F403103

General Info

Members Datasets Scaffolds Average Seq Length
315 222 630 162

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10000446|Ga0075368_100004463
Length 181
Sequence MSGAAEHGAPAGGSVFASGVKEQTIRANPSVARVAAVLSGAGSTARIMVTDEAAHSAAEAARVLACDVAQIAKSIIFRSKDSDRVVLVVTSGANRVNEKRVVEEIGEKIGKADADFVKQRTGFSIGGVAPLGHLTEPITLLDADLMKFDLVFPAAGHPNTMFRIAPDELARLTGAKICPVN

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
221 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
222 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 0
Rhizoplane 2.22
Rhizosphere 85.4
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10000446 3300006042 Bacteria 12188
2 JGI24740J21852_10031694 3300001979 Bacteria 1701
3 JGI25156J39149_1000551 3300002705 Bacteria 21420
4 rootH1_10043390 3300003316 Bacteria 3027
5 rootL2_10000181 3300003322 Bacteria 16274
6 Ga0055542_1008002 3300003762 Bacteria 2098
7 Ga0070676_10930546 3300005328 Bacteria 649
8 Ga0070690_100130751 3300005330 Bacteria 1695
9 Ga0070670_100059144 3300005331 Bacteria 3289
10 Ga0070677_10743767 3300005333 Bacteria 556
11 Ga0070680_100173028 3300005336 Bacteria 1817
12 Ga0070682_100077262 3300005337 Bacteria 2145
13 Ga0068868_100291681 3300005338 Bacteria 1383
14 Ga0070661_100062531 3300005344 Bacteria 2732
15 Ga0070668_100216070 3300005347 Bacteria 1579
16 Ga0070669_100160888 3300005353 Bacteria 1744
17 Ga0070675_100099693 3300005354 Bacteria 2446
18 Ga0070671_100011120 3300005355 Bacteria 7228
19 Ga0070671_100236318 3300005355 Bacteria 1551
20 Ga0070674_100886302 3300005356 Bacteria 776
21 Ga0070673_100128925 3300005364 Bacteria 2120
22 Ga0070667_100415432 3300005367 Bacteria 1226
23 Ga0070709_10442108 3300005434 Bacteria 978
24 Ga0070713_100710699 3300005436 Unclassified 960
25 Ga0070711_100287825 3300005439 Unclassified 1302
26 Ga0070705_100228213 3300005440 Bacteria 1293
27 Ga0070705_100332640 3300005440 Bacteria 1101
28 Ga0070694_100378884 3300005444 Bacteria 1103
29 Ga0070694_100502267 3300005444 Bacteria 965
30 Ga0070708_100620705 3300005445 Bacteria 1019
31 Ga0070678_100117187 3300005456 Bacteria 2094
32 Ga0070662_100164392 3300005457 Bacteria 1738
33 Ga0070681_10026843 3300005458 Bacteria 5789
34 Ga0068867_100494768 3300005459 Bacteria 1050
35 Ga0068867_100702459 3300005459 Bacteria 892
36 Ga0070707_100037749 3300005468 Bacteria 4612
37 Ga0070707_100322037 3300005468 Bacteria 1502
38 Ga0070699_100138670 3300005518 Bacteria 2146
39 Ga0070679_100009227 3300005530 Bacteria 9322
40 Ga0070679_100214533 3300005530 Bacteria 1887
41 Ga0070672_100095080 3300005543 Bacteria 2410
42 Ga0070686_100184403 3300005544 Bacteria 1485
43 Ga0070695_100383108 3300005545 Bacteria 1062
44 Ga0070696_100080848 3300005546 Bacteria 2302
45 Ga0070696_100377058 3300005546 Bacteria 1105
46 Ga0070693_100372799 3300005547 Bacteria 982
47 Ga0070704_100030021 3300005549 Bacteria 3638
48 Ga0070704_101817196 3300005549 Bacteria 564
49 Ga0068857_100143961 3300005577 Bacteria 2156
50 Ga0068856_100962094 3300005614 Bacteria 872
51 Ga0070702_100099836 3300005615 Bacteria 1778
52 Ga0068859_100192841 3300005617 Bacteria 2122
53 Ga0068866_10250698 3300005718 Bacteria 1083
54 Ga0068861_100660182 3300005719 Unclassified 967
55 Ga0068861_101079289 3300005719 Bacteria 771
56 Ga0068870_10266321 3300005840 Bacteria 1069
57 Ga0068863_100019341 3300005841 Bacteria 6513
58 Ga0068863_100139115 3300005841 Unclassified 2320
59 Ga0068858_100187598 3300005842 Bacteria 1953
60 Ga0068858_100323998 3300005842 Bacteria 1473
61 Ga0068858_101415577 3300005842 Bacteria 685
62 Ga0068860_100133538 3300005843 Bacteria 2383
63 Ga0068860_100969715 3300005843 Bacteria 868
64 Ga0068862_100049082 3300005844 Bacteria 3604
65 Ga0081538_10034461 3300005981 Bacteria 3347
66 Ga0075365_10094854 3300006038 Bacteria 2037
67 Ga0075363_100048708 3300006048 Bacteria 2254
68 Ga0075364_10037142 3300006051 Bacteria 3152
69 Ga0075362_10007039 3300006177 Bacteria 4227
70 Ga0075369_10032095 3300006186 Bacteria 2221
71 Ga0075369_10043504 3300006186 Bacteria 1927
72 Ga0075366_10013056 3300006195 Bacteria 4724
73 Ga0097621_100835490 3300006237 Bacteria 855
74 Ga0075370_10005646 3300006353 Bacteria 6244
75 Ga0068871_100922397 3300006358 Bacteria 810
76 Ga0075428_100000367 3300006844 Bacteria 44787
77 Ga0075428_100269963 3300006844 Bacteria 1830
78 Ga0075430_100000036 3300006846 Bacteria 68655
79 Ga0075430_100113591 3300006846 Unclassified 2257
80 Ga0075431_100000370 3300006847 Bacteria 35785
81 Ga0075431_100163131 3300006847 Bacteria 2291
82 Ga0075433_10031485 3300006852 Bacteria 4535
83 Ga0075433_10036013 3300006852 Bacteria 4260
84 Ga0075434_100028275 3300006871 Bacteria 5506
85 Ga0075434_100147613 3300006871 Unclassified 2372
86 Ga0075434_100149172 3300006871 Bacteria 2358
87 Ga0075429_100000001 3300006880 Bacteria 139031
88 Ga0075429_100096909 3300006880 Unclassified 2573
89 Ga0075429_100614256 3300006880 Bacteria 953
90 Ga0068865_100773046 3300006881 Bacteria 826
91 Ga0075436_100323144 3300006914 Bacteria 1109
92 Ga0097620_100192839 3300006931 Bacteria 2122
93 Ga0075435_100004683 3300007076 Bacteria 9432
94 Ga0075435_100043400 3300007076 Bacteria 3599
95 Ga0099794_10204987 3300007265 Bacteria 1010
96 Ga0105251_10308323 3300009011 Bacteria 718
97 Ga0105240_10323044 3300009093 Bacteria 1758
98 Ga0111539_10000796 3300009094 Bacteria 41092
99 Ga0111539_10004822 3300009094 Bacteria 17581
100 Ga0111539_10161065 3300009094 Bacteria 2624
101 Ga0111539_10298572 3300009094 Bacteria 1875
102 Ga0111539_11541242 3300009094 Bacteria 771
103 Ga0114129_10025650 3300009147 Bacteria 8351
104 Ga0114129_10046457 3300009147 Bacteria 6102
105 Ga0114129_10130966 3300009147 Bacteria 3445
106 Ga0114129_10152028 3300009147 Unclassified 3167
107 Ga0114129_10185400 3300009147 Bacteria 2829
108 Ga0114129_10228429 3300009147 Bacteria 2507
109 Ga0114129_10239341 3300009147 Bacteria 2440
110 Ga0105243_10098655 3300009148 Bacteria 2420
111 Ga0105243_11507944 3300009148 Bacteria 696
112 Ga0105241_11160695 3300009174 Unclassified 730
113 Ga0105242_10277458 3300009176 Bacteria 1521
114 Ga0105237_11034207 3300009545 Bacteria 828
115 Ga0105238_11033481 3300009551 Bacteria 843
116 Ga0105249_11097228 3300009553 Bacteria 866
117 Ga0157373_10009206 3300013100 Bacteria 7304
118 Ga0157370_10056529 3300013104 Bacteria 3734
119 Ga0157378_10737394 3300013297 Bacteria 1007
120 Ga0157378_11773521 3300013297 Bacteria 665
121 Ga0157372_10006547 3300013307 Bacteria 12391
122 Ga0157380_10042149 3300014326 Bacteria 3567
123 Ga0213876_10049541 3300021384 Bacteria 2219
124 Ga0209148_1000829 3300025254 Bacteria 22139
125 Ga0209455_1000661 3300025272 Bacteria 20976
126 Ga0207682_10086849 3300025893 Bacteria 1350
127 Ga0207684_10122552 3300025910 Bacteria 2229
128 Ga0207684_10123648 3300025910 Bacteria 2219
129 Ga0207707_10029870 3300025912 Bacteria 4766
130 Ga0207663_10406349 3300025916 Unclassified 1042
131 Ga0207660_10046583 3300025917 Bacteria 3060
132 Ga0207660_10134813 3300025917 Bacteria 1883
133 Ga0207652_10079787 3300025921 Bacteria 2860
134 Ga0207646_10008503 3300025922 Bacteria 10271
135 Ga0207646_10129085 3300025922 Bacteria 2274
136 Ga0207646_10300162 3300025922 Bacteria 1451
137 Ga0207681_10021101 3300025923 Bacteria 4136
138 Ga0207694_10953079 3300025924 Bacteria 726
139 Ga0207650_10494739 3300025925 Bacteria 1021
140 Ga0207650_11748386 3300025925 Bacteria 527
141 Ga0207700_10631892 3300025928 Unclassified 954
142 Ga0207644_10004954 3300025931 Bacteria 8691
143 Ga0207644_10619228 3300025931 Bacteria 900
144 Ga0207706_10434216 3300025933 Bacteria 1137
145 Ga0207709_10559803 3300025935 Bacteria 900
146 Ga0207669_10047988 3300025937 Bacteria 2534
147 Ga0207669_10191178 3300025937 Bacteria 1477
148 Ga0207669_10333879 3300025937 Bacteria 1165
149 Ga0207704_10354639 3300025938 Bacteria 1143
150 Ga0207665_10510459 3300025939 Bacteria 930
151 Ga0207691_10020391 3300025940 Bacteria 6266
152 Ga0207651_11679180 3300025960 Bacteria 572
153 Ga0207668_10200973 3300025972 Bacteria 1587
154 Ga0207677_11181442 3300026023 Bacteria 700
155 Ga0207639_10074608 3300026041 Bacteria 2664
156 Ga0207678_10657799 3300026067 Bacteria 921
157 Ga0207702_10756176 3300026078 Bacteria 959
158 Ga0207641_10312552 3300026088 Bacteria 1487
159 Ga0207648_10399108 3300026089 Bacteria 1246
160 Ga0207648_10666377 3300026089 Unclassified 962
161 Ga0207674_10055957 3300026116 Bacteria 4007
162 Ga0207675_100782309 3300026118 Unclassified 967
163 Ga0207675_101360739 3300026118 Bacteria 731
164 Ga0207675_101798549 3300026118 Bacteria 632
165 Ga0207428_10000018 3300027907 Bacteria 293117
166 Ga0207428_10000057 3300027907 Bacteria 158615
167 Ga0207428_10277160 3300027907 Bacteria 1245
168 Ga0268265_10014060 3300028380 Bacteria 5454
169 Ga0268264_10314220 3300028381 Bacteria 1479
170 Ga0268264_10475025 3300028381 Bacteria 1215
171 Ga0268264_11158592 3300028381 Bacteria 782
172 Ga0268264_11174454 3300028381 Bacteria 777
173 Ga0307511_10000103 3300030521 Bacteria 75234
174 Ga0265327_10113419 3300031251 Bacteria 1292
175 Ga0307408_100328321 3300031548 Bacteria 1291
176 Ga0307408_100646751 3300031548 Bacteria 945
177 Ga0307413_10017652 3300031824 Bacteria 3722
178 Ga0307410_10047746 3300031852 Bacteria 2863
179 Ga0307407_10736265 3300031903 Bacteria 745
180 Ga0307409_100750566 3300031995 Bacteria 979
181 Ga0307416_100230487 3300032002 Bacteria 1785
182 Ga0307415_100740705 3300032126 Bacteria 891
183 Ga0373940_0045877 3300035088 Unclassified 1215
184 Ga0373939_0041524 3300035114 Bacteria 1387
185 Ga0373941_0092027 3300035115 Unclassified 1042
186 Ga0373962_0112023 3300035242 Bacteria 862
187 Ga0373931_0038962 3300035691 Unclassified 2489
188 Ga0373931_0675804 3300035691 Bacteria 680
189 Ga0373933_0402434 3300035724 Bacteria 893
190 Ga0373937_0237143 3300036401 Bacteria 1718
191 Ga0436365_1051341 3300039437 Bacteria 7158
192 Ga0436365_1329067 3300039437 Bacteria 600
193 Ga0436360_0542449 3300039438 Bacteria 758
194 Ga0436360_1350931 3300039438 Bacteria 1431
195 Ga0436361_0900547 3300039447 Bacteria 2997
196 Ga0439466_0057033 3300041411 Unclassified 1266
197 Ga0439465_0366412 3300041413 Bacteria 546
198 Ga0451853_0741025 3300041512 Bacteria 1130
199 Ga0450889_004310 3300042144 Bacteria 1406
200 Ga0439446_0169106 3300042156 Bacteria 726
201 Ga0439434_0149040 3300042435 Bacteria 774
202 Ga0451577_0133531 3300042876 Bacteria 2228
203 Ga0466963_0294055 3300044694 Bacteria 1142
204 Ga0466959_0431851 3300045049 Bacteria 894
205 Ga0451576_0121192 3300045051 Bacteria 2723
206 Ga0451576_0403381 3300045051 Bacteria 1433
207 Ga0451576_0817504 3300045051 Bacteria 978
208 Ga0466967_0125991 3300045976 Bacteria 2372
209 Ga0495592_0115490 3300046454 Bacteria 1895
210 Ga0495629_0539719 3300046459 Bacteria 783
211 Ga0495580_0000199 3300046472 Bacteria 46030
212 Ga0495584_0200296 3300046491 Bacteria 1015
213 Ga0495642_0024307 3300046528 Bacteria 2397
214 Ga0495640_0174474 3300046533 Bacteria 1373
215 Ga0495598_0108450 3300046537 Bacteria 928
216 Ga0495621_0005175 3300046539 Bacteria 3731
217 Ga0495621_0043612 3300046539 Bacteria 1582
218 Ga0495674_0437060 3300047319 Bacteria 1053
219 Ga0495602_0034414 3300048088 Bacteria 4740
220 Ga0495602_0405590 3300048088 Bacteria 971
221 Ga0496102_0052964 3300048905 Bacteria 3699
222 Ga0496105_0307672 3300048908 Bacteria 1273
223 Ga0496106_0242735 3300048909 Bacteria 1439
224 Ga0496108_0717103 3300048911 Bacteria 867
225 Ga0496108_1166029 3300048911 Bacteria 653
226 Ga0496111_0266895 3300048914 Bacteria 1270
227 Ga0496113_1024192 3300048916 Bacteria 650
228 Ga0496126_0488689 3300048929 Bacteria 985
229 Ga0501032_0806450 3300049569 Bacteria 593
230 Ga0501034_1158600 3300049571 Bacteria 653
231 Ga0501034_1648645 3300049571 Bacteria 514
232 Ga0501036_0142655 3300049572 Bacteria 2021
233 Ga0501038_0645848 3300049574 Bacteria 797
234 Ga0501039_0395170 3300049575 Bacteria 1086
235 Ga0501047_0012583 3300049581 Bacteria 8016
236 Ga0501048_0146151 3300049582 Bacteria 1672
237 Ga0501048_0566565 3300049582 Bacteria 815
238 Ga0501067_0079642 3300049583 Bacteria 1815
239 Ga0501068_0560280 3300049584 Unclassified 743
240 Ga0501070_0020708 3300049586 Bacteria 5517
241 Ga0501070_0912539 3300049586 Bacteria 685
242 Ga0501072_0627505 3300049588 Bacteria 847
243 Ga0501073_0001259 3300049589 Bacteria 18568
244 Ga0501073_0188316 3300049589 Bacteria 1428
245 Ga0501075_0257794 3300049591 Bacteria 1329
246 Ga0501075_0393453 3300049591 Bacteria 1056
247 Ga0501075_0441537 3300049591 Unclassified 992
248 Ga0501076_0127763 3300049592 Bacteria 2060
249 Ga0501079_0044825 3300049741 Bacteria 3413
250 Ga0501079_0091212 3300049741 Bacteria 2361
251 Ga0501080_0277908 3300049742 Bacteria 1523
252 Ga0501080_0518789 3300049742 Bacteria 1063
253 Ga0501081_0047526 3300049743 Bacteria 2952
254 Ga0501083_0060761 3300049744 Bacteria 2524
255 Ga0501083_0224745 3300049744 Bacteria 1223
256 Ga0501044_0287343 3300049823 Bacteria 1577
257 Ga0501045_0434931 3300049824 Bacteria 976
258 nmdc:mga03683_7889_c1 3300050489 Bacteria 3717
259 nmdc:mga03n38_80266_c1 3300050490 Bacteria 1532
260 nmdc:mga0yw44_67149_c1 3300050492 Bacteria 2216
261 nmdc:mga0k408_31229_c1 3300050493 Bacteria 3041
262 nmdc:mga04h51_64915_c1 3300050495 Bacteria 1261
263 nmdc:mga05p37_1088355_c1 3300050507 Bacteria 838
264 nmdc:mga05p37_428557_c1 3300050507 Bacteria 1537
265 nmdc:mga05p37_5956_c1 3300050507 Bacteria 14347
266 nmdc:mga05p37_68596_c1 3300050507 Bacteria 4361
267 nmdc:mga05p37_75916_c1 3300050507 Bacteria 4137
268 nmdc:mga09592_385555_c1 3300050508 Unclassified 1212
269 nmdc:mga09592_498844_c1 3300050508 Bacteria 1048
270 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
271 nmdc:mga0qj67_15426_c1 3300050509 Bacteria 5785
272 nmdc:mga0qj67_1693_c1 3300050509 Bacteria 15545
273 nmdc:mga06r32_117222_c1 3300050510 Bacteria 2624
274 nmdc:mga06r32_1209842_c1 3300050510 Unclassified 702
275 nmdc:mga06r32_1336_c1 3300050510 Bacteria 22239
276 nmdc:mga08y16_1074638_c1 3300050511 Bacteria 781
277 nmdc:mga08y16_282_c1 3300050511 Bacteria 46166
278 nmdc:mga08y16_44_c1 3300050511 Bacteria 121496
279 nmdc:mga08y16_94513_c1 3300050511 Bacteria 3114
280 nmdc:mga0n895_1672931_c1 3300050512 Bacteria 599
281 nmdc:mga0n895_26864_c1 3300050512 Bacteria 5460
282 nmdc:mga0n895_4365_c1 3300050512 Bacteria 11597
283 nmdc:mga0n895_6613_c1 3300050512 Bacteria 9869
284 nmdc:mga0rr50_16594_c1 3300050513 Bacteria 4897
285 nmdc:mga08x19_1217577_c1 3300050514 Bacteria 534
286 nmdc:mga08x19_803268_c1 3300050514 Bacteria 668
287 nmdc:mga0a205_43640_c1 3300050515 Bacteria 4322
288 nmdc:mga0a205_901477_c1 3300050515 Bacteria 731
289 nmdc:mga0sz30_34987_c1 3300050516 Bacteria 2094
290 nmdc:mga0sz30_80104_c1 3300050516 Bacteria 1413
291 Ga0495601_0550023 3300053077 Bacteria 743
292 Ga0495595_0244714 3300053084 Bacteria 897
293 Ga0500646_0000596 3300053090 Bacteria 10412
294 Ga0500583_0003528 3300053092 Bacteria 4936
295 Ga0500583_0184861 3300053092 Bacteria 1037
296 Ga0500566_0306572 3300053094 Bacteria 745
297 Ga0500555_031796 3300053103 Bacteria 1494
298 Ga0500642_0038910 3300053130 Bacteria 2042
299 Ga0500568_0234304 3300053139 Bacteria 669
300 Ga0500588_0121610 3300053146 Bacteria 921
301 Ga0500604_0001276 3300053151 Bacteria 7050
302 Ga0500636_0437686 3300053177 Bacteria 595
303 Ga0500637_0154154 3300053178 Bacteria 1326
304 Ga0501084_0478558 3300054114 Bacteria 1052
305 Ga0501084_1101217 3300054114 Bacteria 667
306 Ga0590074_071093 3300059423 Bacteria 656
307 Ga0501082_0036323 3300060353 Bacteria 4245
308 Ga0501082_0234949 3300060353 Bacteria 1595
309 Ga0501082_1165052 3300060353 Bacteria 674
310 Ga0530510_0150821 3300061734 Bacteria 1716
311 Ga0530510_0218672 3300061734 Bacteria 1416
312 Ga0530510_0650581 3300061734 Bacteria 802
313 2808968454 2808606384 Bacteria 8474373
314 2809003285 2808606390 Bacteria 8476311
315 2809010562 2808606391 Bacteria 8308166
316 Ga0075368_10000446
317 JGI24740J21852_10031694
318 JGI25156J39149_1000551
319 rootH1_10043390
320 rootL2_10000181
321 Ga0055542_1008002
322 Ga0070676_10930546
323 Ga0070690_100130751
324 Ga0070670_100059144
325 Ga0070677_10743767
326 Ga0070680_100173028
327 Ga0070682_100077262
328 Ga0068868_100291681
329 Ga0070661_100062531
330 Ga0070668_100216070
331 Ga0070669_100160888
332 Ga0070675_100099693
333 Ga0070671_100011120
334 Ga0070671_100236318
335 Ga0070674_100886302
336 Ga0070673_100128925
337 Ga0070667_100415432
338 Ga0070709_10442108
339 Ga0070713_100710699
340 Ga0070711_100287825
341 Ga0070705_100228213
342 Ga0070705_100332640
343 Ga0070694_100378884
344 Ga0070694_100502267
345 Ga0070708_100620705
346 Ga0070678_100117187
347 Ga0070662_100164392
348 Ga0070681_10026843
349 Ga0068867_100494768
350 Ga0068867_100702459
351 Ga0070707_100037749
352 Ga0070707_100322037
353 Ga0070699_100138670
354 Ga0070679_100009227
355 Ga0070679_100214533
356 Ga0070672_100095080
357 Ga0070686_100184403
358 Ga0070695_100383108
359 Ga0070696_100080848
360 Ga0070696_100377058
361 Ga0070693_100372799
362 Ga0070704_100030021
363 Ga0070704_101817196
364 Ga0068857_100143961
365 Ga0068856_100962094
366 Ga0070702_100099836
367 Ga0068859_100192841
368 Ga0068866_10250698
369 Ga0068861_100660182
370 Ga0068861_101079289
371 Ga0068870_10266321
372 Ga0068863_100019341
373 Ga0068863_100139115
374 Ga0068858_100187598
375 Ga0068858_100323998
376 Ga0068858_101415577
377 Ga0068860_100133538
378 Ga0068860_100969715
379 Ga0068862_100049082
380 Ga0081538_10034461
381 Ga0075365_10094854
382 Ga0075363_100048708
383 Ga0075364_10037142
384 Ga0075362_10007039
385 Ga0075369_10032095
386 Ga0075369_10043504
387 Ga0075366_10013056
388 Ga0097621_100835490
389 Ga0075370_10005646
390 Ga0068871_100922397
391 Ga0075428_100000367
392 Ga0075428_100269963
393 Ga0075430_100000036
394 Ga0075430_100113591
395 Ga0075431_100000370
396 Ga0075431_100163131
397 Ga0075433_10031485
398 Ga0075433_10036013
399 Ga0075434_100028275
400 Ga0075434_100147613
401 Ga0075434_100149172
402 Ga0075429_100000001
403 Ga0075429_100096909
404 Ga0075429_100614256
405 Ga0068865_100773046
406 Ga0075436_100323144
407 Ga0097620_100192839
408 Ga0075435_100004683
409 Ga0075435_100043400
410 Ga0099794_10204987
411 Ga0105251_10308323
412 Ga0105240_10323044
413 Ga0111539_10000796
414 Ga0111539_10004822
415 Ga0111539_10161065
416 Ga0111539_10298572
417 Ga0111539_11541242
418 Ga0114129_10025650
419 Ga0114129_10046457
420 Ga0114129_10130966
421 Ga0114129_10152028
422 Ga0114129_10185400
423 Ga0114129_10228429
424 Ga0114129_10239341
425 Ga0105243_10098655
426 Ga0105243_11507944
427 Ga0105241_11160695
428 Ga0105242_10277458
429 Ga0105237_11034207
430 Ga0105238_11033481
431 Ga0105249_11097228
432 Ga0157373_10009206
433 Ga0157370_10056529
434 Ga0157378_10737394
435 Ga0157378_11773521
436 Ga0157372_10006547
437 Ga0157380_10042149
438 Ga0213876_10049541
439 Ga0209148_1000829
440 Ga0209455_1000661
441 Ga0207682_10086849
442 Ga0207684_10122552
443 Ga0207684_10123648
444 Ga0207707_10029870
445 Ga0207663_10406349
446 Ga0207660_10046583
447 Ga0207660_10134813
448 Ga0207652_10079787
449 Ga0207646_10008503
450 Ga0207646_10129085
451 Ga0207646_10300162
452 Ga0207681_10021101
453 Ga0207694_10953079
454 Ga0207650_10494739
455 Ga0207650_11748386
456 Ga0207700_10631892
457 Ga0207644_10004954
458 Ga0207644_10619228
459 Ga0207706_10434216
460 Ga0207709_10559803
461 Ga0207669_10047988
462 Ga0207669_10191178
463 Ga0207669_10333879
464 Ga0207704_10354639
465 Ga0207665_10510459
466 Ga0207691_10020391
467 Ga0207651_11679180
468 Ga0207668_10200973
469 Ga0207677_11181442
470 Ga0207639_10074608
471 Ga0207678_10657799
472 Ga0207702_10756176
473 Ga0207641_10312552
474 Ga0207648_10399108
475 Ga0207648_10666377
476 Ga0207674_10055957
477 Ga0207675_100782309
478 Ga0207675_101360739
479 Ga0207675_101798549
480 Ga0207428_10000018
481 Ga0207428_10000057
482 Ga0207428_10277160
483 Ga0268265_10014060
484 Ga0268264_10314220
485 Ga0268264_10475025
486 Ga0268264_11158592
487 Ga0268264_11174454
488 Ga0307511_10000103
489 Ga0265327_10113419
490 Ga0307408_100328321
491 Ga0307408_100646751
492 Ga0307413_10017652
493 Ga0307410_10047746
494 Ga0307407_10736265
495 Ga0307409_100750566
496 Ga0307416_100230487
497 Ga0307415_100740705
498 Ga0373940_0045877
499 Ga0373939_0041524
500 Ga0373941_0092027
501 Ga0373962_0112023
502 Ga0373931_0038962
503 Ga0373931_0675804
504 Ga0373933_0402434
505 Ga0373937_0237143
506 Ga0436365_1051341
507 Ga0436365_1329067
508 Ga0436360_0542449
509 Ga0436360_1350931
510 Ga0436361_0900547
511 Ga0439466_0057033
512 Ga0439465_0366412
513 Ga0451853_0741025
514 Ga0450889_004310
515 Ga0439446_0169106
516 Ga0439434_0149040
517 Ga0451577_0133531
518 Ga0466963_0294055
519 Ga0466959_0431851
520 Ga0451576_0121192
521 Ga0451576_0403381
522 Ga0451576_0817504
523 Ga0466967_0125991
524 Ga0495592_0115490
525 Ga0495629_0539719
526 Ga0495580_0000199
527 Ga0495584_0200296
528 Ga0495642_0024307
529 Ga0495640_0174474
530 Ga0495598_0108450
531 Ga0495621_0005175
532 Ga0495621_0043612
533 Ga0495674_0437060
534 Ga0495602_0034414
535 Ga0495602_0405590
536 Ga0496102_0052964
537 Ga0496105_0307672
538 Ga0496106_0242735
539 Ga0496108_0717103
540 Ga0496108_1166029
541 Ga0496111_0266895
542 Ga0496113_1024192
543 Ga0496126_0488689
544 Ga0501032_0806450
545 Ga0501034_1158600
546 Ga0501034_1648645
547 Ga0501036_0142655
548 Ga0501038_0645848
549 Ga0501039_0395170
550 Ga0501047_0012583
551 Ga0501048_0146151
552 Ga0501048_0566565
553 Ga0501067_0079642
554 Ga0501068_0560280
555 Ga0501070_0020708
556 Ga0501070_0912539
557 Ga0501072_0627505
558 Ga0501073_0001259
559 Ga0501073_0188316
560 Ga0501075_0257794
561 Ga0501075_0393453
562 Ga0501075_0441537
563 Ga0501076_0127763
564 Ga0501079_0044825
565 Ga0501079_0091212
566 Ga0501080_0277908
567 Ga0501080_0518789
568 Ga0501081_0047526
569 Ga0501083_0060761
570 Ga0501083_0224745
571 Ga0501044_0287343
572 Ga0501045_0434931
573 nmdc:mga03683_7889_c1
574 nmdc:mga03n38_80266_c1
575 nmdc:mga0yw44_67149_c1
576 nmdc:mga0k408_31229_c1
577 nmdc:mga04h51_64915_c1
578 nmdc:mga05p37_1088355_c1
579 nmdc:mga05p37_428557_c1
580 nmdc:mga05p37_5956_c1
581 nmdc:mga05p37_68596_c1
582 nmdc:mga05p37_75916_c1
583 nmdc:mga09592_385555_c1
584 nmdc:mga09592_498844_c1
585 nmdc:mga09592_66_c1
586 nmdc:mga0qj67_15426_c1
587 nmdc:mga0qj67_1693_c1
588 nmdc:mga06r32_117222_c1
589 nmdc:mga06r32_1209842_c1
590 nmdc:mga06r32_1336_c1
591 nmdc:mga08y16_1074638_c1
592 nmdc:mga08y16_282_c1
593 nmdc:mga08y16_44_c1
594 nmdc:mga08y16_94513_c1
595 nmdc:mga0n895_1672931_c1
596 nmdc:mga0n895_26864_c1
597 nmdc:mga0n895_4365_c1
598 nmdc:mga0n895_6613_c1
599 nmdc:mga0rr50_16594_c1
600 nmdc:mga08x19_1217577_c1
601 nmdc:mga08x19_803268_c1
602 nmdc:mga0a205_43640_c1
603 nmdc:mga0a205_901477_c1
604 nmdc:mga0sz30_34987_c1
605 nmdc:mga0sz30_80104_c1
606 Ga0495601_0550023
607 Ga0495595_0244714
608 Ga0500646_0000596
609 Ga0500583_0003528
610 Ga0500583_0184861
611 Ga0500566_0306572
612 Ga0500555_031796
613 Ga0500642_0038910
614 Ga0500568_0234304
615 Ga0500588_0121610
616 Ga0500604_0001276
617 Ga0500636_0437686
618 Ga0500637_0154154
619 Ga0501084_0478558
620 Ga0501084_1101217
621 Ga0590074_071093
622 Ga0501082_0036323
623 Ga0501082_0234949
624 Ga0501082_1165052
625 Ga0530510_0150821
626 Ga0530510_0218672
627 Ga0530510_0650581
628 2808968454
629 2809003285
630 2809010562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

51

172

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9446 10 165
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9392 10 165
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9387 10 165
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.9379 9 165
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9345 10 165
ID Description Score Start End Superfamily
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9335 9 165 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9276 9 165 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9151 16 164 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9037 16 164 3.90.960.10
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9025 11 165 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A2A4C545-F1-model_v4 Cys-tRNA(Pro)/cys-tRNA(Cys) deacylase 1.003 1 168 GO:0002161
AF-A2W6Z0-F1-model_v4 deleted 1.002 1 168
AF-A0A4R9PFS2-F1-model_v4 YbaK/EbsC family protein 0.9995 43 159 GO:0002161
AF-A0A1X7JYX2-F1-model_v4 Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC 0.999 7 168 GO:0002161
AF-A0A848NSJ1-F1-model_v4 YbaK/EbsC family protein 0.9987 83 165 GO:0002161

Map