F403124

General Info

Members Datasets Scaffolds Average Seq Length
315 185 630 194

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10000607|Ga0075433_1000060720
Length 223
Sequence MRGHGTRPPRCNISICYRRHPIGKTVMLPNSDSGPTELLQAWSQGDGSALDRLMPLVYNELHRLARRYMRQERPDHTLQATSLVNEAYLRLIDVNRVEWRNRAHFLALAAQMMRRILVESARNRQXXXRGGGAVHVNLDDLQELPDSKEHDLVALSDALSGLATFDARMSQVVELRFFGGLTVDETAHVLNISPETVMRDWKTAKAWLLREIRRGHRTDSSRT

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
131 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
162 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
174 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 24.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10000607 3300006852 Bacteria 23862
2 JGI24751J29686_10000686 3300002459 Bacteria 8415
3 JGI26145J50221_1020018 3300003371 Unclassified 642
4 Ga0065704_10291140 3300005289 Bacteria 903
5 Ga0065712_10069914 3300005290 Bacteria 6517
6 Ga0065715_10033163 3300005293 Bacteria 1692
7 Ga0065707_10088647 3300005295 Unclassified 4594
8 Ga0065707_10149724 3300005295 Bacteria 1672
9 Ga0065707_10271227 3300005295 Bacteria 1071
10 Ga0065707_10492870 3300005295 Bacteria 764
11 Ga0065707_10544995 3300005295 Unclassified 725
12 Ga0070676_10501662 3300005328 Bacteria 862
13 Ga0070676_10502696 3300005328 Unclassified 861
14 Ga0070670_100012451 3300005331 Bacteria 7279
15 Ga0070670_100054916 3300005331 Bacteria 3419
16 Ga0070670_100195860 3300005331 Bacteria 1755
17 Ga0070670_101247750 3300005331 Unclassified 680
18 Ga0070677_10087237 3300005333 Bacteria 1349
19 Ga0068869_100010504 3300005334 Bacteria 6040
20 Ga0068869_100736108 3300005334 Bacteria 843
21 Ga0070689_100143349 3300005340 Bacteria 1922
22 Ga0070687_100334696 3300005343 Unclassified 972
23 Ga0070668_100289416 3300005347 Bacteria 1371
24 Ga0070669_100015654 3300005353 Bacteria 5407
25 Ga0070669_100102282 3300005353 Bacteria 2163
26 Ga0070675_100185046 3300005354 Bacteria 1802
27 Ga0070675_100287844 3300005354 Unclassified 1445
28 Ga0070675_100817365 3300005354 Unclassified 852
29 Ga0070674_100058762 3300005356 Bacteria 2675
30 Ga0070674_100405608 3300005356 Bacteria 1115
31 Ga0070673_100603301 3300005364 Unclassified 1001
32 Ga0070659_100794597 3300005366 Bacteria 823
33 Ga0070714_100550036 3300005435 Unclassified 1105
34 Ga0070711_100884189 3300005439 Bacteria 762
35 Ga0070663_100886532 3300005455 Bacteria 770
36 Ga0070662_100208647 3300005457 Unclassified 1553
37 Ga0070662_100677008 3300005457 Bacteria 872
38 Ga0070707_100625267 3300005468 Bacteria 1039
39 Ga0070698_100066788 3300005471 Bacteria 3618
40 Ga0070698_100113629 3300005471 Bacteria 2673
41 Ga0070699_100022972 3300005518 Bacteria 5372
42 Ga0070699_100269237 3300005518 Bacteria 1524
43 Ga0070684_100594106 3300005535 Unclassified 1029
44 Ga0070697_100237538 3300005536 Bacteria 1556
45 Ga0070672_100060494 3300005543 Unclassified 2982
46 Ga0070672_100190895 3300005543 Unclassified 1710
47 Ga0070686_101131118 3300005544 Bacteria 648
48 Ga0070696_100463813 3300005546 Bacteria 1002
49 Ga0070665_100726886 3300005548 Bacteria 1006
50 Ga0070665_101138522 3300005548 Unclassified 792
51 Ga0070704_100427052 3300005549 Bacteria 1136
52 Ga0070664_100129113 3300005564 Bacteria 2219
53 Ga0068857_100079356 3300005577 Bacteria 2930
54 Ga0068857_100843010 3300005577 Bacteria 877
55 Ga0068859_100004560 3300005617 Bacteria 14130
56 Ga0068859_100011598 3300005617 Bacteria 8863
57 Ga0068864_100013197 3300005618 Bacteria 6841
58 Ga0068864_100060640 3300005618 Bacteria 3275
59 Ga0068864_100967702 3300005618 Bacteria 843
60 Ga0068861_100305455 3300005719 Bacteria 1380
61 Ga0068861_101236094 3300005719 Bacteria 724
62 Ga0068863_100002889 3300005841 Bacteria 17014
63 Ga0068858_100640302 3300005842 Bacteria 1033
64 Ga0068860_100558411 3300005843 Unclassified 1148
65 Ga0068860_100626179 3300005843 Unclassified 1083
66 Ga0068862_100127586 3300005844 Bacteria 2247
67 Ga0068862_100145339 3300005844 Bacteria 2107
68 Ga0068862_100201576 3300005844 Bacteria 1794
69 Ga0075432_10022115 3300006058 Bacteria 2174
70 Ga0075428_100032138 3300006844 Bacteria 5797
71 Ga0075428_100198645 3300006844 Bacteria 2169
72 Ga0075428_100272700 3300006844 Bacteria 1820
73 Ga0075428_100729127 3300006844 Bacteria 1055
74 Ga0075428_100783967 3300006844 Bacteria 1013
75 Ga0075428_101016045 3300006844 Bacteria 877
76 Ga0075430_100063926 3300006846 Bacteria 3091
77 Ga0075430_100078744 3300006846 Unclassified 2762
78 Ga0075430_100765707 3300006846 Unclassified 796
79 Ga0075431_100135853 3300006847 Bacteria 2535
80 Ga0075431_100210819 3300006847 Bacteria 1984
81 Ga0075431_100338163 3300006847 Unclassified 1515
82 Ga0075431_100650492 3300006847 Bacteria 1034
83 Ga0075433_10001409 3300006852 Bacteria 17712
84 Ga0075433_10007628 3300006852 Bacteria 8591
85 Ga0075433_10138157 3300006852 Bacteria 2166
86 Ga0075433_10296965 3300006852 Bacteria 1430
87 Ga0075433_10463373 3300006852 Unclassified 1117
88 Ga0075434_100069447 3300006871 Bacteria 3512
89 Ga0075434_100186718 3300006871 Bacteria 2093
90 Ga0075434_100255365 3300006871 Bacteria 1771
91 Ga0075434_100260117 3300006871 Bacteria 1754
92 Ga0075434_100568132 3300006871 Unclassified 1154
93 Ga0075434_100604594 3300006871 Unclassified 1116
94 Ga0075429_100134228 3300006880 Bacteria 2166
95 Ga0075429_100229394 3300006880 Unclassified 1626
96 Ga0075429_100360759 3300006880 Bacteria 1272
97 Ga0075429_101244134 3300006880 Unclassified 649
98 Ga0068865_100118160 3300006881 Unclassified 1967
99 Ga0068865_100297487 3300006881 Bacteria 1290
100 Ga0097620_100004559 3300006931 Bacteria 14130
101 Ga0097620_100011599 3300006931 Bacteria 8863
102 Ga0075435_100008771 3300007076 Bacteria 7279
103 Ga0075435_100011340 3300007076 Bacteria 6552
104 Ga0105240_10244096 3300009093 Unclassified 2080
105 Ga0111539_10007716 3300009094 Bacteria 13745
106 Ga0111539_10017435 3300009094 Bacteria 8891
107 Ga0111539_10035660 3300009094 Bacteria 6022
108 Ga0111539_10226675 3300009094 Unclassified 2176
109 Ga0111539_10327668 3300009094 Bacteria 1783
110 Ga0111539_10340970 3300009094 Unclassified 1744
111 Ga0111539_10428606 3300009094 Bacteria 1540
112 Ga0105245_10866067 3300009098 Bacteria 944
113 Ga0114129_10003253 3300009147 Bacteria 22800
114 Ga0114129_10076238 3300009147 Bacteria 4669
115 Ga0114129_10153260 3300009147 Bacteria 3153
116 Ga0114129_10208269 3300009147 Bacteria 2645
117 Ga0114129_10574035 3300009147 Bacteria 1464
118 Ga0114129_10624018 3300009147 Bacteria 1394
119 Ga0114129_10878718 3300009147 Bacteria 1137
120 Ga0114129_10914054 3300009147 Bacteria 1111
121 Ga0105248_10040180 3300009177 Bacteria 5244
122 Ga0105248_10530554 3300009177 Bacteria 1328
123 Ga0105249_11243332 3300009553 Unclassified 816
124 Ga0099796_10290196 3300010159 Bacteria 690
125 Ga0105239_10984540 3300010375 Bacteria 969
126 Ga0105246_10056852 3300011119 Bacteria 2706
127 Ga0105246_10129462 3300011119 Bacteria 1883
128 Ga0157327_1010180 3300012512 Bacteria 882
129 Ga0157375_10437054 3300013308 Bacteria 1474
130 Ga0163163_10063037 3300014325 Bacteria 3675
131 Ga0163163_10215888 3300014325 Bacteria 1967
132 Ga0157380_10445963 3300014326 Unclassified 1241
133 Ga0157379_10420707 3300014968 Bacteria 1230
134 Ga0157376_10248681 3300014969 Unclassified 1660
135 Ga0163161_10150687 3300017792 Unclassified 1767
136 Ga0163161_11163758 3300017792 Unclassified 665
137 Ga0207692_10652206 3300025898 Unclassified 680
138 Ga0207688_10017651 3300025901 Bacteria 3881
139 Ga0207688_10027048 3300025901 Bacteria 3155
140 Ga0207645_10155030 3300025907 Bacteria 1496
141 Ga0207643_10014283 3300025908 Bacteria 4312
142 Ga0207695_10612955 3300025913 Unclassified 969
143 Ga0207646_10540775 3300025922 Bacteria 1048
144 Ga0207681_10144538 3300025923 Bacteria 1775
145 Ga0207681_10180504 3300025923 Bacteria 1607
146 Ga0207650_10005181 3300025925 Bacteria 8892
147 Ga0207650_10013826 3300025925 Bacteria 5597
148 Ga0207650_10029611 3300025925 Bacteria 3937
149 Ga0207650_10432401 3300025925 Unclassified 1093
150 Ga0207659_10196180 3300025926 Bacteria 1609
151 Ga0207644_11072980 3300025931 Bacteria 677
152 Ga0207690_10555340 3300025932 Bacteria 934
153 Ga0207706_10054536 3300025933 Bacteria 3528
154 Ga0207670_10143452 3300025936 Bacteria 1763
155 Ga0207669_10029921 3300025937 Bacteria 3019
156 Ga0207669_10433408 3300025937 Unclassified 1037
157 Ga0207704_10533733 3300025938 Unclassified 951
158 Ga0207704_10953528 3300025938 Unclassified 724
159 Ga0207691_10003984 3300025940 Bacteria 14344
160 Ga0207691_10041311 3300025940 Bacteria 4258
161 Ga0207689_10042081 3300025942 Bacteria 3781
162 Ga0207689_10045460 3300025942 Bacteria 3630
163 Ga0207689_11024710 3300025942 Bacteria 696
164 Ga0207679_10974415 3300025945 Unclassified 777
165 Ga0207658_10182550 3300025986 Unclassified 1738
166 Ga0207703_10664763 3300026035 Bacteria 989
167 Ga0207678_10914076 3300026067 Bacteria 776
168 Ga0207708_10278169 3300026075 Bacteria 1355
169 Ga0207641_10003793 3300026088 Bacteria 13257
170 Ga0207648_10301217 3300026089 Bacteria 1438
171 Ga0207648_10360234 3300026089 Unclassified 1312
172 Ga0207676_10012637 3300026095 Bacteria 6057
173 Ga0207676_10013253 3300026095 Bacteria 5921
174 Ga0207674_10103133 3300026116 Bacteria 2832
175 Ga0207674_10341681 3300026116 Unclassified 1447
176 Ga0207675_100085175 3300026118 Bacteria 2966
177 Ga0207675_101485009 3300026118 Bacteria 698
178 Ga0207698_10106553 3300026142 Bacteria 2338
179 Ga0209969_1001945 3300027360 Bacteria 2839
180 Ga0209967_1012042 3300027364 Unclassified 1219
181 Ga0209996_1011940 3300027395 Bacteria 1164
182 Ga0209999_1001482 3300027543 Bacteria 4026
183 Ga0209982_1003480 3300027552 Bacteria 2237
184 Ga0209982_1023312 3300027552 Unclassified 957
185 Ga0209970_1006235 3300027614 Bacteria 1953
186 Ga0210002_1000348 3300027617 Bacteria 6322
187 Ga0209983_1020759 3300027665 Bacteria 1370
188 Ga0209971_1021293 3300027682 Unclassified 1542
189 Ga0209971_1043061 3300027682 Unclassified 1087
190 Ga0209966_1012580 3300027695 Bacteria 1556
191 Ga0209998_10012500 3300027717 Bacteria 1763
192 Ga0209998_10020168 3300027717 Unclassified 1425
193 Ga0209974_10019366 3300027876 Bacteria 2256
194 Ga0207428_10018197 3300027907 Bacteria 6007
195 Ga0207428_10071189 3300027907 Unclassified 2732
196 Ga0207428_10114276 3300027907 Bacteria 2075
197 Ga0268266_10112640 3300028379 Bacteria 2412
198 Ga0268266_10929693 3300028379 Unclassified 841
199 Ga0268265_10038137 3300028380 Bacteria 3533
200 Ga0268265_10065618 3300028380 Unclassified 2802
201 Ga0268265_10309654 3300028380 Unclassified 1425
202 Ga0268264_10397625 3300028381 Bacteria 1323
203 Ga0268264_10664922 3300028381 Bacteria 1032
204 Ga0307408_100009319 3300031548 Bacteria 6472
205 Ga0307408_100032083 3300031548 Bacteria 3662
206 Ga0307405_10135179 3300031731 Bacteria 1710
207 Ga0307405_10380912 3300031731 Bacteria 1098
208 Ga0307413_10808799 3300031824 Bacteria 788
209 Ga0307410_10002571 3300031852 Bacteria 8802
210 Ga0307410_10296792 3300031852 Bacteria 1274
211 Ga0307406_10311191 3300031901 Bacteria 1214
212 Ga0307407_10462463 3300031903 Bacteria 923
213 Ga0307412_10006157 3300031911 Bacteria 6761
214 Ga0307412_10242668 3300031911 Bacteria 1394
215 Ga0307409_100081240 3300031995 Bacteria 2619
216 Ga0307416_100025882 3300032002 Bacteria 4312
217 Ga0307416_100183815 3300032002 Bacteria 1962
218 Ga0307416_101304353 3300032002 Bacteria 832
219 Ga0307411_10035357 3300032005 Bacteria 3119
220 Ga0307411_10072092 3300032005 Bacteria 2344
221 Ga0307411_10221122 3300032005 Bacteria 1469
222 Ga0307415_100007455 3300032126 Bacteria 5986
223 Ga0307415_100320422 3300032126 Bacteria 1292
224 Ga0373959_0019578 3300034820 Bacteria 1284
225 Ga0373932_0014853 3300035112 Bacteria 1965
226 Ga0373960_0015222 3300035121 Bacteria 1960
227 Ga0373962_0093571 3300035242 Unclassified 929
228 Ga0373937_0119999 3300036401 Unclassified 2450
229 Ga0439453_0014285 3300041408 Bacteria 1360
230 Ga0439431_0101633 3300041997 Unclassified 791
231 Ga0439456_043733 3300042013 Bacteria 974
232 Ga0450923_001335 3300042125 Bacteria 3232
233 Ga0439446_0043909 3300042156 Bacteria 1322
234 Ga0439434_0027528 3300042435 Bacteria 1719
235 Ga0439434_0082259 3300042435 Unclassified 1023
236 Ga0439444_0001828 3300042437 Bacteria 2824
237 Ga0439440_0061050 3300042993 Bacteria 963
238 Ga0453683_0210949 3300044673 Unclassified 1234
239 Ga0451576_0853318 3300045051 Unclassified 956
240 Ga0495592_0018216 3300046454 Bacteria 5337
241 Ga0495603_0111344 3300046455 Bacteria 1597
242 Ga0495629_0704233 3300046459 Bacteria 670
243 Ga0495651_0251776 3300046462 Unclassified 1206
244 Ga0495582_0247511 3300046473 Bacteria 1022
245 Ga0495594_0202539 3300046499 Unclassified 1131
246 Ga0495587_0000437 3300046536 Bacteria 29203
247 Ga0495621_0170683 3300046539 Bacteria 864
248 Ga0495645_0067638 3300046543 Bacteria 2580
249 Ga0495645_0081279 3300046543 Bacteria 2325
250 Ga0495634_0693391 3300046642 Unclassified 586
251 Ga0495659_0226906 3300046664 Unclassified 773
252 Ga0495661_0291981 3300046665 Bacteria 819
253 Ga0495623_0106528 3300046679 Unclassified 1703
254 Ga0495647_0198546 3300046681 Bacteria 879
255 Ga0495581_0559872 3300047315 Bacteria 663
256 Ga0495684_0278038 3300047471 Bacteria 1209
257 Ga0495602_0007843 3300048088 Bacteria 11165
258 Ga0496108_0507462 3300048911 Unclassified 1053
259 Ga0496109_0045128 3300048912 Bacteria 3999
260 Ga0496112_0071383 3300048915 Bacteria 3432
261 Ga0496114_0639075 3300048917 Bacteria 937
262 Ga0501290_027046 3300049513 Bacteria 808
263 Ga0501299_007757 3300049522 Bacteria 1723
264 Ga0501300_022734 3300049523 Bacteria 917
265 Ga0501303_004554 3300049526 Bacteria 1150
266 Ga0501071_0861496 3300049587 Unclassified 699
267 Ga0501076_0158055 3300049592 Bacteria 1846
268 Ga0501077_0065628 3300049593 Bacteria 2302
269 Ga0501202_018495 3300049652 Bacteria 1369
270 Ga0501217_113479 3300049661 Bacteria 780
271 Ga0501235_048993 3300049669 Bacteria 976
272 Ga0501239_007917 3300049672 Bacteria 1124
273 Ga0501225_0029999 3300049705 Bacteria 1495
274 Ga0501080_0387194 3300049742 Unclassified 1259
275 Ga0501081_0167046 3300049743 Bacteria 1588
276 Ga0501268_061878 3300049765 Bacteria 743
277 Ga0501273_030808 3300049770 Bacteria 763
278 nmdc:mga05p37_208555_c1 3300050507 Bacteria 2363
279 nmdc:mga05p37_44952_c1 3300050507 Bacteria 5433
280 nmdc:mga05p37_540565_c1 3300050507 Bacteria 1329
281 nmdc:mga05p37_587607_c1 3300050507 Bacteria 1260
282 nmdc:mga05p37_9738_c1 3300050507 Bacteria 11395
283 nmdc:mga09592_102203_c1 3300050508 Bacteria 2456
284 nmdc:mga09592_454639_c1 3300050508 Bacteria 1105
285 nmdc:mga0qj67_139701_c1 3300050509 Bacteria 1964
286 nmdc:mga0qj67_567391_c1 3300050509 Bacteria 910
287 nmdc:mga0qj67_616028_c1 3300050509 Unclassified 868
288 nmdc:mga06r32_10103_c1 3300050510 Bacteria 8521
289 nmdc:mga06r32_242743_c1 3300050510 Bacteria 1789
290 nmdc:mga06r32_262060_c1 3300050510 Bacteria 1716
291 nmdc:mga06r32_271314_c1 3300050510 Unclassified 1684
292 nmdc:mga06r32_27391_c1 3300050510 Bacteria 5324
293 nmdc:mga06r32_508904_c1 3300050510 Bacteria 1181
294 nmdc:mga06r32_74911_c1 3300050510 Bacteria 3283
295 nmdc:mga08y16_113726_c1 3300050511 Bacteria 2818
296 nmdc:mga08y16_154157_c1 3300050511 Unclassified 2388
297 nmdc:mga08y16_507817_c1 3300050511 Unclassified 1224
298 nmdc:mga08y16_720806_c1 3300050511 Bacteria 995
299 nmdc:mga08y16_856679_c1 3300050511 Unclassified 898
300 nmdc:mga08y16_88983_c1 3300050511 Bacteria 3218
301 nmdc:mga0n895_247824_c1 3300050512 Unclassified 1808
302 nmdc:mga0n895_2821_c1 3300050512 Bacteria 13753
303 nmdc:mga0rr50_274779_c1 3300050513 Unclassified 1405
304 nmdc:mga0rr50_91297_c1 3300050513 Bacteria 2372
305 nmdc:mga0a205_16660_c1 3300050515 Bacteria 6884
306 nmdc:mga0a205_1888_c1 3300050515 Bacteria 18183
307 nmdc:mga0a205_20445_c1 3300050515 Bacteria 6245
308 nmdc:mga0a205_218422_c1 3300050515 Bacteria 1793
309 nmdc:mga0a205_409566_c1 3300050515 Unclassified 1219
310 nmdc:mga0a205_431218_c1 3300050515 Unclassified 1180
311 nmdc:mga0a205_6828_c1 3300050515 Bacteria 10326
312 Ga0590071_001720 3300059421 Bacteria 5665
313 Ga0590075_013865 3300059424 Bacteria 1968
314 Ga0590077_001300 3300059426 Bacteria 5940
315 Ga0590077_002866 3300059426 Bacteria 3624
316 Ga0075433_10000607
317 JGI24751J29686_10000686
318 JGI26145J50221_1020018
319 Ga0065704_10291140
320 Ga0065712_10069914
321 Ga0065715_10033163
322 Ga0065707_10088647
323 Ga0065707_10149724
324 Ga0065707_10271227
325 Ga0065707_10492870
326 Ga0065707_10544995
327 Ga0070676_10501662
328 Ga0070676_10502696
329 Ga0070670_100012451
330 Ga0070670_100054916
331 Ga0070670_100195860
332 Ga0070670_101247750
333 Ga0070677_10087237
334 Ga0068869_100010504
335 Ga0068869_100736108
336 Ga0070689_100143349
337 Ga0070687_100334696
338 Ga0070668_100289416
339 Ga0070669_100015654
340 Ga0070669_100102282
341 Ga0070675_100185046
342 Ga0070675_100287844
343 Ga0070675_100817365
344 Ga0070674_100058762
345 Ga0070674_100405608
346 Ga0070673_100603301
347 Ga0070659_100794597
348 Ga0070714_100550036
349 Ga0070711_100884189
350 Ga0070663_100886532
351 Ga0070662_100208647
352 Ga0070662_100677008
353 Ga0070707_100625267
354 Ga0070698_100066788
355 Ga0070698_100113629
356 Ga0070699_100022972
357 Ga0070699_100269237
358 Ga0070684_100594106
359 Ga0070697_100237538
360 Ga0070672_100060494
361 Ga0070672_100190895
362 Ga0070686_101131118
363 Ga0070696_100463813
364 Ga0070665_100726886
365 Ga0070665_101138522
366 Ga0070704_100427052
367 Ga0070664_100129113
368 Ga0068857_100079356
369 Ga0068857_100843010
370 Ga0068859_100004560
371 Ga0068859_100011598
372 Ga0068864_100013197
373 Ga0068864_100060640
374 Ga0068864_100967702
375 Ga0068861_100305455
376 Ga0068861_101236094
377 Ga0068863_100002889
378 Ga0068858_100640302
379 Ga0068860_100558411
380 Ga0068860_100626179
381 Ga0068862_100127586
382 Ga0068862_100145339
383 Ga0068862_100201576
384 Ga0075432_10022115
385 Ga0075428_100032138
386 Ga0075428_100198645
387 Ga0075428_100272700
388 Ga0075428_100729127
389 Ga0075428_100783967
390 Ga0075428_101016045
391 Ga0075430_100063926
392 Ga0075430_100078744
393 Ga0075430_100765707
394 Ga0075431_100135853
395 Ga0075431_100210819
396 Ga0075431_100338163
397 Ga0075431_100650492
398 Ga0075433_10001409
399 Ga0075433_10007628
400 Ga0075433_10138157
401 Ga0075433_10296965
402 Ga0075433_10463373
403 Ga0075434_100069447
404 Ga0075434_100186718
405 Ga0075434_100255365
406 Ga0075434_100260117
407 Ga0075434_100568132
408 Ga0075434_100604594
409 Ga0075429_100134228
410 Ga0075429_100229394
411 Ga0075429_100360759
412 Ga0075429_101244134
413 Ga0068865_100118160
414 Ga0068865_100297487
415 Ga0097620_100004559
416 Ga0097620_100011599
417 Ga0075435_100008771
418 Ga0075435_100011340
419 Ga0105240_10244096
420 Ga0111539_10007716
421 Ga0111539_10017435
422 Ga0111539_10035660
423 Ga0111539_10226675
424 Ga0111539_10327668
425 Ga0111539_10340970
426 Ga0111539_10428606
427 Ga0105245_10866067
428 Ga0114129_10003253
429 Ga0114129_10076238
430 Ga0114129_10153260
431 Ga0114129_10208269
432 Ga0114129_10574035
433 Ga0114129_10624018
434 Ga0114129_10878718
435 Ga0114129_10914054
436 Ga0105248_10040180
437 Ga0105248_10530554
438 Ga0105249_11243332
439 Ga0099796_10290196
440 Ga0105239_10984540
441 Ga0105246_10056852
442 Ga0105246_10129462
443 Ga0157327_1010180
444 Ga0157375_10437054
445 Ga0163163_10063037
446 Ga0163163_10215888
447 Ga0157380_10445963
448 Ga0157379_10420707
449 Ga0157376_10248681
450 Ga0163161_10150687
451 Ga0163161_11163758
452 Ga0207692_10652206
453 Ga0207688_10017651
454 Ga0207688_10027048
455 Ga0207645_10155030
456 Ga0207643_10014283
457 Ga0207695_10612955
458 Ga0207646_10540775
459 Ga0207681_10144538
460 Ga0207681_10180504
461 Ga0207650_10005181
462 Ga0207650_10013826
463 Ga0207650_10029611
464 Ga0207650_10432401
465 Ga0207659_10196180
466 Ga0207644_11072980
467 Ga0207690_10555340
468 Ga0207706_10054536
469 Ga0207670_10143452
470 Ga0207669_10029921
471 Ga0207669_10433408
472 Ga0207704_10533733
473 Ga0207704_10953528
474 Ga0207691_10003984
475 Ga0207691_10041311
476 Ga0207689_10042081
477 Ga0207689_10045460
478 Ga0207689_11024710
479 Ga0207679_10974415
480 Ga0207658_10182550
481 Ga0207703_10664763
482 Ga0207678_10914076
483 Ga0207708_10278169
484 Ga0207641_10003793
485 Ga0207648_10301217
486 Ga0207648_10360234
487 Ga0207676_10012637
488 Ga0207676_10013253
489 Ga0207674_10103133
490 Ga0207674_10341681
491 Ga0207675_100085175
492 Ga0207675_101485009
493 Ga0207698_10106553
494 Ga0209969_1001945
495 Ga0209967_1012042
496 Ga0209996_1011940
497 Ga0209999_1001482
498 Ga0209982_1003480
499 Ga0209982_1023312
500 Ga0209970_1006235
501 Ga0210002_1000348
502 Ga0209983_1020759
503 Ga0209971_1021293
504 Ga0209971_1043061
505 Ga0209966_1012580
506 Ga0209998_10012500
507 Ga0209998_10020168
508 Ga0209974_10019366
509 Ga0207428_10018197
510 Ga0207428_10071189
511 Ga0207428_10114276
512 Ga0268266_10112640
513 Ga0268266_10929693
514 Ga0268265_10038137
515 Ga0268265_10065618
516 Ga0268265_10309654
517 Ga0268264_10397625
518 Ga0268264_10664922
519 Ga0307408_100009319
520 Ga0307408_100032083
521 Ga0307405_10135179
522 Ga0307405_10380912
523 Ga0307413_10808799
524 Ga0307410_10002571
525 Ga0307410_10296792
526 Ga0307406_10311191
527 Ga0307407_10462463
528 Ga0307412_10006157
529 Ga0307412_10242668
530 Ga0307409_100081240
531 Ga0307416_100025882
532 Ga0307416_100183815
533 Ga0307416_101304353
534 Ga0307411_10035357
535 Ga0307411_10072092
536 Ga0307411_10221122
537 Ga0307415_100007455
538 Ga0307415_100320422
539 Ga0373959_0019578
540 Ga0373932_0014853
541 Ga0373960_0015222
542 Ga0373962_0093571
543 Ga0373937_0119999
544 Ga0439453_0014285
545 Ga0439431_0101633
546 Ga0439456_043733
547 Ga0450923_001335
548 Ga0439446_0043909
549 Ga0439434_0027528
550 Ga0439434_0082259
551 Ga0439444_0001828
552 Ga0439440_0061050
553 Ga0453683_0210949
554 Ga0451576_0853318
555 Ga0495592_0018216
556 Ga0495603_0111344
557 Ga0495629_0704233
558 Ga0495651_0251776
559 Ga0495582_0247511
560 Ga0495594_0202539
561 Ga0495587_0000437
562 Ga0495621_0170683
563 Ga0495645_0067638
564 Ga0495645_0081279
565 Ga0495634_0693391
566 Ga0495659_0226906
567 Ga0495661_0291981
568 Ga0495623_0106528
569 Ga0495647_0198546
570 Ga0495581_0559872
571 Ga0495684_0278038
572 Ga0495602_0007843
573 Ga0496108_0507462
574 Ga0496109_0045128
575 Ga0496112_0071383
576 Ga0496114_0639075
577 Ga0501290_027046
578 Ga0501299_007757
579 Ga0501300_022734
580 Ga0501303_004554
581 Ga0501071_0861496
582 Ga0501076_0158055
583 Ga0501077_0065628
584 Ga0501202_018495
585 Ga0501217_113479
586 Ga0501235_048993
587 Ga0501239_007917
588 Ga0501225_0029999
589 Ga0501080_0387194
590 Ga0501081_0167046
591 Ga0501268_061878
592 Ga0501273_030808
593 nmdc:mga05p37_208555_c1
594 nmdc:mga05p37_44952_c1
595 nmdc:mga05p37_540565_c1
596 nmdc:mga05p37_587607_c1
597 nmdc:mga05p37_9738_c1
598 nmdc:mga09592_102203_c1
599 nmdc:mga09592_454639_c1
600 nmdc:mga0qj67_139701_c1
601 nmdc:mga0qj67_567391_c1
602 nmdc:mga0qj67_616028_c1
603 nmdc:mga06r32_10103_c1
604 nmdc:mga06r32_242743_c1
605 nmdc:mga06r32_262060_c1
606 nmdc:mga06r32_271314_c1
607 nmdc:mga06r32_27391_c1
608 nmdc:mga06r32_508904_c1
609 nmdc:mga06r32_74911_c1
610 nmdc:mga08y16_113726_c1
611 nmdc:mga08y16_154157_c1
612 nmdc:mga08y16_507817_c1
613 nmdc:mga08y16_720806_c1
614 nmdc:mga08y16_856679_c1
615 nmdc:mga08y16_88983_c1
616 nmdc:mga0n895_247824_c1
617 nmdc:mga0n895_2821_c1
618 nmdc:mga0rr50_274779_c1
619 nmdc:mga0rr50_91297_c1
620 nmdc:mga0a205_16660_c1
621 nmdc:mga0a205_1888_c1
622 nmdc:mga0a205_20445_c1
623 nmdc:mga0a205_218422_c1
624 nmdc:mga0a205_409566_c1
625 nmdc:mga0a205_431218_c1
626 nmdc:mga0a205_6828_c1
627 Ga0590071_001720
628 Ga0590075_013865
629 Ga0590077_001300
630 Ga0590077_002866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07638

Sigma70_ECF

ECF sigma factor

33

214

0.95

PF04545

Sigma70_r4

Sigma-70, region 4

161

204

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.9776 141 180
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9595 127 188
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.954 129 187
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9493 129 188
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9492 128 188
ID Description Score Start End Superfamily
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9508 128 187 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9492 128 188 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9402 127 188 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9379 127 188 1.10.10.10
3hugA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9358 127 188 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4U5JKJ4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.886 19 195 GO:0006352
GO:0016987
AF-A0A2V8G6E6-F1-model_v4 RNA polymerase subunit sigma-70 0.8747 84 190 GO:0016987
AF-A0A4U5JV14-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8732 11 194 GO:0006352
GO:0016987
AF-A0A2N1WAH6-F1-model_v4 RNA polymerase subunit sigma-70 0.8646 25 188 GO:0006352
GO:0016987
AF-A0A2V8MFR8-F1-model_v4 RNA polymerase subunit sigma-70 0.8634 62 188 GO:0006352
GO:0016987

Map