F403206

General Info

Members Datasets Scaffolds Average Seq Length
315 148 630 80

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10124820|Ga0207646_101248202
Length 97
Sequence MSTIQVDKTIDARGMACPGPLMALIGAIRQGQVGERFEVLSSDEGSKTDIPAWVAKAKQELVEVVPDDGYSRFIVRKRGPREIEDFVGSEGEVRHGC

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
72 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
73 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
78 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
79 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
80 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
81 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.44
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 30.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10124820 3300025922 Bacteria 2314
2 MBSR1b_contig_7017827 2162886012 Bacteria 1060
3 Ga0065712_10159407 3300005290 Unclassified 1312
4 Ga0065707_10137128 3300005295 Unclassified 1824
5 Ga0065707_10879161 3300005295 Unclassified 573
6 Ga0068868_100186662 3300005338 Bacteria 1723
7 Ga0068868_100546738 3300005338 Unclassified 1020
8 Ga0070689_100323994 3300005340 Archaea 1287
9 Ga0070687_101426212 3300005343 Unclassified 518
10 Ga0070709_10107004 3300005434 Unclassified 1873
11 Ga0070709_10141774 3300005434 Unclassified 1652
12 Ga0070709_11574843 3300005434 Unclassified 535
13 Ga0070714_100000001 3300005435 Bacteria 469087
14 Ga0070714_100014238 3300005435 Bacteria 6387
15 Ga0070714_100024950 3300005435 Bacteria 4930
16 Ga0070714_100070630 3300005435 Unclassified 3018
17 Ga0070714_100318973 3300005435 Bacteria 1453
18 Ga0070714_101143879 3300005435 Unclassified 759
19 Ga0070714_101311141 3300005435 Bacteria 707
20 Ga0070714_102130344 3300005435 Bacteria 546
21 Ga0070713_100003108 3300005436 Bacteria 10918
22 Ga0070713_100069787 3300005436 Bacteria 2964
23 Ga0070713_100097626 3300005436 Bacteria 2539
24 Ga0070713_100925312 3300005436 Unclassified 839
25 Ga0070713_101037107 3300005436 Bacteria 792
26 Ga0070713_101335671 3300005436 Unclassified 695
27 Ga0070710_10253641 3300005437 Bacteria 1132
28 Ga0070711_100752663 3300005439 Bacteria 823
29 Ga0070705_100494189 3300005440 Viruses 927
30 Ga0070694_100297072 3300005444 Bacteria 1236
31 Ga0070708_100000214 3300005445 Bacteria 43022
32 Ga0070708_100004063 3300005445 Bacteria 11497
33 Ga0070708_100008964 3300005445 Bacteria 8060
34 Ga0070708_100011528 3300005445 Bacteria 7195
35 Ga0070708_100013982 3300005445 Bacteria 6593
36 Ga0070708_100214682 3300005445 Unclassified 1803
37 Ga0070708_100302293 3300005445 Bacteria 1506
38 Ga0070708_100328148 3300005445 Unclassified 1442
39 Ga0070708_100878182 3300005445 Bacteria 842
40 Ga0070708_100922613 3300005445 Bacteria 820
41 Ga0070678_100784085 3300005456 Bacteria 864
42 Ga0068867_101059916 3300005459 Bacteria 738
43 Ga0070706_100000215 3300005467 Bacteria 71421
44 Ga0070706_100000342 3300005467 Bacteria 56147
45 Ga0070706_100003001 3300005467 Bacteria 16720
46 Ga0070706_100012841 3300005467 Bacteria 7753
47 Ga0070706_100071595 3300005467 Bacteria 3207
48 Ga0070706_100168606 3300005467 Bacteria 2044
49 Ga0070706_100552136 3300005467 Bacteria 1071
50 Ga0070707_100000782 3300005468 Bacteria 31457
51 Ga0070707_100001474 3300005468 Bacteria 23038
52 Ga0070707_100006303 3300005468 Bacteria 11035
53 Ga0070707_100012468 3300005468 Bacteria 7940
54 Ga0070707_100012861 3300005468 Bacteria 7816
55 Ga0070707_100022841 3300005468 Bacteria 5914
56 Ga0070707_100055984 3300005468 Bacteria 3781
57 Ga0070707_100079871 3300005468 Bacteria 3157
58 Ga0070707_100188936 3300005468 Bacteria 2008
59 Ga0070707_100302509 3300005468 Bacteria 1554
60 Ga0070707_102202448 3300005468 Unclassified 519
61 Ga0070707_102226650 3300005468 Unclassified 515
62 Ga0070698_100004527 3300005471 Bacteria 15274
63 Ga0070698_100005824 3300005471 Bacteria 13484
64 Ga0070698_100006619 3300005471 Bacteria 12564
65 Ga0070698_100071379 3300005471 Unclassified 3482
66 Ga0070698_100145840 3300005471 Unclassified 2316
67 Ga0070698_100270794 3300005471 Bacteria 1630
68 Ga0070698_100302770 3300005471 Unclassified 1529
69 Ga0070698_100339998 3300005471 Bacteria 1432
70 Ga0070698_100917984 3300005471 Bacteria 821
71 Ga0070698_101322028 3300005471 Bacteria 671
72 Ga0070699_100002683 3300005518 Bacteria 15905
73 Ga0070699_100009375 3300005518 Bacteria 8479
74 Ga0070699_100385196 3300005518 Bacteria 1266
75 Ga0070697_100000060 3300005536 Bacteria 86138
76 Ga0070697_100007359 3300005536 Bacteria 8564
77 Ga0070697_100010249 3300005536 Bacteria 7303
78 Ga0070672_100679993 3300005543 Unclassified 900
79 Ga0070695_100764976 3300005545 Unclassified 771
80 Ga0070695_100991489 3300005545 Unclassified 683
81 Ga0070696_100095194 3300005546 Bacteria 2126
82 Ga0070696_100544210 3300005546 Unclassified 929
83 Ga0070704_100003389 3300005549 Bacteria 9134
84 Ga0070704_100011929 3300005549 Bacteria 5352
85 Ga0070704_100680075 3300005549 Unclassified 911
86 Ga0070704_101309806 3300005549 Bacteria 663
87 Ga0068855_102236585 3300005563 Bacteria 548
88 Ga0068856_100022030 3300005614 Bacteria 6196
89 Ga0068859_102551353 3300005617 Bacteria 562
90 Ga0070717_10000078 3300006028 Bacteria 80104
91 Ga0070717_10001123 3300006028 Bacteria 18092
92 Ga0070717_10001401 3300006028 Bacteria 16620
93 Ga0070717_10001709 3300006028 Bacteria 15302
94 Ga0070717_10004633 3300006028 Bacteria 9966
95 Ga0070717_10143084 3300006028 Bacteria 2064
96 Ga0070717_10185337 3300006028 Bacteria 1816
97 Ga0070717_10559417 3300006028 Bacteria 1036
98 Ga0070717_10577614 3300006028 Bacteria 1019
99 Ga0070715_10010691 3300006163 Bacteria 3279
100 Ga0070716_100000589 3300006173 Bacteria 15280
101 Ga0070716_100075006 3300006173 Bacteria 2000
102 Ga0070716_100156562 3300006173 Bacteria 1472
103 Ga0070716_100166423 3300006173 Bacteria 1434
104 Ga0070716_100233617 3300006173 Bacteria 1243
105 Ga0070712_100167418 3300006175 Bacteria 1702
106 Ga0070712_100245096 3300006175 Bacteria 1429
107 Ga0070712_100302010 3300006175 Unclassified 1296
108 Ga0070712_100559620 3300006175 Bacteria 964
109 Ga0070712_101210694 3300006175 Unclassified 657
110 Ga0075428_100227104 3300006844 Unclassified 2015
111 Ga0075431_100010502 3300006847 Bacteria 9309
112 Ga0075433_10037944 3300006852 Bacteria 4159
113 Ga0075433_11085584 3300006852 Bacteria 696
114 Ga0075429_100001254 3300006880 Bacteria 20628
115 Ga0075436_100016237 3300006914 Bacteria 5097
116 Ga0075436_100018023 3300006914 Bacteria 4835
117 Ga0075436_100042199 3300006914 Bacteria 3146
118 Ga0097620_102551328 3300006931 Bacteria 562
119 Ga0075435_100561271 3300007076 Bacteria 989
120 Ga0105245_10111484 3300009098 Unclassified 2544
121 Ga0114129_10003725 3300009147 Bacteria 21496
122 Ga0157373_10505827 3300013100 Unclassified 873
123 Ga0157370_10656613 3300013104 Bacteria 958
124 Ga0157374_10791266 3300013296 Unclassified 964
125 Ga0157377_11388263 3300014745 Unclassified 553
126 Ga0207653_10000233 3300025885 Bacteria 36792
127 Ga0207692_10094878 3300025898 Bacteria 1625
128 Ga0207685_10000765 3300025905 Bacteria 5894
129 Ga0207699_10000055 3300025906 Bacteria 97936
130 Ga0207699_10200406 3300025906 Unclassified 1352
131 Ga0207699_11256632 3300025906 Unclassified 548
132 Ga0207684_10000012 3300025910 Bacteria 478666
133 Ga0207684_10000013 3300025910 Bacteria 443468
134 Ga0207684_10000233 3300025910 Bacteria 84435
135 Ga0207684_10001510 3300025910 Bacteria 24938
136 Ga0207684_10003900 3300025910 Bacteria 14297
137 Ga0207684_10009720 3300025910 Bacteria 8481
138 Ga0207684_10058384 3300025910 Bacteria 3274
139 Ga0207684_10613428 3300025910 Bacteria 929
140 Ga0207684_11154369 3300025910 Bacteria 643
141 Ga0207684_11380743 3300025910 Bacteria 577
142 Ga0207693_10023053 3300025915 Bacteria 4944
143 Ga0207693_10541900 3300025915 Unclassified 908
144 Ga0207693_10821083 3300025915 Unclassified 716
145 Ga0207693_11121010 3300025915 Unclassified 597
146 Ga0207663_10009992 3300025916 Bacteria 5027
147 Ga0207663_10764825 3300025916 Unclassified 768
148 Ga0207646_10000063 3300025922 Bacteria 150574
149 Ga0207646_10000823 3300025922 Bacteria 40335
150 Ga0207646_10004979 3300025922 Bacteria 14189
151 Ga0207646_10008673 3300025922 Bacteria 10155
152 Ga0207646_10008800 3300025922 Bacteria 10074
153 Ga0207646_10009543 3300025922 Bacteria 9582
154 Ga0207646_10012052 3300025922 Bacteria 8325
155 Ga0207646_10016359 3300025922 Bacteria 6961
156 Ga0207646_10041867 3300025922 Unclassified 4115
157 Ga0207646_10182077 3300025922 Unclassified 1898
158 Ga0207646_10204206 3300025922 Unclassified 1785
159 Ga0207646_10251738 3300025922 Bacteria 1596
160 Ga0207646_10520525 3300025922 Unclassified 1071
161 Ga0207646_11309383 3300025922 Bacteria 632
162 Ga0207646_11481721 3300025922 Bacteria 588
163 Ga0207646_11783800 3300025922 Unclassified 527
164 Ga0207687_10063677 3300025927 Bacteria 2611
165 Ga0207700_10002314 3300025928 Bacteria 10930
166 Ga0207700_10080425 3300025928 Unclassified 2541
167 Ga0207700_10751959 3300025928 Bacteria 871
168 Ga0207700_10858060 3300025928 Unclassified 812
169 Ga0207700_10874484 3300025928 Bacteria 804
170 Ga0207700_11838127 3300025928 Unclassified 532
171 Ga0207664_10000010 3300025929 Bacteria 298623
172 Ga0207664_10000291 3300025929 Bacteria 37556
173 Ga0207664_10104251 3300025929 Unclassified 2348
174 Ga0207664_10521271 3300025929 Unclassified 1065
175 Ga0207664_10644147 3300025929 Bacteria 952
176 Ga0207664_10906200 3300025929 Bacteria 792
177 Ga0207664_11690652 3300025929 Bacteria 555
178 Ga0207664_11795542 3300025929 Unclassified 536
179 Ga0207670_10353132 3300025936 Archaea 1165
180 Ga0207665_10012313 3300025939 Bacteria 5618
181 Ga0207665_10028979 3300025939 Bacteria 3660
182 Ga0207665_10098494 3300025939 Bacteria 2037
183 Ga0207665_10133633 3300025939 Bacteria 1763
184 Ga0207665_10164113 3300025939 Bacteria 1600
185 Ga0207665_10243940 3300025939 Bacteria 1325
186 Ga0207665_11476424 3300025939 Bacteria 540
187 Ga0207689_10521020 3300025942 Unclassified 997
188 Ga0207667_11769153 3300025949 Bacteria 583
189 Ga0207651_11239202 3300025960 Bacteria 670
190 Ga0207640_10390676 3300025981 Bacteria 1130
191 Ga0207677_10102296 3300026023 Bacteria 2112
192 Ga0207677_10457436 3300026023 Unclassified 1095
193 Ga0207702_12476722 3300026078 Unclassified 505
194 Ga0207648_12244374 3300026089 Bacteria 506
195 Ga0207683_10654620 3300026121 Bacteria 973
196 Ga0209999_1118098 3300027543 Unclassified 519
197 Ga0307413_11028464 3300031824 Bacteria 708
198 Ga0307406_10465218 3300031901 Unclassified 1018
199 Ga0307415_100917016 3300032126 Unclassified 809
200 Ga0373944_0255108 3300035089 Unclassified 648
201 Ga0373949_0264441 3300035090 Unclassified 536
202 Ga0373941_0061357 3300035115 Unclassified 1224
203 Ga0373943_0052233 3300035170 Bacteria 2015
204 Ga0373943_0106682 3300035170 Bacteria 1472
205 Ga0373943_0230408 3300035170 Bacteria 1035
206 Ga0373935_0219615 3300035692 Bacteria 1320
207 Ga0373925_0176321 3300037068 Bacteria 1690
208 Ga0373925_0936872 3300037068 Bacteria 714
209 Ga0439461_0051581 3300041410 Bacteria 914
210 Ga0439441_007466 3300042001 Unclassified 1762
211 Ga0439443_107811 3300042003 Bacteria 538
212 Ga0439435_0081475 3300042436 Bacteria 972
213 Ga0439460_0052979 3300042461 Bacteria 1221
214 Ga0495603_0024248 3300046455 Bacteria 3669
215 Ga0495603_0027942 3300046455 Unclassified 3402
216 Ga0495603_0037695 3300046455 Bacteria 2900
217 Ga0495603_0082873 3300046455 Unclassified 1878
218 Ga0495603_0199794 3300046455 Bacteria 1155
219 Ga0495641_0017744 3300046461 Bacteria 3697
220 Ga0495639_0274643 3300046475 Unclassified 837
221 Ga0495662_0040587 3300046476 Unclassified 2247
222 Ga0495662_0300324 3300046476 Unclassified 790
223 Ga0495618_0082979 3300046514 Bacteria 2047
224 Ga0495630_0244054 3300046517 Unclassified 1372
225 Ga0495663_0137299 3300046525 Unclassified 828
226 Ga0495665_0188416 3300046531 Bacteria 1071
227 Ga0495586_0224765 3300046535 Unclassified 1067
228 Ga0495609_0346848 3300046538 Unclassified 599
229 Ga0495645_0113784 3300046543 Bacteria 1913
230 Ga0495633_0570408 3300046558 Unclassified 509
231 Ga0495647_0505875 3300046681 Unclassified 563
232 Ga0495658_0604896 3300046683 Bacteria 702
233 Ga0495613_0014075 3300046689 Bacteria 5937
234 Ga0495613_1121614 3300046689 Unclassified 501
235 Ga0495600_0440746 3300046809 Unclassified 806
236 Ga0495581_0192179 3300047315 Bacteria 1194
237 Ga0495676_0045984 3300047321 Bacteria 3548
238 Ga0495676_0160883 3300047321 Unclassified 1589
239 Ga0495676_0322918 3300047321 Bacteria 1037
240 Ga0495676_0541453 3300047321 Bacteria 761
241 Ga0495684_0106131 3300047471 Bacteria 2122
242 Ga0496100_0277674 3300048903 Bacteria 1248
243 Ga0496105_0232199 3300048908 Bacteria 1499
244 Ga0496105_1183804 3300048908 Unclassified 563
245 Ga0496107_1268207 3300048910 Unclassified 528
246 Ga0496108_0056180 3300048911 Bacteria 3307
247 Ga0496109_0051907 3300048912 Bacteria 3736
248 Ga0496109_1352887 3300048912 Unclassified 648
249 Ga0496110_0027867 3300048913 Bacteria 4847
250 Ga0496111_0144023 3300048914 Bacteria 1766
251 Ga0496112_0018233 3300048915 Bacteria 6608
252 Ga0496113_0125209 3300048916 Bacteria 2012
253 Ga0496113_0538144 3300048916 Unclassified 937
254 Ga0496114_0601219 3300048917 Unclassified 970
255 Ga0496115_1295578 3300048918 Unclassified 543
256 Ga0501031_0250480 3300049568 Bacteria 1151
257 Ga0501031_0372120 3300049568 Unclassified 924
258 Ga0501032_0674900 3300049569 Bacteria 656
259 Ga0501034_0775784 3300049571 Bacteria 853
260 Ga0501036_0264677 3300049572 Bacteria 1440
261 Ga0501036_0340515 3300049572 Unclassified 1252
262 Ga0501036_0482690 3300049572 Bacteria 1032
263 Ga0501036_1185638 3300049572 Bacteria 622
264 Ga0501038_1363445 3300049574 Unclassified 510
265 Ga0501039_0211183 3300049575 Unclassified 1526
266 Ga0501040_0028930 3300049576 Bacteria 3737
267 Ga0501040_0063493 3300049576 Bacteria 2542
268 Ga0501041_0056529 3300049577 Bacteria 2398
269 Ga0501042_0015751 3300049578 Bacteria 5182
270 Ga0501042_0269986 3300049578 Bacteria 1228
271 Ga0501042_0434528 3300049578 Unclassified 952
272 Ga0501043_0370750 3300049579 Unclassified 1085
273 Ga0501046_0258123 3300049580 Bacteria 1281
274 Ga0501046_0359530 3300049580 Bacteria 1056
275 Ga0501048_0122378 3300049582 Unclassified 1839
276 Ga0501048_0149709 3300049582 Bacteria 1651
277 Ga0501048_0186575 3300049582 Unclassified 1470
278 Ga0501068_0247805 3300049584 Bacteria 1135
279 Ga0501070_0647004 3300049586 Bacteria 840
280 Ga0501071_0682098 3300049587 Unclassified 791
281 Ga0501071_0890484 3300049587 Bacteria 687
282 Ga0501072_0156547 3300049588 Bacteria 1817
283 Ga0501072_0967627 3300049588 Bacteria 664
284 Ga0501075_0028608 3300049591 Bacteria 4114
285 Ga0501075_0175428 3300049591 Bacteria 1636
286 Ga0501075_0721943 3300049591 Bacteria 759
287 Ga0501075_0819589 3300049591 Unclassified 708
288 Ga0501076_0053455 3300049592 Bacteria 3201
289 Ga0501076_0289679 3300049592 Unclassified 1341
290 Ga0501077_0235072 3300049593 Archaea 1165
291 Ga0501079_0241857 3300049741 Unclassified 1410
292 Ga0501079_0253725 3300049741 Bacteria 1375
293 Ga0501080_0178901 3300049742 Bacteria 1953
294 Ga0501081_0026528 3300049743 Bacteria 3908
295 Ga0501081_1086503 3300049743 Bacteria 605
296 Ga0501083_0061083 3300049744 Unclassified 2516
297 Ga0501035_1507944 3300049822 Bacteria 512
298 Ga0501045_0157399 3300049824 Unclassified 1690
299 nmdc:mga05p37_2472_c1 3300050507 Bacteria 21504
300 nmdc:mga09592_4579_c1 3300050508 Bacteria 11192
301 nmdc:mga06r32_21864_c1 3300050510 Bacteria 5907
302 nmdc:mga0rr50_887934_c1 3300050513 Bacteria 760
303 nmdc:mga08x19_221502_c1 3300050514 Bacteria 1300
304 nmdc:mga0a205_1546818_c1 3300050515 Unclassified 512
305 nmdc:mga0a205_53752_c1 3300050515 Bacteria 3887
306 Ga0495601_0000499 3300053077 Bacteria 20572
307 Ga0495595_0009070 3300053084 Bacteria 4108
308 Ga0495619_0017448 3300053085 Bacteria 4544
309 Ga0501084_0493884 3300054114 Bacteria 1034
310 Ga0501084_0631564 3300054114 Unclassified 904
311 Ga0501084_1371009 3300054114 Unclassified 592
312 Ga0501082_0233797 3300060353 Bacteria 1599
313 Ga0501082_0868737 3300060353 Unclassified 789
314 Ga0530510_0039326 3300061734 Bacteria 3414
315 Ga0530510_1190420 3300061734 Unclassified 584
316 Ga0207646_10124820
317 MBSR1b_contig_7017827
318 Ga0065712_10159407
319 Ga0065707_10137128
320 Ga0065707_10879161
321 Ga0068868_100186662
322 Ga0068868_100546738
323 Ga0070689_100323994
324 Ga0070687_101426212
325 Ga0070709_10107004
326 Ga0070709_10141774
327 Ga0070709_11574843
328 Ga0070714_100000001
329 Ga0070714_100014238
330 Ga0070714_100024950
331 Ga0070714_100070630
332 Ga0070714_100318973
333 Ga0070714_101143879
334 Ga0070714_101311141
335 Ga0070714_102130344
336 Ga0070713_100003108
337 Ga0070713_100069787
338 Ga0070713_100097626
339 Ga0070713_100925312
340 Ga0070713_101037107
341 Ga0070713_101335671
342 Ga0070710_10253641
343 Ga0070711_100752663
344 Ga0070705_100494189
345 Ga0070694_100297072
346 Ga0070708_100000214
347 Ga0070708_100004063
348 Ga0070708_100008964
349 Ga0070708_100011528
350 Ga0070708_100013982
351 Ga0070708_100214682
352 Ga0070708_100302293
353 Ga0070708_100328148
354 Ga0070708_100878182
355 Ga0070708_100922613
356 Ga0070678_100784085
357 Ga0068867_101059916
358 Ga0070706_100000215
359 Ga0070706_100000342
360 Ga0070706_100003001
361 Ga0070706_100012841
362 Ga0070706_100071595
363 Ga0070706_100168606
364 Ga0070706_100552136
365 Ga0070707_100000782
366 Ga0070707_100001474
367 Ga0070707_100006303
368 Ga0070707_100012468
369 Ga0070707_100012861
370 Ga0070707_100022841
371 Ga0070707_100055984
372 Ga0070707_100079871
373 Ga0070707_100188936
374 Ga0070707_100302509
375 Ga0070707_102202448
376 Ga0070707_102226650
377 Ga0070698_100004527
378 Ga0070698_100005824
379 Ga0070698_100006619
380 Ga0070698_100071379
381 Ga0070698_100145840
382 Ga0070698_100270794
383 Ga0070698_100302770
384 Ga0070698_100339998
385 Ga0070698_100917984
386 Ga0070698_101322028
387 Ga0070699_100002683
388 Ga0070699_100009375
389 Ga0070699_100385196
390 Ga0070697_100000060
391 Ga0070697_100007359
392 Ga0070697_100010249
393 Ga0070672_100679993
394 Ga0070695_100764976
395 Ga0070695_100991489
396 Ga0070696_100095194
397 Ga0070696_100544210
398 Ga0070704_100003389
399 Ga0070704_100011929
400 Ga0070704_100680075
401 Ga0070704_101309806
402 Ga0068855_102236585
403 Ga0068856_100022030
404 Ga0068859_102551353
405 Ga0070717_10000078
406 Ga0070717_10001123
407 Ga0070717_10001401
408 Ga0070717_10001709
409 Ga0070717_10004633
410 Ga0070717_10143084
411 Ga0070717_10185337
412 Ga0070717_10559417
413 Ga0070717_10577614
414 Ga0070715_10010691
415 Ga0070716_100000589
416 Ga0070716_100075006
417 Ga0070716_100156562
418 Ga0070716_100166423
419 Ga0070716_100233617
420 Ga0070712_100167418
421 Ga0070712_100245096
422 Ga0070712_100302010
423 Ga0070712_100559620
424 Ga0070712_101210694
425 Ga0075428_100227104
426 Ga0075431_100010502
427 Ga0075433_10037944
428 Ga0075433_11085584
429 Ga0075429_100001254
430 Ga0075436_100016237
431 Ga0075436_100018023
432 Ga0075436_100042199
433 Ga0097620_102551328
434 Ga0075435_100561271
435 Ga0105245_10111484
436 Ga0114129_10003725
437 Ga0157373_10505827
438 Ga0157370_10656613
439 Ga0157374_10791266
440 Ga0157377_11388263
441 Ga0207653_10000233
442 Ga0207692_10094878
443 Ga0207685_10000765
444 Ga0207699_10000055
445 Ga0207699_10200406
446 Ga0207699_11256632
447 Ga0207684_10000012
448 Ga0207684_10000013
449 Ga0207684_10000233
450 Ga0207684_10001510
451 Ga0207684_10003900
452 Ga0207684_10009720
453 Ga0207684_10058384
454 Ga0207684_10613428
455 Ga0207684_11154369
456 Ga0207684_11380743
457 Ga0207693_10023053
458 Ga0207693_10541900
459 Ga0207693_10821083
460 Ga0207693_11121010
461 Ga0207663_10009992
462 Ga0207663_10764825
463 Ga0207646_10000063
464 Ga0207646_10000823
465 Ga0207646_10004979
466 Ga0207646_10008673
467 Ga0207646_10008800
468 Ga0207646_10009543
469 Ga0207646_10012052
470 Ga0207646_10016359
471 Ga0207646_10041867
472 Ga0207646_10182077
473 Ga0207646_10204206
474 Ga0207646_10251738
475 Ga0207646_10520525
476 Ga0207646_11309383
477 Ga0207646_11481721
478 Ga0207646_11783800
479 Ga0207687_10063677
480 Ga0207700_10002314
481 Ga0207700_10080425
482 Ga0207700_10751959
483 Ga0207700_10858060
484 Ga0207700_10874484
485 Ga0207700_11838127
486 Ga0207664_10000010
487 Ga0207664_10000291
488 Ga0207664_10104251
489 Ga0207664_10521271
490 Ga0207664_10644147
491 Ga0207664_10906200
492 Ga0207664_11690652
493 Ga0207664_11795542
494 Ga0207670_10353132
495 Ga0207665_10012313
496 Ga0207665_10028979
497 Ga0207665_10098494
498 Ga0207665_10133633
499 Ga0207665_10164113
500 Ga0207665_10243940
501 Ga0207665_11476424
502 Ga0207689_10521020
503 Ga0207667_11769153
504 Ga0207651_11239202
505 Ga0207640_10390676
506 Ga0207677_10102296
507 Ga0207677_10457436
508 Ga0207702_12476722
509 Ga0207648_12244374
510 Ga0207683_10654620
511 Ga0209999_1118098
512 Ga0307413_11028464
513 Ga0307406_10465218
514 Ga0307415_100917016
515 Ga0373944_0255108
516 Ga0373949_0264441
517 Ga0373941_0061357
518 Ga0373943_0052233
519 Ga0373943_0106682
520 Ga0373943_0230408
521 Ga0373935_0219615
522 Ga0373925_0176321
523 Ga0373925_0936872
524 Ga0439461_0051581
525 Ga0439441_007466
526 Ga0439443_107811
527 Ga0439435_0081475
528 Ga0439460_0052979
529 Ga0495603_0024248
530 Ga0495603_0027942
531 Ga0495603_0037695
532 Ga0495603_0082873
533 Ga0495603_0199794
534 Ga0495641_0017744
535 Ga0495639_0274643
536 Ga0495662_0040587
537 Ga0495662_0300324
538 Ga0495618_0082979
539 Ga0495630_0244054
540 Ga0495663_0137299
541 Ga0495665_0188416
542 Ga0495586_0224765
543 Ga0495609_0346848
544 Ga0495645_0113784
545 Ga0495633_0570408
546 Ga0495647_0505875
547 Ga0495658_0604896
548 Ga0495613_0014075
549 Ga0495613_1121614
550 Ga0495600_0440746
551 Ga0495581_0192179
552 Ga0495676_0045984
553 Ga0495676_0160883
554 Ga0495676_0322918
555 Ga0495676_0541453
556 Ga0495684_0106131
557 Ga0496100_0277674
558 Ga0496105_0232199
559 Ga0496105_1183804
560 Ga0496107_1268207
561 Ga0496108_0056180
562 Ga0496109_0051907
563 Ga0496109_1352887
564 Ga0496110_0027867
565 Ga0496111_0144023
566 Ga0496112_0018233
567 Ga0496113_0125209
568 Ga0496113_0538144
569 Ga0496114_0601219
570 Ga0496115_1295578
571 Ga0501031_0250480
572 Ga0501031_0372120
573 Ga0501032_0674900
574 Ga0501034_0775784
575 Ga0501036_0264677
576 Ga0501036_0340515
577 Ga0501036_0482690
578 Ga0501036_1185638
579 Ga0501038_1363445
580 Ga0501039_0211183
581 Ga0501040_0028930
582 Ga0501040_0063493
583 Ga0501041_0056529
584 Ga0501042_0015751
585 Ga0501042_0269986
586 Ga0501042_0434528
587 Ga0501043_0370750
588 Ga0501046_0258123
589 Ga0501046_0359530
590 Ga0501048_0122378
591 Ga0501048_0149709
592 Ga0501048_0186575
593 Ga0501068_0247805
594 Ga0501070_0647004
595 Ga0501071_0682098
596 Ga0501071_0890484
597 Ga0501072_0156547
598 Ga0501072_0967627
599 Ga0501075_0028608
600 Ga0501075_0175428
601 Ga0501075_0721943
602 Ga0501075_0819589
603 Ga0501076_0053455
604 Ga0501076_0289679
605 Ga0501077_0235072
606 Ga0501079_0241857
607 Ga0501079_0253725
608 Ga0501080_0178901
609 Ga0501081_0026528
610 Ga0501081_1086503
611 Ga0501083_0061083
612 Ga0501035_1507944
613 Ga0501045_0157399
614 nmdc:mga05p37_2472_c1
615 nmdc:mga09592_4579_c1
616 nmdc:mga06r32_21864_c1
617 nmdc:mga0rr50_887934_c1
618 nmdc:mga08x19_221502_c1
619 nmdc:mga0a205_1546818_c1
620 nmdc:mga0a205_53752_c1
621 Ga0495601_0000499
622 Ga0495595_0009070
623 Ga0495619_0017448
624 Ga0501084_0493884
625 Ga0501084_0631564
626 Ga0501084_1371009
627 Ga0501082_0233797
628 Ga0501082_0868737
629 Ga0530510_0039326
630 Ga0530510_1190420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01206

TusA

Sulfurtransferase TusA

8

77

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8999 5 79
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.8873 10 81
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.878 5 79
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.8542 10 81
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8533 1 81
ID Description Score Start End Superfamily
af_Q2G1R7_113_189_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9631 10 79 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9607 11 79 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9382 10 79 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.922 11 79 3.30.110.40
af_Q58170_72_142_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.8902 10 78 3.30.110.40
ID Description Score Start End GO Terms
AF-A0A538ICZ1-F1-model_v4 Sulfurtransferase TusA family protein 0.9873 7 80 GO:0016740
AF-A0A2G6IF15-F1-model_v4 Preprotein translocase subunit TatB 0.987 11 79
AF-I0IS01-F1-model_v4 UPF0033 domain-containing protein 0.9842 7 80
AF-A0A7W5WFR5-F1-model_v4 deleted 0.9836 8 80
AF-L7UAU7-F1-model_v4 UPF0033 domain-containing protein 0.9834 7 81

Map