria 1568
286 Ga0501252_007315 3300049682 Bacteria 1248
287 Ga0501257_017893 3300049686 Bacteria 1650
288 Ga0501259_002665 3300049688 Bacteria 2875
289 Ga0501261_009299 3300049690 Bacteria 1280
290 Ga0501245_003636 3300049708 Bacteria 2100
291 Ga0501079_0099701 3300049741 Bacteria 2251
292 Ga0501080_0025145 3300049742 Bacteria 5526
293 Ga0501083_0062460 3300049744 Bacteria 2485
294 Ga0501264_006065 3300049761 Bacteria 1110
295 Ga0501266_000639 3300049763 Bacteria 4564
296 Ga0501267_024515 3300049764 Bacteria 682
297 Ga0501268_009947 3300049765 Bacteria 1471
298 Ga0501035_0006173 3300049822 Bacteria 11279
299 Ga0501044_0007279 3300049823 Bacteria 12161
300 Ga0501204_054821 3300049850 Bacteria 620
301 Ga0501212_021593 3300049851 Bacteria 999
302 nmdc:mga05p37_12316_c1 3300050507 Bacteria 10215
303 nmdc:mga06r32_299352_c1 3300050510 Bacteria 1595
304 nmdc:mga08y16_1173157_c1 3300050511 Bacteria 740
305 nmdc:mga0n895_13573_c1 3300050512 Bacteria 7359
306 nmdc:mga08x19_355995_c1 3300050514 Bacteria 1022
307 nmdc:mga0a205_67610_c1 3300050515 Bacteria 3452
308 Ga0495601_0007034 3300053077 Bacteria 6593
309 Ga0495601_0024999 3300053077 Bacteria 3680
310 Ga0495601_0051753 3300053077 Bacteria 2592
311 Ga0495655_0105694 3300053083 Bacteria 839
312 Ga0495619_0000060 3300053085 Bacteria 89377
313 Ga0495619_0002877 3300053085 Bacteria 11194
314 Ga0495619_0006523 3300053085 Bacteria 7387
315 Ga0501082_0110822 3300060353 Bacteria 2375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027907 Ga0207428_10652817 Ga0207428_106528171 124
2 3300009094 Ga0111539_10177230 Ga0111539_101772301 137
3 3300050511 nmdc:mga08y16_1173157_c1 nmdc:mga08y16_1173157_c1_106_573 137
4 3300005327 Ga0070658_10074234 Ga0070658_100742343 138
5 3300005329 Ga0070683_100002371 Ga0070683_10000237110 138
6 3300005329 Ga0070683_100084948 Ga0070683_1000849482 138
7 3300005329 Ga0070683_100221687 Ga0070683_1002216872 138
8 3300005329 Ga0070683_100222135 Ga0070683_1002221352 138
9 3300005334 Ga0068869_100363146 Ga0068869_1003631462 138
10 3300005335 Ga0070666_10016968 Ga0070666_100169682 138
11 3300005336 Ga0070680_100317630 Ga0070680_1003176302 138
12 3300005337 Ga0070682_100010603 Ga0070682_1000106033 138
13 3300005337 Ga0070682_100456723 Ga0070682_1004567232 138
14 3300005338 Ga0068868_100009531 Ga0068868_1000095317 138
15 3300005338 Ga0068868_100117937 Ga0068868_1001179372 138
16 3300005339 Ga0070660_100026522 Ga0070660_1000265222 138
17 3300005341 Ga0070691_10239312 Ga0070691_102393122 138
18 3300005344 Ga0070661_100101294 Ga0070661_1001012942 138
19 3300005345 Ga0070692_10007304 Ga0070692_100073045 138
20 3300005347 Ga0070668_100045876 Ga0070668_1000458762 138
21 3300005354 Ga0070675_100055766 Ga0070675_1000557663 138
22 3300005356 Ga0070674_100012881 Ga0070674_1000128812 138
23 3300005364 Ga0070673_100317255 Ga0070673_1003172552 138
24 3300005366 Ga0070659_100006808 Ga0070659_1000068082 138
25 3300005366 Ga0070659_100008246 Ga0070659_1000082464 138
26 3300005366 Ga0070659_100026053 Ga0070659_1000260535 138
27 3300005435 Ga0070714_100007897 Ga0070714_10000789710 138
28 3300005436 Ga0070713_100000061 Ga0070713_1000000616 138
29 3300005437 Ga0070710_10391836 Ga0070710_103918362 138
30 3300005441 Ga0070700_100026747 Ga0070700_1000267473 138
31 3300005455 Ga0070663_100020966 Ga0070663_1000209663 138
32 3300005455 Ga0070663_100034273 Ga0070663_1000342732 138
33 3300005456 Ga0070678_100123282 Ga0070678_1001232821 138
34 3300005457 Ga0070662_100104982 Ga0070662_1001049822 138
35 3300005459 Ga0068867_100049641 Ga0068867_1000496413 138
36 3300005530 Ga0070679_100073737 Ga0070679_1000737372 138
37 3300005535 Ga0070684_100017290 Ga0070684_1000172903 138
38 3300005535 Ga0070684_100051265 Ga0070684_1000512652 138
39 3300005535 Ga0070684_100068139 Ga0070684_1000681392 138
40 3300005539 Ga0068853_100071480 Ga0068853_1000714802 138
41 3300005543 Ga0070672_100000018 Ga0070672_10000001856 138
42 3300005543 Ga0070672_100052463 Ga0070672_1000524632 138
43 3300005544 Ga0070686_100208873 Ga0070686_1002088732 138
44 3300005547 Ga0070693_100081036 Ga0070693_1000810363 138
45 3300005548 Ga0070665_100110065 Ga0070665_1001100652 138
46 3300005564 Ga0070664_100022138 Ga0070664_1000221382 138
47 3300005564 Ga0070664_101103575 Ga0070664_1011035752 138
48 3300005577 Ga0068857_100298840 Ga0068857_1002988402 138
49 3300005578 Ga0068854_100050001 Ga0068854_1000500012 138
50 3300005614 Ga0068856_101368186 Ga0068856_1013681861 138
51 3300005615 Ga0070702_100175445 Ga0070702_1001754452 138
52 3300005616 Ga0068852_100002716 Ga0068852_1000027163 138
53 3300005617 Ga0068859_100082740 Ga0068859_1000827404 138
54 3300005618 Ga0068864_100162143 Ga0068864_1001621433 138
55 3300005718 Ga0068866_10233675 Ga0068866_102336752 138
56 3300005840 Ga0068870_10099162 Ga0068870_100991622 138
57 3300005842 Ga0068858_100106051 Ga0068858_1001060513 138
58 3300005937 Ga0081455_10022386 Ga0081455_100223868 138
59 3300005937 Ga0081455_10474385 Ga0081455_104743852 138
60 3300005983 Ga0081540_1000503 Ga0081540_10005037 138
61 3300005985 Ga0081539_10063061 Ga0081539_100630612 138
62 3300006038 Ga0075365_10018953 Ga0075365_100189532 138
63 3300006048 Ga0075363_100067463 Ga0075363_1000674631 138
64 3300006048 Ga0075363_100512940 Ga0075363_1005129401 138
65 3300006051 Ga0075364_10068343 Ga0075364_100683432 138
66 3300006881 Ga0068865_100117702 Ga0068865_1001177023 138
67 3300006931 Ga0097620_100082738 Ga0097620_1000827384 138
68 3300009098 Ga0105245_10000012 Ga0105245_1000001287 138
69 3300010375 Ga0105239_10312019 Ga0105239_103120194 138
70 3300014969 Ga0157376_10014432 Ga0157376_100144322 138
71 3300014969 Ga0157376_10020413 Ga0157376_100204137 138
72 3300025898 Ga0207692_10368722 Ga0207692_103687221 138
73 3300025899 Ga0207642_10199028 Ga0207642_101990282 138
74 3300025900 Ga0207710_10000365 Ga0207710_1000036519 138
75 3300025901 Ga0207688_10019077 Ga0207688_100190772 138
76 3300025903 Ga0207680_10129382 Ga0207680_101293821 138
77 3300025908 Ga0207643_10081993 Ga0207643_100819934 138
78 3300025909 Ga0207705_10016873 Ga0207705_100168733 138
79 3300025914 Ga0207671_10203968 Ga0207671_102039685 138
80 3300025919 Ga0207657_10003009 Ga0207657_100030094 138
81 3300025920 Ga0207649_10236085 Ga0207649_102360852 138
82 3300025926 Ga0207659_10079939 Ga0207659_100799393 138
83 3300025927 Ga0207687_10000011 Ga0207687_10000011140 138
84 3300025927 Ga0207687_10031499 Ga0207687_100314994 138
85 3300025927 Ga0207687_10105065 Ga0207687_101050653 138
86 3300025928 Ga0207700_10000016 Ga0207700_1000001682 138
87 3300025929 Ga0207664_10002111 Ga0207664_100021116 138
88 3300025932 Ga0207690_10004245 Ga0207690_100042452 138
89 3300025932 Ga0207690_10022473 Ga0207690_100224732 138
90 3300025932 Ga0207690_10126999 Ga0207690_101269993 138
91 3300025933 Ga0207706_10012441 Ga0207706_100124412 138
92 3300025934 Ga0207686_10003881 Ga0207686_100038813 138
93 3300025935 Ga0207709_10028292 Ga0207709_100282922 138
94 3300025937 Ga0207669_10097214 Ga0207669_100972142 138
95 3300025938 Ga0207704_10133003 Ga0207704_101330032 138
96 3300025940 Ga0207691_10000121 Ga0207691_1000012120 138
97 3300025940 Ga0207691_10005127 Ga0207691_100051272 138
98 3300025942 Ga0207689_10252786 Ga0207689_102527862 138
99 3300025944 Ga0207661_10000275 Ga0207661_1000027525 138
100 3300025944 Ga0207661_10007508 Ga0207661_100075087 138
101 3300025944 Ga0207661_10074623 Ga0207661_100746232 138
102 3300025944 Ga0207661_10681030 Ga0207661_106810302 138
103 3300025945 Ga0207679_10017962 Ga0207679_100179625 138
104 3300025961 Ga0207712_10066444 Ga0207712_100664442 138
105 3300025972 Ga0207668_10106674 Ga0207668_101066742 138
106 3300025981 Ga0207640_10010938 Ga0207640_100109382 138
107 3300025986 Ga0207658_11040058 Ga0207658_110400581 138
108 3300026023 Ga0207677_10003912 Ga0207677_100039123 138
109 3300026023 Ga0207677_10101584 Ga0207677_101015842 138
110 3300026035 Ga0207703_10565401 Ga0207703_105654012 138
111 3300026041 Ga0207639_10085502 Ga0207639_100855023 138
112 3300026041 Ga0207639_10452360 Ga0207639_104523602 138
113 3300026067 Ga0207678_10004621 Ga0207678_1000462113 138
114 3300026075 Ga0207708_10004311 Ga0207708_100043116 138
115 3300026078 Ga0207702_11601522 Ga0207702_116015221 138
116 3300026089 Ga0207648_10071665 Ga0207648_100716653 138
117 3300028556 Ga0265337_1000074 Ga0265337_100007444 138
118 3300028558 Ga0265326_10000035 Ga0265326_1000003529 138
119 3300028653 Ga0265323_10094192 Ga0265323_100941922 138
120 3300028654 Ga0265322_10000009 Ga0265322_10000009110 138
121 3300028666 Ga0265336_10109224 Ga0265336_101092241 138
122 3300029957 Ga0265324_10000168 Ga0265324_100001689 138
123 3300031239 Ga0265328_10000939 Ga0265328_1000093911 138
124 3300031240 Ga0265320_10000024 Ga0265320_1000002465 138
125 3300031242 Ga0265329_10004276 Ga0265329_100042768 138
126 3300031249 Ga0265339_10011049 Ga0265339_100110495 138
127 3300031250 Ga0265331_10005065 Ga0265331_100050659 138
128 3300031251 Ga0265327_10000227 Ga0265327_1000022766 138
129 3300031344 Ga0265316_10018834 Ga0265316_100188346 138
130 3300031711 Ga0265314_10000647 Ga0265314_1000064739 138
131 3300031712 Ga0265342_10138236 Ga0265342_101382362 138
132 3300031852 Ga0307410_10771122 Ga0307410_107711221 138
133 3300031901 Ga0307406_10035028 Ga0307406_100350282 138
134 3300031901 Ga0307406_10793594 Ga0307406_107935942 138
135 3300032002 Ga0307416_100348316 Ga0307416_1003483162 138
136 3300032126 Ga0307415_100079329 Ga0307415_1000793292 138
137 3300046455 Ga0495603_0000054 Ga0495603_0000054_34582_35016 138
138 3300046463 Ga0495653_0715024 Ga0495653_0715024_166_597 138
139 3300046536 Ga0495587_0129099 Ga0495587_0129099_24_455 138
140 3300046543 Ga0495645_0484763 Ga0495645_0484763_267_698 138
141 3300046689 Ga0495613_0018352 Ga0495613_0018352_411_842 138
142 3300047319 Ga0495674_0001786 Ga0495674_0001786_18243_18674 138
143 3300048906 Ga0496103_0299680 Ga0496103_0299680_469_900 138
144 3300048906 Ga0496103_0816650 Ga0496103_0816650_135_563 138
145 3300048907 Ga0496104_0000307 Ga0496104_0000307_14583_15014 138
146 3300048908 Ga0496105_0000070 Ga0496105_0000070_26211_26642 138
147 3300048916 Ga0496113_1297707 Ga0496113_1297707_127_555 138
148 3300048921 Ga0496118_0279205 Ga0496118_0279205_200_631 138
149 3300048924 Ga0496121_0289667 Ga0496121_0289667_660_1100 138
150 3300049568 Ga0501031_0002389 Ga0501031_0002389_1764_2192 138
151 3300049569 Ga0501032_0002564 Ga0501032_0002564_12059_12487 138
152 3300049570 Ga0501033_0085780 Ga0501033_0085780_117_545 138
153 3300049571 Ga0501034_0019089 Ga0501034_0019089_1754_2182 138
154 3300049572 Ga0501036_0006591 Ga0501036_0006591_1726_2154 138
155 3300049573 Ga0501037_0003409 Ga0501037_0003409_9401_9829 138
156 3300049574 Ga0501038_0109525 Ga0501038_0109525_1754_2182 138
157 3300049575 Ga0501039_0092234 Ga0501039_0092234_1815_2243 138
158 3300049578 Ga0501042_0080329 Ga0501042_0080329_93_521 138
159 3300049579 Ga0501043_0085553 Ga0501043_0085553_321_749 138
160 3300049580 Ga0501046_0002906 Ga0501046_0002906_13701_14129 138
161 3300049581 Ga0501047_0004514 Ga0501047_0004514_1754_2182 138
162 3300049582 Ga0501048_0002887 Ga0501048_0002887_10934_11362 138
163 3300049583 Ga0501067_0039235 Ga0501067_0039235_1914_2342 138
164 3300049584 Ga0501068_0030303 Ga0501068_0030303_1721_2149 138
165 3300049585 Ga0501069_0052689 Ga0501069_0052689_75_503 138
166 3300049585 Ga0501069_0126089 Ga0501069_0126089_993_1421 138
167 3300049585 Ga0501069_0459380 Ga0501069_0459380_317_745 138
168 3300049586 Ga0501070_0004138 Ga0501070_0004138_10310_10738 138
169 3300049587 Ga0501071_0091086 Ga0501071_0091086_1744_2172 138
170 3300049589 Ga0501073_0064789 Ga0501073_0064789_1726_2154 138
171 3300049590 Ga0501074_0010118 Ga0501074_0010118_1754_2182 138
172 3300049741 Ga0501079_0099701 Ga0501079_0099701_89_517 138
173 3300049742 Ga0501080_0025145 Ga0501080_0025145_18_446 138
174 3300049744 Ga0501083_0062460 Ga0501083_0062460_1723_2151 138
175 3300049822 Ga0501035_0006173 Ga0501035_0006173_9098_9526 138
176 3300049823 Ga0501044_0007279 Ga0501044_0007279_1754_2182 138
177 3300053077 Ga0495601_0007034 Ga0495601_0007034_2087_2518 138
178 3300053077 Ga0495601_0051753 Ga0495601_0051753_50_481 138
179 3300053083 Ga0495655_0105694 Ga0495655_0105694_395_823 138
180 3300060353 Ga0501082_0110822 Ga0501082_0110822_132_560 138
181 3300013307 Ga0157372_10097670 Ga0157372_100976701 140
182 3300013307 Ga0157372_10426601 Ga0157372_104266011 140
183 3300049656 Ga0501209_003280 Ga0501209_003280_1974_2411 140
184 3300049674 Ga0501242_000255 Ga0501242_000255_2574_3011 140
185 3300049675 Ga0501243_001894 Ga0501243_001894_1711_2148 140
186 3300049679 Ga0501249_016928 Ga0501249_016928_820_1257 140
187 3300049682 Ga0501252_007315 Ga0501252_007315_171_608 140
188 3300049686 Ga0501257_017893 Ga0501257_017893_53_490 140
189 3300049688 Ga0501259_002665 Ga0501259_002665_1719_2156 140
190 3300049690 Ga0501261_009299 Ga0501261_009299_562_999 140
191 3300049708 Ga0501245_003636 Ga0501245_003636_763_1200 140
192 3300049761 Ga0501264_006065 Ga0501264_006065_349_786 140
193 3300049763 Ga0501266_000639 Ga0501266_000639_2639_3076 140
194 3300049764 Ga0501267_024515 Ga0501267_024515_71_508 140
195 3300049765 Ga0501268_009947 Ga0501268_009947_628_1065 140
196 3300049850 Ga0501204_054821 Ga0501204_054821_16_453 140
197 3300049851 Ga0501212_021593 Ga0501212_021593_309_746 140
198 3300009148 Ga0105243_10022821 Ga0105243_100228215 142
199 3300014326 Ga0157380_10000009 Ga0157380_1000000967 142
200 3300025898 Ga0207692_10189824 Ga0207692_101898242 142
201 3300025935 Ga0207709_10024049 Ga0207709_100240495 142
202 3300046690 Ga0495624_0003396 Ga0495624_0003396_7024_7482 142
203 3300048912 Ga0496109_0000106 Ga0496109_0000106_82640_83098 142
204 3300049584 Ga0501068_0091630 Ga0501068_0091630_91_549 142
205 3300005328 Ga0070676_10891745 Ga0070676_108917451 144
206 3300005530 Ga0070679_100237933 Ga0070679_1002379333 144
207 3300005535 Ga0070684_100432266 Ga0070684_1004322661 144
208 3300005577 Ga0068857_100335098 Ga0068857_1003350983 144
209 3300009098 Ga0105245_10073844 Ga0105245_100738442 144
210 3300009098 Ga0105245_11996910 Ga0105245_119969102 144
211 3300009148 Ga0105243_10005188 Ga0105243_1000518810 144
212 3300009553 Ga0105249_10054170 Ga0105249_100541704 144
213 3300010375 Ga0105239_10090385 Ga0105239_100903853 144
214 3300013307 Ga0157372_10359094 Ga0157372_103590943 144
215 3300013308 Ga0157375_10077397 Ga0157375_100773972 144
216 3300014325 Ga0163163_10078229 Ga0163163_100782293 144
217 3300014326 Ga0157380_10017839 Ga0157380_100178395 144
218 3300014745 Ga0157377_10021854 Ga0157377_100218542 144
219 3300014968 Ga0157379_10776417 Ga0157379_107764172 144
220 3300046511 Ga0495608_0772730 Ga0495608_0772730_36_482 144
221 3300046533 Ga0495640_0436369 Ga0495640_0436369_182_628 144
222 3300046663 Ga0495635_0759371 Ga0495635_0759371_145_591 144
223 3300048912 Ga0496109_0248293 Ga0496109_0248293_291_737 144
224 3300048913 Ga0496110_0098235 Ga0496110_0098235_1205_1651 144
225 3300048914 Ga0496111_0003706 Ga0496111_0003706_2912_3358 144
226 3300046674 Ga0495588_0000278 Ga0495588_0000278_3148_3624 146
227 3300037471 Ga0395905_0026420 Ga0395905_0026420_4803_5282 148
228 3300047317 Ga0495604_0000078 Ga0495604_0000078_17102_17563 148
229 3300006048 Ga0075363_100177568 Ga0075363_1001775682 149
230 3300031727 Ga0316576_10149306 Ga0316576_101493062 149
231 3300031728 Ga0316578_10075298 Ga0316578_100752983 149
232 3300031852 Ga0307410_11235118 Ga0307410_112351182 149
233 3300032133 Ga0316583_10108680 Ga0316583_101086802 149
234 3300032137 Ga0316585_10053823 Ga0316585_100538232 149
235 3300032139 Ga0316580_10069223 Ga0316580_100692232 149
236 3300035398 Ga0316574_0033156 Ga0316574_0033156_565_1053 149
237 3300036647 Ga0316582_0005652 Ga0316582_0005652_3202_3690 149
238 3300036401 Ga0373937_1651679 Ga0373937_1651679_89_556 150
239 3300046809 Ga0495600_0009512 Ga0495600_0009512_2385_2861 150
240 3300001977 JGI24746J21847_1000015 JGI24746J21847_100001512 151
241 3300005329 Ga0070683_100032357 Ga0070683_1000323574 151
242 3300005338 Ga0068868_100000314 Ga0068868_10000031423 151
243 3300005406 Ga0070703_10070063 Ga0070703_100700632 151
244 3300005455 Ga0070663_100071918 Ga0070663_1000719183 151
245 3300005457 Ga0070662_100000079 Ga0070662_10000007911 151
246 3300005535 Ga0070684_100025825 Ga0070684_1000258252 151
247 3300005539 Ga0068853_100484249 Ga0068853_1004842492 151
248 3300005547 Ga0070693_100002093 Ga0070693_1000020937 151
249 3300005549 Ga0070704_100461701 Ga0070704_1004617011 151
250 3300005615 Ga0070702_100603920 Ga0070702_1006039201 151
251 3300005842 Ga0068858_100000178 Ga0068858_10000017817 151
252 3300006173 Ga0070716_100862254 Ga0070716_1008622541 151
253 3300006847 Ga0075431_100152670 Ga0075431_1001526702 151
254 3300006852 Ga0075433_10063671 Ga0075433_100636712 151
255 3300006871 Ga0075434_100002798 Ga0075434_10000279816 151
256 3300006914 Ga0075436_100225679 Ga0075436_1002256793 151
257 3300007076 Ga0075435_100448115 Ga0075435_1004481152 151
258 3300009147 Ga0114129_10003248 Ga0114129_1000324814 151
259 3300009553 Ga0105249_10000039 Ga0105249_1000003994 151
260 3300014325 Ga0163163_10844670 Ga0163163_108446702 151
261 3300014326 Ga0157380_10000277 Ga0157380_1000027712 151
262 3300014968 Ga0157379_10069180 Ga0157379_100691805 151
263 3300025893 Ga0207682_10000007 Ga0207682_1000000759 151
264 3300025933 Ga0207706_10000302 Ga0207706_1000030250 151
265 3300025938 Ga0207704_10000009 Ga0207704_1000000958 151
266 3300025939 Ga0207665_10197650 Ga0207665_101976502 151
267 3300025961 Ga0207712_10000003 Ga0207712_10000003109 151
268 3300026023 Ga0207677_10000218 Ga0207677_1000021830 151
269 3300026035 Ga0207703_10000381 Ga0207703_1000038116 151
270 3300031995 Ga0307409_101384881 Ga0307409_1013848811 151
271 3300035398 Ga0316574_0259341 Ga0316574_0259341_52_570 151
272 3300038443 Ga0395901_0763342 Ga0395901_0763342_412_882 151
273 3300044842 Ga0466957_0561130 Ga0466957_0561130_60_551 151
274 3300045976 Ga0466967_0081203 Ga0466967_0081203_1256_1729 151
275 3300046476 Ga0495662_0004031 Ga0495662_0004031_3817_4296 151
276 3300046499 Ga0495594_0000007 Ga0495594_0000007_153936_154406 151
277 3300046500 Ga0495596_0274175 Ga0495596_0274175_26_493 151
278 3300046511 Ga0495608_0102509 Ga0495608_0102509_879_1346 151
279 3300046514 Ga0495618_0630975 Ga0495618_0630975_35_514 151
280 3300046537 Ga0495598_0003049 Ga0495598_0003049_1151_1618 151
281 3300046557 Ga0495622_0000437 Ga0495622_0000437_21139_21609 151
282 3300046615 Ga0495656_0034656 Ga0495656_0034656_1494_1979 151
283 3300046616 Ga0495668_0306469 Ga0495668_0306469_82_549 151
284 3300046663 Ga0495635_0036986 Ga0495635_0036986_764_1234 151
285 3300048903 Ga0496100_0000004 Ga0496100_0000004_213966_214433 151
286 3300048903 Ga0496100_0359315 Ga0496100_0359315_490_957 151
287 3300048904 Ga0496101_0000007 Ga0496101_0000007_213966_214433 151
288 3300048905 Ga0496102_0161367 Ga0496102_0161367_1239_1775 151
289 3300048905 Ga0496102_0243689 Ga0496102_0243689_80_547 151
290 3300048907 Ga0496104_0000003 Ga0496104_0000003_587732_588199 151
291 3300048908 Ga0496105_0000003 Ga0496105_0000003_597922_598389 151
292 3300048909 Ga0496106_0000004 Ga0496106_0000004_175380_175847 151
293 3300048910 Ga0496107_0000001 Ga0496107_0000001_213966_214433 151
294 3300048910 Ga0496107_0849986 Ga0496107_0849986_116_583 151
295 3300048911 Ga0496108_0000002 Ga0496108_0000002_663557_664024 151
296 3300048911 Ga0496108_0000202 Ga0496108_0000202_50373_50840 151
297 3300048911 Ga0496108_0047000 Ga0496108_0047000_1987_2454 151
298 3300048912 Ga0496109_0000001 Ga0496109_0000001_663519_663986 151
299 3300048912 Ga0496109_0000131 Ga0496109_0000131_35562_36029 151
300 3300048912 Ga0496109_0038060 Ga0496109_0038060_133_600 151
301 3300048916 Ga0496113_0023287 Ga0496113_0023287_2226_2693 151
302 3300048918 Ga0496115_0024022 Ga0496115_0024022_3969_4439 151
303 3300048928 Ga0496125_0460075 Ga0496125_0460075_158_625 151
304 3300049578 Ga0501042_0145106 Ga0501042_0145106_1086_1556 151
305 3300049584 Ga0501068_0094640 Ga0501068_0094640_1302_1787 151
306 3300049591 Ga0501075_0016038 Ga0501075_0016038_832_1299 151
307 3300050507 nmdc:mga05p37_12316_c1 nmdc:mga05p37_12316_c1_27_494 151
308 3300050510 nmdc:mga06r32_299352_c1 nmdc:mga06r32_299352_c1_934_1401 151
309 3300050512 nmdc:mga0n895_13573_c1 nmdc:mga0n895_13573_c1_1870_2337 151
310 3300050514 nmdc:mga08x19_355995_c1 nmdc:mga08x19_355995_c1_167_634 151
311 3300050515 nmdc:mga0a205_67610_c1 nmdc:mga0a205_67610_c1_354_821 151
312 3300053077 Ga0495601_0024999 Ga0495601_0024999_1767_2246 151
313 3300053085 Ga0495619_0000060 Ga0495619_0000060_14734_15201 151
314 3300053085 Ga0495619_0002877 Ga0495619_0002877_7494_7961 151
315 3300053085 Ga0495619_0006523 Ga0495619_0006523_3860_4330 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

25

172

0.98

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

24

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xpw-assembly1.cif.gz_A-2 structure of amphioxus igvj-c2 molecule 0.9893 32 45
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9801 10 147
5xpv-assembly1.cif.gz_B structure of the v domain of amphioxus igvj-c2 0.9797 32 45
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9792 10 147
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9791 10 147
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.986 50 107 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9806 8 147 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9787 10 147 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9764 7 147 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9738 10 147 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A838V119-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9866 7 148 GO:0002100
GO:0008270
GO:0052717
AF-A0A2V8QMJ3-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9836 10 147 GO:0002100
GO:0008270
GO:0052717
AF-A0A2N6EV60-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9831 9 147 GO:0002100
GO:0008270
GO:0052717
AF-A0A2Z5U1G1-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9831 7 147 GO:0002100
GO:0008270
GO:0052717
AF-A8AUL4-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9828 7 147 GO:0002100
GO:0008270
GO:0052717

Feature Viewer

pLDDT pTM Quality
92.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map