F403109

General Info

Members Datasets Scaffolds Average Seq Length
315 210 630 193

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100039204|Ga0070712_1000392041
Length 219
Sequence MADHLLPPSISSFYPLLLSFPTRAVPMARKNILMLVGDYVEDYEVMVPFQALLMVGHSVHAACPGKKSGDTVRTAIHDFEGDQTYSEKRGHNFALNATFDHVKPEDYDALVIPGGRAPEYIRLNPRVLEIVRHFASANKPIAALCHGAQVLAAAGVLEGKKVSCYPACAPEVTRSGGTFAEVAMTEAVVDGNLVSGPAWPAHPAWLAKFLHVIGTRIEL

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
103 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 2534681786 Brucella suis 92/29 Isolate Unclassified
201 2643221645 Massilia sp. Root351 Isolate Unclassified
202 2643221664 Massilia sp. Root418 Isolate Unclassified
203 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
204 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
205 2854911287 Brucella lupini LUP21 Isolate Unclassified
206 2857558681 Duganella sp. R-74565 Isolate Unclassified
207 2904424332 Duganella sp. 1411 Isolate Rhizosphere
208 639633007 Azoarcus olearius BH72 Isolate Unclassified
209 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
210 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 0.63
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0.63
Rhizoplane 1.27
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100039204 3300006175 Bacteria 3241
2 Ga0070670_100000537 3300005331 Bacteria 30260
3 Ga0070666_10013703 3300005335 Bacteria 5147
4 Ga0070666_10061020 3300005335 Bacteria 2552
5 Ga0068868_100001838 3300005338 Bacteria 14595
6 Ga0068868_100869507 3300005338 Bacteria 817
7 Ga0070689_100036038 3300005340 Bacteria 3783
8 Ga0070687_100072061 3300005343 Bacteria 1858
9 Ga0070675_100058658 3300005354 Bacteria 3175
10 Ga0070671_100009638 3300005355 Bacteria 7757
11 Ga0070673_100032137 3300005364 Bacteria 3947
12 Ga0070673_100053070 3300005364 Bacteria 3182
13 Ga0070688_100047959 3300005365 Bacteria 2652
14 Ga0070667_100001696 3300005367 Bacteria 19693
15 Ga0070709_10001992 3300005434 Bacteria 11120
16 Ga0070709_10128146 3300005434 Bacteria 1729
17 Ga0070709_10885820 3300005434 Bacteria 705
18 Ga0070714_100109854 3300005435 Bacteria 2440
19 Ga0070713_100003185 3300005436 Bacteria 10802
20 Ga0070710_10090834 3300005437 Bacteria 1801
21 Ga0070711_100025245 3300005439 Bacteria 3885
22 Ga0070711_100210032 3300005439 Bacteria 1507
23 Ga0070711_100536956 3300005439 Bacteria 968
24 Ga0070708_100057815 3300005445 Bacteria 3454
25 Ga0070708_100162195 3300005445 Bacteria 2083
26 Ga0070678_100607013 3300005456 Bacteria 977
27 Ga0070707_100018285 3300005468 Bacteria 6595
28 Ga0070707_100419755 3300005468 Bacteria 1298
29 Ga0070707_100577829 3300005468 Bacteria 1086
30 Ga0070707_100645601 3300005468 Bacteria 1021
31 Ga0070698_100010920 3300005471 Bacteria 9661
32 Ga0070698_101148177 3300005471 Bacteria 726
33 Ga0070699_100866747 3300005518 Bacteria 827
34 Ga0070697_100469680 3300005536 Bacteria 1097
35 Ga0070672_100001567 3300005543 Bacteria 14166
36 Ga0070672_100199179 3300005543 Bacteria 1674
37 Ga0070686_100017516 3300005544 Bacteria 4188
38 Ga0070665_100001237 3300005548 Bacteria 31017
39 Ga0068855_100065313 3300005563 Bacteria 4243
40 Ga0070664_100034842 3300005564 Bacteria 4224
41 Ga0070664_100087180 3300005564 Bacteria 2698
42 Ga0068856_100111441 3300005614 Bacteria 2734
43 Ga0070702_100190121 3300005615 Bacteria 1350
44 Ga0068852_100007878 3300005616 Bacteria 7800
45 Ga0068859_101062783 3300005617 Unclassified 890
46 Ga0068864_100001816 3300005618 Bacteria 17520
47 Ga0068866_10353990 3300005718 Bacteria 934
48 Ga0068863_100012703 3300005841 Bacteria 8121
49 Ga0068863_100019245 3300005841 Bacteria 6532
50 Ga0068863_100028856 3300005841 Bacteria 5298
51 Ga0068858_100022920 3300005842 Bacteria 5824
52 Ga0068858_100090342 3300005842 Bacteria 2850
53 Ga0068858_100125550 3300005842 Bacteria 2402
54 Ga0068858_100491601 3300005842 Bacteria 1185
55 Ga0068860_100079848 3300005843 Bacteria 3111
56 Ga0081455_10171780 3300005937 Bacteria 1650
57 Ga0070715_10318226 3300006163 Bacteria 839
58 Ga0070716_100001520 3300006173 Bacteria 10384
59 Ga0070716_100029008 3300006173 Bacteria 2987
60 Ga0070712_100140430 3300006175 Bacteria 1842
61 Ga0070712_100316931 3300006175 Bacteria 1267
62 Ga0070712_101098175 3300006175 Bacteria 690
63 Ga0075362_10012719 3300006177 Bacteria 3350
64 Ga0097621_100002270 3300006237 Bacteria 13158
65 Ga0097621_100069546 3300006237 Bacteria 2907
66 Ga0097621_100169701 3300006237 Bacteria 1880
67 Ga0097621_100486961 3300006237 Bacteria 1116
68 Ga0068871_100004497 3300006358 Bacteria 9710
69 Ga0068871_100047702 3300006358 Bacteria 3455
70 Ga0068871_100061560 3300006358 Bacteria 3066
71 Ga0068871_100178801 3300006358 Bacteria 1822
72 Ga0068871_100179718 3300006358 Bacteria 1818
73 Ga0075433_10115007 3300006852 Bacteria 2387
74 Ga0075434_100120688 3300006871 Bacteria 2637
75 Ga0075434_100123436 3300006871 Bacteria 2606
76 Ga0068865_100505611 3300006881 Bacteria 1008
77 Ga0097620_100017774 3300006931 Bacteria 7148
78 Ga0097620_101062474 3300006931 Unclassified 890
79 Ga0075435_100046346 3300007076 Bacteria 3487
80 Ga0075435_100364386 3300007076 Bacteria 1240
81 Ga0099794_10011029 3300007265 Bacteria 3860
82 Ga0099794_10018141 3300007265 Bacteria 3150
83 Ga0099794_10024084 3300007265 Bacteria 2791
84 Ga0099794_10027208 3300007265 Bacteria 2649
85 Ga0099794_10091426 3300007265 Bacteria 1510
86 Ga0099794_10205837 3300007265 Bacteria 1008
87 Ga0099795_10106821 3300007788 Bacteria 1105
88 Ga0111539_10992687 3300009094 Bacteria 976
89 Ga0105243_10643606 3300009148 Bacteria 1026
90 Ga0105242_10051122 3300009176 Bacteria 3367
91 Ga0105248_10001467 3300009177 Bacteria 26242
92 Ga0105248_10006328 3300009177 Bacteria 12993
93 Ga0105248_10037313 3300009177 Bacteria 5436
94 Ga0105248_10158541 3300009177 Bacteria 2553
95 Ga0105249_10180421 3300009553 Bacteria 2054
96 Ga0105249_10473091 3300009553 Bacteria 1295
97 Ga0105246_10060947 3300011119 Bacteria 2623
98 Ga0157374_10167386 3300013296 Bacteria 2143
99 Ga0157378_10032237 3300013297 Bacteria 4630
100 Ga0163162_10007413 3300013306 Bacteria 10671
101 Ga0163162_10034707 3300013306 Bacteria 5021
102 Ga0157372_10004217 3300013307 Bacteria 15380
103 Ga0157375_10004543 3300013308 Bacteria 12057
104 Ga0157375_10008100 3300013308 Bacteria 9195
105 Ga0157375_10054392 3300013308 Bacteria 3942
106 Ga0157375_10200247 3300013308 Bacteria 2152
107 Ga0163163_10009699 3300014325 Bacteria 8614
108 Ga0163163_10021945 3300014325 Bacteria 6035
109 Ga0157379_10033467 3300014968 Bacteria 4583
110 Ga0157379_10122048 3300014968 Bacteria 2344
111 Ga0157376_10000008 3300014969 Bacteria 351192
112 Ga0157376_10002432 3300014969 Bacteria 12594
113 Ga0206349_1639792 3300020075 Bacteria 1171
114 Ga0213874_10002918 3300021377 Bacteria 3733
115 Ga0213875_10002058 3300021388 Bacteria 12342
116 Ga0207680_10082134 3300025903 Bacteria 2027
117 Ga0207680_10157836 3300025903 Bacteria 1518
118 Ga0207699_10003156 3300025906 Bacteria 7841
119 Ga0207684_10045697 3300025910 Bacteria 3713
120 Ga0207693_10042359 3300025915 Bacteria 3584
121 Ga0207693_10075097 3300025915 Bacteria 2647
122 Ga0207663_10227585 3300025916 Bacteria 1360
123 Ga0207663_10367666 3300025916 Bacteria 1093
124 Ga0207663_10530523 3300025916 Bacteria 918
125 Ga0207662_10065016 3300025918 Bacteria 2196
126 Ga0207646_10020965 3300025922 Bacteria 6045
127 Ga0207646_10036155 3300025922 Bacteria 4459
128 Ga0207646_10342843 3300025922 Bacteria 1350
129 Ga0207650_10022666 3300025925 Bacteria 4447
130 Ga0207650_10276794 3300025925 Bacteria 1365
131 Ga0207659_10309647 3300025926 Bacteria 1300
132 Ga0207700_10024968 3300025928 Bacteria 4143
133 Ga0207664_10006865 3300025929 Bacteria 7870
134 Ga0207644_10033340 3300025931 Bacteria 3597
135 Ga0207704_10243884 3300025938 Bacteria 1344
136 Ga0207704_10275698 3300025938 Bacteria 1276
137 Ga0207665_10000043 3300025939 Bacteria 82623
138 Ga0207665_10005500 3300025939 Bacteria 8452
139 Ga0207665_10006335 3300025939 Bacteria 7847
140 Ga0207665_10058184 3300025939 Bacteria 2613
141 Ga0207691_10001987 3300025940 Bacteria 20003
142 Ga0207691_10349815 3300025940 Bacteria 1264
143 Ga0207711_10000014 3300025941 Bacteria 506753
144 Ga0207711_10008806 3300025941 Bacteria 8438
145 Ga0207711_10050277 3300025941 Bacteria 3568
146 Ga0207679_10062613 3300025945 Bacteria 2773
147 Ga0207679_10489743 3300025945 Bacteria 1096
148 Ga0207667_10130788 3300025949 Bacteria 2585
149 Ga0207651_10002931 3300025960 Bacteria 8252
150 Ga0207651_10399233 3300025960 Bacteria 1169
151 Ga0207658_10003392 3300025986 Bacteria 11275
152 Ga0207677_10000807 3300026023 Bacteria 17976
153 Ga0207703_10053634 3300026035 Bacteria 3278
154 Ga0207703_10071489 3300026035 Bacteria 2866
155 Ga0207703_10277207 3300026035 Bacteria 1521
156 Ga0207703_10331722 3300026035 Bacteria 1396
157 Ga0207702_10064469 3300026078 Bacteria 3135
158 Ga0207641_10004023 3300026088 Bacteria 12831
159 Ga0207641_10011896 3300026088 Bacteria 7138
160 Ga0207641_10172058 3300026088 Bacteria 1977
161 Ga0207648_10247669 3300026089 Bacteria 1588
162 Ga0207676_10038218 3300026095 Bacteria 3661
163 Ga0207698_10003853 3300026142 Bacteria 9081
164 Ga0209588_1002048 3300027671 Bacteria 5439
165 Ga0209588_1007035 3300027671 Bacteria 3298
166 Ga0209588_1011118 3300027671 Bacteria 2715
167 Ga0209588_1056799 3300027671 Bacteria 1265
168 Ga0209588_1103736 3300027671 Bacteria 914
169 Ga0268266_10000112 3300028379 Bacteria 168186
170 Ga0268264_10073110 3300028381 Bacteria 2909
171 Ga0268264_10252589 3300028381 Bacteria 1639
172 Ga0265320_10000008 3300031240 Bacteria 296209
173 Ga0265320_10186505 3300031240 Bacteria 929
174 Ga0265316_10026426 3300031344 Bacteria 4828
175 Ga0265316_10036182 3300031344 Bacteria 3993
176 Ga0265316_10073545 3300031344 Bacteria 2632
177 Ga0265316_10099797 3300031344 Bacteria 2208
178 Ga0265316_10177473 3300031344 Bacteria 1587
179 Ga0316579_10004127 3300031691 Bacteria 5740
180 Ga0316576_10004688 3300031727 Bacteria 8248
181 Ga0316576_10651051 3300031727 Bacteria 766
182 Ga0316577_10089424 3300031733 Bacteria 1723
183 Ga0307518_10008758 3300031838 Bacteria 7225
184 Ga0316212_1018271 3300033547 Archaea 986
185 Ga0373934_0003074 3300035086 Bacteria 6092
186 Ga0373923_0058023 3300035111 Bacteria 1638
187 Ga0373954_0000937 3300035118 Bacteria 11355
188 Ga0373956_0000858 3300035119 Bacteria 12654
189 Ga0373957_0002260 3300035120 Bacteria 5457
190 Ga0373955_0000656 3300035172 Bacteria 14739
191 Ga0373931_0028007 3300035691 Bacteria 2881
192 Ga0373933_0004816 3300035724 Bacteria 7375
193 Ga0373937_0003910 3300036401 Bacteria 12603
194 Ga0373937_0024965 3300036401 Bacteria 5394
195 Ga0316582_0193696 3300036647 Bacteria 1385
196 Ga0316584_0026598 3300036712 Bacteria 4253
197 Ga0316584_0168442 3300036712 Bacteria 1626
198 Ga0395898_0054591 3300037466 Bacteria 3898
199 Ga0395898_0145987 3300037466 Bacteria 2264
200 Ga0395905_0590978 3300037471 Bacteria 1012
201 Ga0316581_0084197 3300037588 Bacteria 978
202 Ga0436364_0610132 3300037853 Bacteria 30546
203 Ga0395901_0216226 3300038443 Bacteria 2005
204 Ga0436363_1197295 3300039450 Bacteria 686
205 Ga0436362_0200075 3300039453 Bacteria 2957
206 Ga0439457_034348 3300042014 Unclassified 1127
207 Ga0466966_0548040 3300044684 Bacteria 696
208 Ga0466959_0159802 3300045049 Bacteria 1585
209 Ga0451576_0110336 3300045051 Bacteria 2863
210 Ga0466958_0192036 3300045836 Bacteria 1298
211 Ga0495592_0643978 3300046454 Bacteria 642
212 Ga0495629_0048884 3300046459 Unclassified 2965
213 Ga0495641_0139235 3300046461 Bacteria 1084
214 Ga0495651_0023587 3300046462 Bacteria 4784
215 Ga0495653_0176512 3300046463 Bacteria 1470
216 Ga0495580_0001052 3300046472 Bacteria 24258
217 Ga0495582_0001596 3300046473 Bacteria 12784
218 Ga0495582_0017925 3300046473 Bacteria 3870
219 Ga0495639_0005285 3300046475 Bacteria 5556
220 Ga0495662_0093179 3300046476 Bacteria 1470
221 Ga0495584_0043523 3300046491 Bacteria 2266
222 Ga0495585_0000171 3300046492 Bacteria 70110
223 Ga0495594_0050444 3300046499 Bacteria 2288
224 Ga0495594_0432679 3300046499 Bacteria 748
225 Ga0495596_0000578 3300046500 Bacteria 22865
226 Ga0495608_0012739 3300046511 Bacteria 5836
227 Ga0495608_0015383 3300046511 Bacteria 5307
228 Ga0495630_0080765 3300046517 Unclassified 2453
229 Ga0495631_0005997 3300046518 Bacteria 6320
230 Ga0495643_0373175 3300046522 Bacteria 634
231 Ga0495665_0107551 3300046531 Bacteria 1463
232 Ga0495586_0127090 3300046535 Bacteria 1426
233 Ga0495587_0004686 3300046536 Bacteria 8976
234 Ga0495609_0013471 3300046538 Bacteria 3859
235 Ga0495609_0179545 3300046538 Bacteria 891
236 Ga0495622_0078981 3300046557 Bacteria 1515
237 Ga0495633_0217689 3300046558 Bacteria 874
238 Ga0495667_0003816 3300046559 Bacteria 10118
239 Ga0495667_0141648 3300046559 Bacteria 1549
240 Ga0495611_0011656 3300046648 Bacteria 3729
241 Ga0495625_0029975 3300046660 Bacteria 4063
242 Ga0495657_0002716 3300046675 Bacteria 14772
243 Ga0495623_0112547 3300046679 Bacteria 1648
244 Ga0495647_0027934 3300046681 Bacteria 2077
245 Ga0495658_0032050 3300046683 Bacteria 2867
246 Ga0495658_0065582 3300046683 Unclassified 2095
247 Ga0495581_0030675 3300047315 Bacteria 3114
248 Ga0495604_0000247 3300047317 Bacteria 48399
249 Ga0495676_0089437 3300047321 Bacteria 2307
250 Ga0495680_0008081 3300047322 Bacteria 9593
251 Ga0495675_0178720 3300047444 Bacteria 1300
252 Ga0495675_0321866 3300047444 Bacteria 915
253 Ga0495673_0031886 3300047469 Bacteria 2464
254 Ga0495684_0075945 3300047471 Bacteria 2552
255 Ga0495684_0243548 3300047471 Bacteria 1310
256 Ga0495602_0001794 3300048088 Bacteria 21461
257 Ga0495614_0060666 3300048089 Bacteria 1625
258 Ga0496103_0015687 3300048906 Bacteria 4515
259 Ga0496114_0023652 3300048917 Bacteria 5015
260 Ga0496114_0399385 3300048917 Bacteria 1217
261 Ga0496115_0028025 3300048918 Bacteria 4411
262 Ga0501034_0005884 3300049571 Bacteria 13321
263 Ga0501036_0838789 3300049572 Bacteria 756
264 Ga0501037_0192031 3300049573 Bacteria 1446
265 Ga0501038_0136766 3300049574 Bacteria 2007
266 Ga0501039_0027415 3300049575 Bacteria 4380
267 Ga0501040_0052982 3300049576 Bacteria 2778
268 Ga0501041_0011579 3300049577 Bacteria 5218
269 Ga0501041_0027404 3300049577 Bacteria 3433
270 Ga0501042_0032868 3300049578 Bacteria 3675
271 Ga0501046_0168576 3300049580 Bacteria 1644
272 Ga0501048_0245272 3300049582 Bacteria 1271
273 Ga0501048_0803225 3300049582 Bacteria 676
274 Ga0501071_0030662 3300049587 Bacteria 3804
275 Ga0501072_0010665 3300049588 Bacteria 6999
276 Ga0501072_0969943 3300049588 Bacteria 663
277 Ga0501075_0079899 3300049591 Bacteria 2475
278 Ga0501076_0006005 3300049592 Bacteria 8774
279 Ga0501076_0105862 3300049592 Bacteria 2270
280 Ga0501077_0001052 3300049593 Bacteria 16652
281 Ga0501079_0067977 3300049741 Bacteria 2750
282 Ga0501080_0084186 3300049742 Bacteria 2955
283 Ga0501081_0147056 3300049743 Bacteria 1691
284 Ga0501081_0234524 3300049743 Bacteria 1337
285 Ga0501083_0119863 3300049744 Bacteria 1726
286 Ga0501044_0011717 3300049823 Bacteria 9496
287 Ga0501044_0349770 3300049823 Bacteria 1398
288 Ga0501045_0015796 3300049824 Bacteria 5355
289 nmdc:mga03n38_18646_c1 3300050490 Bacteria 2743
290 nmdc:mga07m45_272368_c1 3300050496 Bacteria 985
291 nmdc:mga0n895_721279_c1 3300050512 Bacteria 992
292 nmdc:mga0n895_875753_c1 3300050512 Bacteria 885
293 nmdc:mga0n895_95788_c1 3300050512 Bacteria 2973
294 nmdc:mga0rr50_229429_c1 3300050513 Bacteria 1536
295 nmdc:mga0rr50_332408_c1 3300050513 Bacteria 1276
296 nmdc:mga0rr50_383684_c1 3300050513 Bacteria 1185
297 nmdc:mga0rr50_40301_c1 3300050513 Bacteria 3395
298 nmdc:mga08x19_688210_c1 3300050514 Bacteria 726
299 nmdc:mga0a205_209419_c1 3300050515 Bacteria 1838
300 nmdc:mga0a205_401869_c1 3300050515 Bacteria 1234
301 Ga0495619_0199848 3300053085 Bacteria 1384
302 Ga0501084_0043915 3300054114 Bacteria 3740
303 Ga0587128_064114 3300059630 Bacteria 701
304 Ga0501082_0091268 3300060353 Bacteria 2630
305 2535484913 2534681786 Bacteria 3308809
306 2644251311 2643221645 Bacteria 7207331
307 2644357489 2643221664 Bacteria 7272945
308 2776914671 2775507049 Bacteria 6284736
309 2842402026 2842395702 Bacteria 6780583
310 2854912131 2854911287 Bacteria 5582813
311 2857561790 2857558681 Bacteria 6617694
312 2904425680 2904424332 Bacteria 7633521
313 639785124 639633007 Bacteria 4376040
314 8005699123 8005695170 Bacteria 6912330
315 8056379710 8056375014 Bacteria 7006639
316 Ga0070712_100039204
317 Ga0070670_100000537
318 Ga0070666_10013703
319 Ga0070666_10061020
320 Ga0068868_100001838
321 Ga0068868_100869507
322 Ga0070689_100036038
323 Ga0070687_100072061
324 Ga0070675_100058658
325 Ga0070671_100009638
326 Ga0070673_100032137
327 Ga0070673_100053070
328 Ga0070688_100047959
329 Ga0070667_100001696
330 Ga0070709_10001992
331 Ga0070709_10128146
332 Ga0070709_10885820
333 Ga0070714_100109854
334 Ga0070713_100003185
335 Ga0070710_10090834
336 Ga0070711_100025245
337 Ga0070711_100210032
338 Ga0070711_100536956
339 Ga0070708_100057815
340 Ga0070708_100162195
341 Ga0070678_100607013
342 Ga0070707_100018285
343 Ga0070707_100419755
344 Ga0070707_100577829
345 Ga0070707_100645601
346 Ga0070698_100010920
347 Ga0070698_101148177
348 Ga0070699_100866747
349 Ga0070697_100469680
350 Ga0070672_100001567
351 Ga0070672_100199179
352 Ga0070686_100017516
353 Ga0070665_100001237
354 Ga0068855_100065313
355 Ga0070664_100034842
356 Ga0070664_100087180
357 Ga0068856_100111441
358 Ga0070702_100190121
359 Ga0068852_100007878
360 Ga0068859_101062783
361 Ga0068864_100001816
362 Ga0068866_10353990
363 Ga0068863_100012703
364 Ga0068863_100019245
365 Ga0068863_100028856
366 Ga0068858_100022920
367 Ga0068858_100090342
368 Ga0068858_100125550
369 Ga0068858_100491601
370 Ga0068860_100079848
371 Ga0081455_10171780
372 Ga0070715_10318226
373 Ga0070716_100001520
374 Ga0070716_100029008
375 Ga0070712_100140430
376 Ga0070712_100316931
377 Ga0070712_101098175
378 Ga0075362_10012719
379 Ga0097621_100002270
380 Ga0097621_100069546
381 Ga0097621_100169701
382 Ga0097621_100486961
383 Ga0068871_100004497
384 Ga0068871_100047702
385 Ga0068871_100061560
386 Ga0068871_100178801
387 Ga0068871_100179718
388 Ga0075433_10115007
389 Ga0075434_100120688
390 Ga0075434_100123436
391 Ga0068865_100505611
392 Ga0097620_100017774
393 Ga0097620_101062474
394 Ga0075435_100046346
395 Ga0075435_100364386
396 Ga0099794_10011029
397 Ga0099794_10018141
398 Ga0099794_10024084
399 Ga0099794_10027208
400 Ga0099794_10091426
401 Ga0099794_10205837
402 Ga0099795_10106821
403 Ga0111539_10992687
404 Ga0105243_10643606
405 Ga0105242_10051122
406 Ga0105248_10001467
407 Ga0105248_10006328
408 Ga0105248_10037313
409 Ga0105248_10158541
410 Ga0105249_10180421
411 Ga0105249_10473091
412 Ga0105246_10060947
413 Ga0157374_10167386
414 Ga0157378_10032237
415 Ga0163162_10007413
416 Ga0163162_10034707
417 Ga0157372_10004217
418 Ga0157375_10004543
419 Ga0157375_10008100
420 Ga0157375_10054392
421 Ga0157375_10200247
422 Ga0163163_10009699
423 Ga0163163_10021945
424 Ga0157379_10033467
425 Ga0157379_10122048
426 Ga0157376_10000008
427 Ga0157376_10002432
428 Ga0206349_1639792
429 Ga0213874_10002918
430 Ga0213875_10002058
431 Ga0207680_10082134
432 Ga0207680_10157836
433 Ga0207699_10003156
434 Ga0207684_10045697
435 Ga0207693_10042359
436 Ga0207693_10075097
437 Ga0207663_10227585
438 Ga0207663_10367666
439 Ga0207663_10530523
440 Ga0207662_10065016
441 Ga0207646_10020965
442 Ga0207646_10036155
443 Ga0207646_10342843
444 Ga0207650_10022666
445 Ga0207650_10276794
446 Ga0207659_10309647
447 Ga0207700_10024968
448 Ga0207664_10006865
449 Ga0207644_10033340
450 Ga0207704_10243884
451 Ga0207704_10275698
452 Ga0207665_10000043
453 Ga0207665_10005500
454 Ga0207665_10006335
455 Ga0207665_10058184
456 Ga0207691_10001987
457 Ga0207691_10349815
458 Ga0207711_10000014
459 Ga0207711_10008806
460 Ga0207711_10050277
461 Ga0207679_10062613
462 Ga0207679_10489743
463 Ga0207667_10130788
464 Ga0207651_10002931
465 Ga0207651_10399233
466 Ga0207658_10003392
467 Ga0207677_10000807
468 Ga0207703_10053634
469 Ga0207703_10071489
470 Ga0207703_10277207
471 Ga0207703_10331722
472 Ga0207702_10064469
473 Ga0207641_10004023
474 Ga0207641_10011896
475 Ga0207641_10172058
476 Ga0207648_10247669
477 Ga0207676_10038218
478 Ga0207698_10003853
479 Ga0209588_1002048
480 Ga0209588_1007035
481 Ga0209588_1011118
482 Ga0209588_1056799
483 Ga0209588_1103736
484 Ga0268266_10000112
485 Ga0268264_10073110
486 Ga0268264_10252589
487 Ga0265320_10000008
488 Ga0265320_10186505
489 Ga0265316_10026426
490 Ga0265316_10036182
491 Ga0265316_10073545
492 Ga0265316_10099797
493 Ga0265316_10177473
494 Ga0316579_10004127
495 Ga0316576_10004688
496 Ga0316576_10651051
497 Ga0316577_10089424
498 Ga0307518_10008758
499 Ga0316212_1018271
500 Ga0373934_0003074
501 Ga0373923_0058023
502 Ga0373954_0000937
503 Ga0373956_0000858
504 Ga0373957_0002260
505 Ga0373955_0000656
506 Ga0373931_0028007
507 Ga0373933_0004816
508 Ga0373937_0003910
509 Ga0373937_0024965
510 Ga0316582_0193696
511 Ga0316584_0026598
512 Ga0316584_0168442
513 Ga0395898_0054591
514 Ga0395898_0145987
515 Ga0395905_0590978
516 Ga0316581_0084197
517 Ga0436364_0610132
518 Ga0395901_0216226
519 Ga0436363_1197295
520 Ga0436362_0200075
521 Ga0439457_034348
522 Ga0466966_0548040
523 Ga0466959_0159802
524 Ga0451576_0110336
525 Ga0466958_0192036
526 Ga0495592_0643978
527 Ga0495629_0048884
528 Ga0495641_0139235
529 Ga0495651_0023587
530 Ga0495653_0176512
531 Ga0495580_0001052
532 Ga0495582_0001596
533 Ga0495582_0017925
534 Ga0495639_0005285
535 Ga0495662_0093179
536 Ga0495584_0043523
537 Ga0495585_0000171
538 Ga0495594_0050444
539 Ga0495594_0432679
540 Ga0495596_0000578
541 Ga0495608_0012739
542 Ga0495608_0015383
543 Ga0495630_0080765
544 Ga0495631_0005997
545 Ga0495643_0373175
546 Ga0495665_0107551
547 Ga0495586_0127090
548 Ga0495587_0004686
549 Ga0495609_0013471
550 Ga0495609_0179545
551 Ga0495622_0078981
552 Ga0495633_0217689
553 Ga0495667_0003816
554 Ga0495667_0141648
555 Ga0495611_0011656
556 Ga0495625_0029975
557 Ga0495657_0002716
558 Ga0495623_0112547
559 Ga0495647_0027934
560 Ga0495658_0032050
561 Ga0495658_0065582
562 Ga0495581_0030675
563 Ga0495604_0000247
564 Ga0495676_0089437
565 Ga0495680_0008081
566 Ga0495675_0178720
567 Ga0495675_0321866
568 Ga0495673_0031886
569 Ga0495684_0075945
570 Ga0495684_0243548
571 Ga0495602_0001794
572 Ga0495614_0060666
573 Ga0496103_0015687
574 Ga0496114_0023652
575 Ga0496114_0399385
576 Ga0496115_0028025
577 Ga0501034_0005884
578 Ga0501036_0838789
579 Ga0501037_0192031
580 Ga0501038_0136766
581 Ga0501039_0027415
582 Ga0501040_0052982
583 Ga0501041_0011579
584 Ga0501041_0027404
585 Ga0501042_0032868
586 Ga0501046_0168576
587 Ga0501048_0245272
588 Ga0501048_0803225
589 Ga0501071_0030662
590 Ga0501072_0010665
591 Ga0501072_0969943
592 Ga0501075_0079899
593 Ga0501076_0006005
594 Ga0501076_0105862
595 Ga0501077_0001052
596 Ga0501079_0067977
597 Ga0501080_0084186
598 Ga0501081_0147056
599 Ga0501081_0234524
600 Ga0501083_0119863
601 Ga0501044_0011717
602 Ga0501044_0349770
603 Ga0501045_0015796
604 nmdc:mga03n38_18646_c1
605 nmdc:mga07m45_272368_c1
606 nmdc:mga0n895_721279_c1
607 nmdc:mga0n895_875753_c1
608 nmdc:mga0n895_95788_c1
609 nmdc:mga0rr50_229429_c1
610 nmdc:mga0rr50_332408_c1
611 nmdc:mga0rr50_383684_c1
612 nmdc:mga0rr50_40301_c1
613 nmdc:mga08x19_688210_c1
614 nmdc:mga0a205_209419_c1
615 nmdc:mga0a205_401869_c1
616 Ga0495619_0199848
617 Ga0501084_0043915
618 Ga0587128_064114
619 Ga0501082_0091268
620 2535484913
621 2644251311
622 2644357489
623 2776914671
624 2842402026
625 2854912131
626 2857561790
627 2904425680
628 639785124
629 8005699123
630 8056379710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

30

212

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofw-assembly2.cif.gz_F crystal structure of arabidopsis thaliana dj-1d 0.9636 3 188
3uk7-assembly1.cif.gz_C crystal structure of arabidopsis thaliana dj-1d 0.9632 3 188
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9613 3 187
4ogg-assembly1.cif.gz_A crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog 0.9519 3 193
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9502 3 187
ID Description Score Start End Superfamily
af_K7LRD9_139_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9745 3 104 3.40.50.880
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9568 2 193 3.40.50.880
af_K7LRD9_234_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 131 193 3.40.50.720
4oggA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9476 2 190 3.40.50.880
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9471 2 193 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2S8K2R1-F1-model_v4 deleted 1.005 89 181
AF-A0A352IP49-F1-model_v4 Protease 1.004 95 180 GO:0006508
GO:0008233
AF-A0A7U3R3L3-F1-model_v4 deleted 1.004 102 187
AF-B1B3Q6-F1-model_v4 Uncharacterized protein agf2 0.9887 92 188
AF-A0A1C7Z0C6-F1-model_v4 Glutamine amidotransferase 0.9886 102 193 GO:0016740

Map