F403100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 205 | 284 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10027092|Ga0070717_100270923 |
| Length | 419 |
| Sequence | MQPKSGVDMRRKSRLDKAMFRRVVLRARCSFSGATPKATPWMFLDHTNNQFLSVGKKGDEHDMTVGEAGKLALLWPRDAPKWHAKTPQDYRLHRVFEAMTALGIEAEPAIYADDVADQVRDQLLRCDGVLVWVDPLFAGQNRIVLDALLRDVASKGVWVSAHPDVILKMGVKEVLHHTRHLGWGTDTHLYRNTATFREEFPQRLRAGGARVLKQNRGNGGEGVWRVELSSEPAQGAATVRVLHAPRGSVTQDMPLGDFMNRCETYFANEGCIIDQPFQARLPDGMIRCYMGADKAVGFGHQFIKALIAPPPEGPDSAQPGPRIMHPASAPEFRALRTKMESEWTPQMMQLLGIEAESLPIIWDADFLYGPRDAAGQDTYVLCEINVSSVFPFPEQAPSEIARLARARVQSKKETRPMSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 3 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 6 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 7 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 8 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 9 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 10 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 11 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 12 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 13 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 14 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 15 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 16 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 17 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 18 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 19 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 20 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 21 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 22 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 136 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 198 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 199 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 201 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 202 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 203 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 204 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 205 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.16 |
| Metatranscriptomes | 0 |
| Isolates | 9.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.17 |
| Nodule | 5.71 |
| Rhizoplane | 4.13 |
| Rhizosphere | 79.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10024743 | 3300003203 | Bacteria | 2347 |
| 2 | JGI25404J52841_10000160 | 3300003659 | Bacteria | 7600 |
| 3 | JGI25404J52841_10016855 | 3300003659 | Bacteria | 1584 |
| 4 | JGI25404J52841_10019413 | 3300003659 | Bacteria | 1473 |
| 5 | Ga0070658_10004712 | 3300005327 | Bacteria | 11087 |
| 6 | Ga0070658_10116662 | 3300005327 | Bacteria | 2216 |
| 7 | Ga0070683_100436412 | 3300005329 | Unclassified | 1249 |
| 8 | Ga0070680_100001752 | 3300005336 | Bacteria | 15939 |
| 9 | Ga0070682_100103850 | 3300005337 | Bacteria | 1881 |
| 10 | Ga0070682_100144518 | 3300005337 | Unclassified | 1625 |
| 11 | Ga0070660_100015766 | 3300005339 | Bacteria | 5466 |
| 12 | Ga0070660_100044678 | 3300005339 | Bacteria | 3390 |
| 13 | Ga0070689_100026611 | 3300005340 | Bacteria | 4355 |
| 14 | Ga0070691_10040933 | 3300005341 | Bacteria | 2190 |
| 15 | Ga0070671_100159190 | 3300005355 | Bacteria | 1909 |
| 16 | Ga0070674_100184364 | 3300005356 | Unclassified | 1601 |
| 17 | Ga0070674_100328092 | 3300005356 | Bacteria | 1229 |
| 18 | Ga0070659_100260469 | 3300005366 | Bacteria | 1439 |
| 19 | Ga0070709_10026709 | 3300005434 | Bacteria | 3425 |
| 20 | Ga0070709_10089332 | 3300005434 | Bacteria | 2028 |
| 21 | Ga0070714_100023336 | 3300005435 | Bacteria | 5081 |
| 22 | Ga0070714_100212801 | 3300005435 | Bacteria | 1773 |
| 23 | Ga0070713_100004199 | 3300005436 | Bacteria | 9616 |
| 24 | Ga0070713_100015639 | 3300005436 | Bacteria | 5682 |
| 25 | Ga0070713_100069995 | 3300005436 | Bacteria | 2960 |
| 26 | Ga0070713_100121490 | 3300005436 | Bacteria | 2292 |
| 27 | Ga0070710_10080160 | 3300005437 | Bacteria | 1904 |
| 28 | Ga0070710_10129255 | 3300005437 | Bacteria | 1538 |
| 29 | Ga0070701_10146416 | 3300005438 | Unclassified | 1356 |
| 30 | Ga0070711_100020817 | 3300005439 | Bacteria | 4233 |
| 31 | Ga0070700_100143903 | 3300005441 | Bacteria | 1623 |
| 32 | Ga0070678_100018844 | 3300005456 | Bacteria | 4482 |
| 33 | Ga0070662_100073579 | 3300005457 | Bacteria | 2525 |
| 34 | Ga0070681_10002984 | 3300005458 | Bacteria | 15697 |
| 35 | Ga0070681_10012089 | 3300005458 | Bacteria | 8559 |
| 36 | Ga0070681_10017034 | 3300005458 | Bacteria | 7263 |
| 37 | Ga0070685_10092958 | 3300005466 | Unclassified | 1828 |
| 38 | Ga0070698_100059339 | 3300005471 | Bacteria | 3864 |
| 39 | Ga0070679_100012824 | 3300005530 | Bacteria | 8020 |
| 40 | Ga0070684_100308216 | 3300005535 | Unclassified | 1453 |
| 41 | Ga0070697_100289374 | 3300005536 | Bacteria | 1407 |
| 42 | Ga0068853_100031600 | 3300005539 | Bacteria | 4479 |
| 43 | Ga0070672_100320363 | 3300005543 | Unclassified | 1318 |
| 44 | Ga0070696_100013179 | 3300005546 | Bacteria | 5546 |
| 45 | Ga0068855_100007480 | 3300005563 | Bacteria | 13224 |
| 46 | Ga0068855_100028307 | 3300005563 | Bacteria | 6702 |
| 47 | Ga0068855_100054873 | 3300005563 | Bacteria | 4682 |
| 48 | Ga0068855_100101909 | 3300005563 | Bacteria | 3304 |
| 49 | Ga0068855_100180483 | 3300005563 | Bacteria | 2387 |
| 50 | Ga0070664_100038292 | 3300005564 | Bacteria | 4036 |
| 51 | Ga0068854_100056592 | 3300005578 | Bacteria | 2827 |
| 52 | Ga0068856_100208908 | 3300005614 | Bacteria | 1967 |
| 53 | Ga0068856_100466069 | 3300005614 | Bacteria | 1284 |
| 54 | Ga0070702_100051765 | 3300005615 | Unclassified | 2352 |
| 55 | Ga0068852_100044528 | 3300005616 | Bacteria | 3770 |
| 56 | Ga0068852_100436390 | 3300005616 | Bacteria | 1294 |
| 57 | Ga0068863_100515973 | 3300005841 | Unclassified | 1178 |
| 58 | Ga0068858_100041300 | 3300005842 | Bacteria | 4277 |
| 59 | Ga0081540_1003820 | 3300005983 | Bacteria | 11788 |
| 60 | Ga0081540_1005280 | 3300005983 | Bacteria | 9666 |
| 61 | Ga0081540_1052847 | 3300005983 | Bacteria | 1997 |
| 62 | Ga0081539_10000640 | 3300005985 | Bacteria | 70720 |
| 63 | Ga0070717_10027092 | 3300006028 | Bacteria | 4578 |
| 64 | Ga0075365_10020339 | 3300006038 | Bacteria | 4115 |
| 65 | Ga0075365_10026592 | 3300006038 | Bacteria | 3675 |
| 66 | Ga0070716_100206406 | 3300006173 | Bacteria | 1310 |
| 67 | Ga0070712_100164764 | 3300006175 | Bacteria | 1715 |
| 68 | Ga0070712_100204694 | 3300006175 | Bacteria | 1552 |
| 69 | Ga0075367_10168066 | 3300006178 | Unclassified | 1365 |
| 70 | Ga0075370_10083583 | 3300006353 | Unclassified | 1837 |
| 71 | Ga0068871_100200400 | 3300006358 | Bacteria | 1723 |
| 72 | Ga0075428_100096737 | 3300006844 | Bacteria | 3218 |
| 73 | Ga0075428_100167927 | 3300006844 | Bacteria | 2380 |
| 74 | Ga0075433_10056749 | 3300006852 | Plasmid | 3422 |
| 75 | Ga0075434_100194625 | 3300006871 | Bacteria | 2048 |
| 76 | Ga0068865_100142688 | 3300006881 | Unclassified | 1807 |
| 77 | Ga0105240_10001948 | 3300009093 | Bacteria | 34189 |
| 78 | Ga0105240_10040274 | 3300009093 | Bacteria | 5977 |
| 79 | Ga0105240_10081026 | 3300009093 | Bacteria | 3990 |
| 80 | Ga0105240_10457167 | 3300009093 | Bacteria | 1427 |
| 81 | Ga0111539_10011650 | 3300009094 | Bacteria | 11034 |
| 82 | Ga0105243_10059165 | 3300009148 | Plasmid | 3057 |
| 83 | Ga0105241_10000845 | 3300009174 | Bacteria | 23178 |
| 84 | Ga0105242_10116755 | 3300009176 | Unclassified | 2283 |
| 85 | Ga0105248_10301893 | 3300009177 | Unclassified | 1803 |
| 86 | Ga0105248_10346089 | 3300009177 | Bacteria | 1674 |
| 87 | Ga0105238_10074463 | 3300009551 | Bacteria | 3388 |
| 88 | Ga0105246_10024249 | 3300011119 | Bacteria | 3939 |
| 89 | Ga0105246_10179193 | 3300011119 | Bacteria | 1630 |
| 90 | Ga0157370_10188690 | 3300013104 | Bacteria | 1914 |
| 91 | Ga0157378_10144809 | 3300013297 | Bacteria | 2209 |
| 92 | Ga0163162_10263082 | 3300013306 | Bacteria | 1857 |
| 93 | Ga0163162_10343370 | 3300013306 | Unclassified | 1625 |
| 94 | Ga0157372_10027211 | 3300013307 | Bacteria | 6225 |
| 95 | Ga0157372_10034924 | 3300013307 | Bacteria | 5533 |
| 96 | Ga0157375_10146293 | 3300013308 | Unclassified | 2494 |
| 97 | Ga0157375_10242222 | 3300013308 | Bacteria | 1963 |
| 98 | Ga0163163_10094639 | 3300014325 | Bacteria | 3006 |
| 99 | Ga0163163_10289953 | 3300014325 | Bacteria | 1689 |
| 100 | Ga0157379_10005157 | 3300014968 | Bacteria | 11217 |
| 101 | Ga0157376_10150930 | 3300014969 | Unclassified | 2095 |
| 102 | Ga0157376_10360434 | 3300014969 | Bacteria | 1394 |
| 103 | Ga0163161_10093153 | 3300017792 | Unclassified | 2232 |
| 104 | Ga0213876_10001710 | 3300021384 | Bacteria | 13330 |
| 105 | Ga0213876_10053511 | 3300021384 | Bacteria | 2132 |
| 106 | Ga0209677_100454 | 3300025253 | Bacteria | 23786 |
| 107 | Ga0209233_1000216 | 3300025261 | Bacteria | 108123 |
| 108 | Ga0207705_10044848 | 3300025909 | Bacteria | 3178 |
| 109 | Ga0207705_10320622 | 3300025909 | Bacteria | 1191 |
| 110 | Ga0207684_10162250 | 3300025910 | Bacteria | 1925 |
| 111 | Ga0207684_10211013 | 3300025910 | Bacteria | 1675 |
| 112 | Ga0207707_10023373 | 3300025912 | Bacteria | 5407 |
| 113 | Ga0207707_10049220 | 3300025912 | Bacteria | 3671 |
| 114 | Ga0207707_10062033 | 3300025912 | Bacteria | 3253 |
| 115 | Ga0207695_10001012 | 3300025913 | Bacteria | 49532 |
| 116 | Ga0207695_10003472 | 3300025913 | Bacteria | 22178 |
| 117 | Ga0207695_10040040 | 3300025913 | Bacteria | 5031 |
| 118 | Ga0207695_10084549 | 3300025913 | Bacteria | 3203 |
| 119 | Ga0207695_10276026 | 3300025913 | Bacteria | 1575 |
| 120 | Ga0207693_10005719 | 3300025915 | Bacteria | 10326 |
| 121 | Ga0207693_10088420 | 3300025915 | Bacteria | 2428 |
| 122 | Ga0207663_10006785 | 3300025916 | Bacteria | 5893 |
| 123 | Ga0207660_10220831 | 3300025917 | Bacteria | 1487 |
| 124 | Ga0207660_10247128 | 3300025917 | Bacteria | 1407 |
| 125 | Ga0207657_10002616 | 3300025919 | Bacteria | 19452 |
| 126 | Ga0207657_10057367 | 3300025919 | Bacteria | 3355 |
| 127 | Ga0207652_10083238 | 3300025921 | Bacteria | 2801 |
| 128 | Ga0207700_10193907 | 3300025928 | Bacteria | 1708 |
| 129 | Ga0207690_10251074 | 3300025932 | Bacteria | 1366 |
| 130 | Ga0207706_10127166 | 3300025933 | Bacteria | 2241 |
| 131 | Ga0207665_10243636 | 3300025939 | Bacteria | 1326 |
| 132 | Ga0207661_10386732 | 3300025944 | Unclassified | 1267 |
| 133 | Ga0207667_10013656 | 3300025949 | Bacteria | 9283 |
| 134 | Ga0207667_10067055 | 3300025949 | Bacteria | 3739 |
| 135 | Ga0207667_10071957 | 3300025949 | Bacteria | 3594 |
| 136 | Ga0207667_10142944 | 3300025949 | Bacteria | 2464 |
| 137 | Ga0207667_10159555 | 3300025949 | Bacteria | 2320 |
| 138 | Ga0207640_10040135 | 3300025981 | Bacteria | 2967 |
| 139 | Ga0207703_10040635 | 3300026035 | Bacteria | 3723 |
| 140 | Ga0207703_10181646 | 3300026035 | Bacteria | 1857 |
| 141 | Ga0207641_10271428 | 3300026088 | Unclassified | 1592 |
| 142 | Ga0207683_10104731 | 3300026121 | Bacteria | 2528 |
| 143 | Ga0207428_10032685 | 3300027907 | Bacteria | 4277 |
| 144 | Ga0268265_10415265 | 3300028380 | Unclassified | 1248 |
| 145 | Ga0307511_10031184 | 3300030521 | Bacteria | 4767 |
| 146 | Ga0307511_10075941 | 3300030521 | Bacteria | 2407 |
| 147 | Ga0307510_10005631 | 3300033180 | Bacteria | 14933 |
| 148 | Ga0373934_0019523 | 3300035086 | Bacteria | 2603 |
| 149 | Ga0373953_0020936 | 3300035117 | Bacteria | 2448 |
| 150 | Ga0373946_0006895 | 3300035171 | Bacteria | 4135 |
| 151 | Ga0373946_0009420 | 3300035171 | Bacteria | 3597 |
| 152 | Ga0373935_0024571 | 3300035692 | Bacteria | 3710 |
| 153 | Ga0373935_0118891 | 3300035692 | Bacteria | 1763 |
| 154 | Ga0373935_0120651 | 3300035692 | Bacteria | 1751 |
| 155 | Ga0373927_0054782 | 3300035695 | Bacteria | 2579 |
| 156 | Ga0373927_0111775 | 3300035695 | Unclassified | 1780 |
| 157 | Ga0373927_0189031 | 3300035695 | Bacteria | 1351 |
| 158 | Ga0373933_0010864 | 3300035724 | Bacteria | 4997 |
| 159 | Ga0373947_0091145 | 3300035725 | Bacteria | 1901 |
| 160 | Ga0373937_0009868 | 3300036401 | Bacteria | 8324 |
| 161 | Ga0373937_0039000 | 3300036401 | Bacteria | 4328 |
| 162 | Ga0395899_0119793 | 3300037312 | Bacteria | 1886 |
| 163 | Ga0395900_0146354 | 3300037418 | Bacteria | 2415 |
| 164 | Ga0395898_0114215 | 3300037466 | Bacteria | 2587 |
| 165 | Ga0395905_0030469 | 3300037471 | Bacteria | 5084 |
| 166 | Ga0395905_0045721 | 3300037471 | Bacteria | 4106 |
| 167 | Ga0395905_0124310 | 3300037471 | Bacteria | 2426 |
| 168 | Ga0436364_1216893 | 3300037853 | Bacteria | 3624 |
| 169 | Ga0395901_0357525 | 3300038443 | Bacteria | 1506 |
| 170 | Ga0436365_0269340 | 3300039437 | Bacteria | 68150 |
| 171 | Ga0436365_0872987 | 3300039437 | Bacteria | 2669 |
| 172 | Ga0436365_1846395 | 3300039437 | Bacteria | 2186 |
| 173 | Ga0436360_1019583 | 3300039438 | Bacteria | 1345 |
| 174 | Ga0436361_0272484 | 3300039447 | Bacteria | 3851 |
| 175 | Ga0436363_1181037 | 3300039450 | Bacteria | 6101 |
| 176 | Ga0466964_0015330 | 3300044706 | Bacteria | 2916 |
| 177 | Ga0466967_0077108 | 3300045976 | Bacteria | 2999 |
| 178 | Ga0495629_0000942 | 3300046459 | Bacteria | 23392 |
| 179 | Ga0495641_0001683 | 3300046461 | Bacteria | 18490 |
| 180 | Ga0495651_0005812 | 3300046462 | Bacteria | 9412 |
| 181 | Ga0495651_0017555 | 3300046462 | Bacteria | 5541 |
| 182 | Ga0495653_0053038 | 3300046463 | Bacteria | 3104 |
| 183 | Ga0495653_0082213 | 3300046463 | Bacteria | 2378 |
| 184 | Ga0495653_0089283 | 3300046463 | Bacteria | 2259 |
| 185 | Ga0495653_0209254 | 3300046463 | Bacteria | 1318 |
| 186 | Ga0495582_0000972 | 3300046473 | Bacteria | 16034 |
| 187 | Ga0495639_0004217 | 3300046475 | Bacteria | 6166 |
| 188 | Ga0495662_0008235 | 3300046476 | Bacteria | 5134 |
| 189 | Ga0495664_0002083 | 3300046477 | Bacteria | 10699 |
| 190 | Ga0495664_0047918 | 3300046477 | Bacteria | 2536 |
| 191 | Ga0495664_0073015 | 3300046477 | Bacteria | 2051 |
| 192 | Ga0495594_0173857 | 3300046499 | Bacteria | 1225 |
| 193 | Ga0495596_0108172 | 3300046500 | Unclassified | 1080 |
| 194 | Ga0495608_0028233 | 3300046511 | Bacteria | 3814 |
| 195 | Ga0495608_0130842 | 3300046511 | Bacteria | 1606 |
| 196 | Ga0495628_0008049 | 3300046516 | Bacteria | 9074 |
| 197 | Ga0495631_0035951 | 3300046518 | Bacteria | 2214 |
| 198 | Ga0495652_0010324 | 3300046529 | Bacteria | 8460 |
| 199 | Ga0495652_0061569 | 3300046529 | Bacteria | 3167 |
| 200 | Ga0495665_0006774 | 3300046531 | Bacteria | 6180 |
| 201 | Ga0495640_0024849 | 3300046533 | Bacteria | 4353 |
| 202 | Ga0495640_0036930 | 3300046533 | Bacteria | 3449 |
| 203 | Ga0495640_0058358 | 3300046533 | Bacteria | 2632 |
| 204 | Ga0495587_0004022 | 3300046536 | Bacteria | 9744 |
| 205 | Ga0495587_0011083 | 3300046536 | Bacteria | 5718 |
| 206 | Ga0495645_0008459 | 3300046543 | Bacteria | 7186 |
| 207 | Ga0495645_0264553 | 3300046543 | Bacteria | 1137 |
| 208 | Ga0495667_0029319 | 3300046559 | Bacteria | 3704 |
| 209 | Ga0495667_0078712 | 3300046559 | Bacteria | 2143 |
| 210 | Ga0495634_0036556 | 3300046642 | Bacteria | 3358 |
| 211 | Ga0495634_0053186 | 3300046642 | Bacteria | 2713 |
| 212 | Ga0495634_0124893 | 3300046642 | Bacteria | 1645 |
| 213 | Ga0495635_0027521 | 3300046663 | Bacteria | 3954 |
| 214 | Ga0495635_0069985 | 3300046663 | Bacteria | 2405 |
| 215 | Ga0495635_0190970 | 3300046663 | Bacteria | 1390 |
| 216 | Ga0495588_0045290 | 3300046674 | Bacteria | 2255 |
| 217 | Ga0495657_0002485 | 3300046675 | Bacteria | 15496 |
| 218 | Ga0495623_0019926 | 3300046679 | Bacteria | 4335 |
| 219 | Ga0495646_0016265 | 3300046680 | Bacteria | 4722 |
| 220 | Ga0495646_0020514 | 3300046680 | Bacteria | 4181 |
| 221 | Ga0495647_0014402 | 3300046681 | Bacteria | 2755 |
| 222 | Ga0495658_0000532 | 3300046683 | Bacteria | 20782 |
| 223 | Ga0495658_0023354 | 3300046683 | Bacteria | 3282 |
| 224 | Ga0495613_0002000 | 3300046689 | Bacteria | 15474 |
| 225 | Ga0495613_0037499 | 3300046689 | Bacteria | 3594 |
| 226 | Ga0495613_0038247 | 3300046689 | Bacteria | 3556 |
| 227 | Ga0495624_0060370 | 3300046690 | Bacteria | 2377 |
| 228 | Ga0495589_0034025 | 3300046794 | Bacteria | 2559 |
| 229 | Ga0495600_0000403 | 3300046809 | Bacteria | 22314 |
| 230 | Ga0495581_0005201 | 3300047315 | Bacteria | 7527 |
| 231 | Ga0495581_0117303 | 3300047315 | Bacteria | 1548 |
| 232 | Ga0495604_0006190 | 3300047317 | Bacteria | 9500 |
| 233 | Ga0495604_0094109 | 3300047317 | Bacteria | 2215 |
| 234 | Ga0495674_0001752 | 3300047319 | Bacteria | 21368 |
| 235 | Ga0495674_0023498 | 3300047319 | Bacteria | 5680 |
| 236 | Ga0495674_0097850 | 3300047319 | Bacteria | 2499 |
| 237 | Ga0495674_0128592 | 3300047319 | Bacteria | 2135 |
| 238 | Ga0495676_0070431 | 3300047321 | Bacteria | 2693 |
| 239 | Ga0495680_0002464 | 3300047322 | Bacteria | 18944 |
| 240 | Ga0495680_0016360 | 3300047322 | Bacteria | 6376 |
| 241 | Ga0495680_0042755 | 3300047322 | Bacteria | 3593 |
| 242 | Ga0495680_0056132 | 3300047322 | Bacteria | 3050 |
| 243 | Ga0495675_0004828 | 3300047444 | Bacteria | 8198 |
| 244 | Ga0495675_0026176 | 3300047444 | Bacteria | 3718 |
| 245 | Ga0495684_0004597 | 3300047471 | Bacteria | 10782 |
| 246 | Ga0495684_0031910 | 3300047471 | Bacteria | 4045 |
| 247 | Ga0495684_0038146 | 3300047471 | Bacteria | 3684 |
| 248 | Ga0495684_0235290 | 3300047471 | Bacteria | 1338 |
| 249 | Ga0495593_0016263 | 3300047673 | Bacteria | 4199 |
| 250 | Ga0495602_0005594 | 3300048088 | Bacteria | 13194 |
| 251 | Ga0496101_0305497 | 3300048904 | Bacteria | 1247 |
| 252 | Ga0496101_0475893 | 3300048904 | Unclassified | 986 |
| 253 | Ga0496104_0285146 | 3300048907 | Bacteria | 1564 |
| 254 | Ga0496105_0137305 | 3300048908 | Bacteria | 2014 |
| 255 | Ga0496107_0041198 | 3300048910 | Bacteria | 3316 |
| 256 | Ga0496108_0019431 | 3300048911 | Bacteria | 5579 |
| 257 | Ga0496108_0110397 | 3300048911 | Bacteria | 2351 |
| 258 | Ga0496108_0408451 | 3300048911 | Unclassified | 1186 |
| 259 | Ga0496109_0009979 | 3300048912 | Bacteria | 8108 |
| 260 | Ga0496110_0439829 | 3300048913 | Bacteria | 1188 |
| 261 | Ga0496111_0078828 | 3300048914 | Bacteria | 2402 |
| 262 | Ga0496114_0300881 | 3300048917 | Bacteria | 1416 |
| 263 | Ga0496114_0332972 | 3300048917 | Unclassified | 1342 |
| 264 | Ga0496121_0033935 | 3300048924 | Bacteria | 4605 |
| 265 | Ga0501041_0141168 | 3300049577 | Unclassified | 1502 |
| 266 | Ga0501079_0108504 | 3300049741 | Bacteria | 2155 |
| 267 | Ga0501083_0052765 | 3300049744 | Bacteria | 2731 |
| 268 | nmdc:mga0yw44_20434_c1 | 3300050492 | Bacteria | 3675 |
| 269 | nmdc:mga0yw44_3879_c1 | 3300050492 | Bacteria | 6737 |
| 270 | nmdc:mga08y16_88976_c1 | 3300050511 | Bacteria | 3218 |
| 271 | nmdc:mga0a205_151275_c1 | 3300050515 | Bacteria | 2220 |
| 272 | Ga0495601_0002565 | 3300053077 | Bacteria | 10327 |
| 273 | Ga0495601_0019234 | 3300053077 | Bacteria | 4164 |
| 274 | Ga0495601_0028303 | 3300053077 | Bacteria | 3471 |
| 275 | Ga0495612_0013471 | 3300053078 | Bacteria | 3294 |
| 276 | Ga0495612_0017111 | 3300053078 | Bacteria | 2904 |
| 277 | Ga0495595_0119448 | 3300053084 | Bacteria | 1283 |
| 278 | Ga0495619_0011343 | 3300053085 | Bacteria | 5611 |
| 279 | Ga0495619_0017314 | 3300053085 | Bacteria | 4564 |
| 280 | Ga0495619_0020607 | 3300053085 | Bacteria | 4202 |
| 281 | Ga0495619_0036463 | 3300053085 | Bacteria | 3203 |
| 282 | Ga0500651_0100405 | 3300053093 | Bacteria | 1774 |
| 283 | Ga0500595_012917 | 3300053119 | Bacteria | 3213 |
| 284 | Ga0501082_0038166 | 3300060353 | Bacteria | 4144 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10012089 | Ga0070681_1001208910 | 278 |
| 2 | 3300025912 | Ga0207707_10062033 | Ga0207707_100620332 | 278 |
| 3 | iso_pu_bacteria | 2885409591 | 2885414120 | 280 |
| 4 | iso_pu_bacteria | 8016613128 | 8016621746 | 280 |
| 5 | 3300048904 | Ga0496101_0305497 | Ga0496101_0305497_17_943 | 284 |
| 6 | 3300048904 | Ga0496101_0475893 | Ga0496101_0475893_22_891 | 286 |
| 7 | 3300005435 | Ga0070714_100212801 | Ga0070714_1002128012 | 291 |
| 8 | 3300048914 | Ga0496111_0078828 | Ga0496111_0078828_49_1020 | 299 |
| 9 | 3300005436 | Ga0070713_100121490 | Ga0070713_1001214904 | 305 |
| 10 | 3300025928 | Ga0207700_10193907 | Ga0207700_101939072 | 305 |
| 11 | 3300046461 | Ga0495641_0001683 | Ga0495641_0001683_2012_2977 | 307 |
| 12 | 3300046463 | Ga0495653_0082213 | Ga0495653_0082213_639_1604 | 307 |
| 13 | 3300046476 | Ga0495662_0008235 | Ga0495662_0008235_700_1665 | 307 |
| 14 | 3300046500 | Ga0495596_0108172 | Ga0495596_0108172_20_952 | 307 |
| 15 | 3300046511 | Ga0495608_0130842 | Ga0495608_0130842_23_988 | 307 |
| 16 | 3300046663 | Ga0495635_0027521 | Ga0495635_0027521_891_1856 | 307 |
| 17 | 3300046683 | Ga0495658_0000532 | Ga0495658_0000532_11831_12796 | 307 |
| 18 | 3300047315 | Ga0495581_0005201 | Ga0495581_0005201_3329_4294 | 307 |
| 19 | 3300048911 | Ga0496108_0408451 | Ga0496108_0408451_212_1144 | 307 |
| 20 | 3300045976 | Ga0466967_0077108 | Ga0466967_0077108_1084_2142 | 314 |
| 21 | 3300046462 | Ga0495651_0005812 | Ga0495651_0005812_2071_3150 | 318 |
| 22 | 3300046463 | Ga0495653_0209254 | Ga0495653_0209254_92_1171 | 318 |
| 23 | 3300046477 | Ga0495664_0047918 | Ga0495664_0047918_24_1103 | 318 |
| 24 | 3300046529 | Ga0495652_0061569 | Ga0495652_0061569_202_1281 | 318 |
| 25 | 3300046533 | Ga0495640_0024849 | Ga0495640_0024849_1368_2447 | 318 |
| 26 | 3300046536 | Ga0495587_0004022 | Ga0495587_0004022_4434_5513 | 318 |
| 27 | 3300046543 | Ga0495645_0264553 | Ga0495645_0264553_16_1095 | 318 |
| 28 | 3300046642 | Ga0495634_0124893 | Ga0495634_0124893_494_1573 | 318 |
| 29 | 3300046663 | Ga0495635_0069985 | Ga0495635_0069985_410_1489 | 318 |
| 30 | 3300046675 | Ga0495657_0002485 | Ga0495657_0002485_12220_13299 | 318 |
| 31 | 3300046679 | Ga0495623_0019926 | Ga0495623_0019926_1317_2396 | 318 |
| 32 | 3300046680 | Ga0495646_0016265 | Ga0495646_0016265_1864_2943 | 318 |
| 33 | 3300046809 | Ga0495600_0000403 | Ga0495600_0000403_18929_20008 | 318 |
| 34 | 3300047317 | Ga0495604_0006190 | Ga0495604_0006190_6508_7587 | 318 |
| 35 | 3300047319 | Ga0495674_0023498 | Ga0495674_0023498_2554_3633 | 318 |
| 36 | 3300047322 | Ga0495680_0002464 | Ga0495680_0002464_7821_8900 | 318 |
| 37 | 3300047444 | Ga0495675_0026176 | Ga0495675_0026176_468_1547 | 318 |
| 38 | 3300053078 | Ga0495612_0017111 | Ga0495612_0017111_365_1378 | 318 |
| 39 | 3300021384 | Ga0213876_10001710 | Ga0213876_100017102 | 324 |
| 40 | 3300039437 | Ga0436365_0269340 | Ga0436365_0269340_12042_13055 | 324 |
| 41 | 3300005841 | Ga0068863_100515973 | Ga0068863_1005159731 | 325 |
| 42 | 3300009148 | Ga0105243_10059165 | Ga0105243_100591651 | 325 |
| 43 | 3300009176 | Ga0105242_10116755 | Ga0105242_101167552 | 325 |
| 44 | 3300009177 | Ga0105248_10301893 | Ga0105248_103018932 | 325 |
| 45 | 3300011119 | Ga0105246_10024249 | Ga0105246_100242495 | 325 |
| 46 | 3300013306 | Ga0163162_10343370 | Ga0163162_103433701 | 325 |
| 47 | 3300013308 | Ga0157375_10146293 | Ga0157375_101462932 | 325 |
| 48 | 3300014325 | Ga0163163_10094639 | Ga0163163_100946397 | 325 |
| 49 | 3300017792 | Ga0163161_10093153 | Ga0163161_100931533 | 325 |
| 50 | 3300025944 | Ga0207661_10386732 | Ga0207661_103867321 | 325 |
| 51 | 3300028380 | Ga0268265_10415265 | Ga0268265_104152651 | 325 |
| 52 | 3300048917 | Ga0496114_0332972 | Ga0496114_0332972_43_1035 | 325 |
| 53 | 3300009093 | Ga0105240_10457167 | Ga0105240_104571672 | 326 |
| 54 | 3300005456 | Ga0070678_100018844 | Ga0070678_1000188445 | 331 |
| 55 | 3300026121 | Ga0207683_10104731 | Ga0207683_101047312 | 331 |
| 56 | 3300005434 | Ga0070709_10089332 | Ga0070709_100893322 | 332 |
| 57 | 3300005436 | Ga0070713_100069995 | Ga0070713_1000699951 | 332 |
| 58 | 3300030521 | Ga0307511_10075941 | Ga0307511_100759412 | 332 |
| 59 | 3300049577 | Ga0501041_0141168 | Ga0501041_0141168_425_1477 | 332 |
| 60 | 3300049741 | Ga0501079_0108504 | Ga0501079_0108504_22_1074 | 332 |
| 61 | 3300053119 | Ga0500595_012917 | Ga0500595_012917_579_1655 | 332 |
| 62 | 3300060353 | Ga0501082_0038166 | Ga0501082_0038166_1160_2212 | 332 |
| 63 | 3300005329 | Ga0070683_100436412 | Ga0070683_1004364121 | 333 |
| 64 | 3300005337 | Ga0070682_100144518 | Ga0070682_1001445182 | 333 |
| 65 | 3300005339 | Ga0070660_100015766 | Ga0070660_10001576610 | 333 |
| 66 | 3300005356 | Ga0070674_100184364 | Ga0070674_1001843641 | 333 |
| 67 | 3300005366 | Ga0070659_100260469 | Ga0070659_1002604692 | 333 |
| 68 | 3300005438 | Ga0070701_10146416 | Ga0070701_101464162 | 333 |
| 69 | 3300005458 | Ga0070681_10017034 | Ga0070681_100170349 | 333 |
| 70 | 3300005466 | Ga0070685_10092958 | Ga0070685_100929581 | 333 |
| 71 | 3300005535 | Ga0070684_100308216 | Ga0070684_1003082162 | 333 |
| 72 | 3300005539 | Ga0068853_100031600 | Ga0068853_1000316002 | 333 |
| 73 | 3300005543 | Ga0070672_100320363 | Ga0070672_1003203631 | 333 |
| 74 | 3300005546 | Ga0070696_100013179 | Ga0070696_10001317910 | 333 |
| 75 | 3300005563 | Ga0068855_100028307 | Ga0068855_1000283077 | 333 |
| 76 | 3300005615 | Ga0070702_100051765 | Ga0070702_1000517653 | 333 |
| 77 | 3300006881 | Ga0068865_100142688 | Ga0068865_1001426882 | 333 |
| 78 | 3300009093 | Ga0105240_10001948 | Ga0105240_1000194823 | 333 |
| 79 | 3300013307 | Ga0157372_10034924 | Ga0157372_100349243 | 333 |
| 80 | 3300014969 | Ga0157376_10150930 | Ga0157376_101509303 | 333 |
| 81 | 3300025912 | Ga0207707_10023373 | Ga0207707_100233737 | 333 |
| 82 | 3300025913 | Ga0207695_10001012 | Ga0207695_1000101248 | 333 |
| 83 | 3300025919 | Ga0207657_10002616 | Ga0207657_1000261615 | 333 |
| 84 | 3300025932 | Ga0207690_10251074 | Ga0207690_102510742 | 333 |
| 85 | 3300025949 | Ga0207667_10013656 | Ga0207667_100136566 | 333 |
| 86 | 3300026088 | Ga0207641_10271428 | Ga0207641_102714281 | 333 |
| 87 | 3300035171 | Ga0373946_0009420 | Ga0373946_0009420_2087_3136 | 333 |
| 88 | 3300035695 | Ga0373927_0189031 | Ga0373927_0189031_87_1136 | 333 |
| 89 | 3300037471 | Ga0395905_0124310 | Ga0395905_0124310_177_1223 | 333 |
| 90 | 3300046459 | Ga0495629_0000942 | Ga0495629_0000942_1690_2739 | 333 |
| 91 | 3300046462 | Ga0495651_0017555 | Ga0495651_0017555_2008_3048 | 333 |
| 92 | 3300046463 | Ga0495653_0053038 | Ga0495653_0053038_1854_2894 | 333 |
| 93 | 3300046473 | Ga0495582_0000972 | Ga0495582_0000972_3239_4288 | 333 |
| 94 | 3300046475 | Ga0495639_0004217 | Ga0495639_0004217_3485_4534 | 333 |
| 95 | 3300046499 | Ga0495594_0173857 | Ga0495594_0173857_15_1064 | 333 |
| 96 | 3300046511 | Ga0495608_0028233 | Ga0495608_0028233_1509_2549 | 333 |
| 97 | 3300046531 | Ga0495665_0006774 | Ga0495665_0006774_2407_3456 | 333 |
| 98 | 3300046533 | Ga0495640_0058358 | Ga0495640_0058358_704_1753 | 333 |
| 99 | 3300046559 | Ga0495667_0029319 | Ga0495667_0029319_1959_3008 | 333 |
| 100 | 3300046642 | Ga0495634_0036556 | Ga0495634_0036556_1616_2665 | 333 |
| 101 | 3300046689 | Ga0495613_0002000 | Ga0495613_0002000_4852_5901 | 333 |
| 102 | 3300046689 | Ga0495613_0038247 | Ga0495613_0038247_2435_3475 | 333 |
| 103 | 3300047319 | Ga0495674_0001752 | Ga0495674_0001752_2718_3758 | 333 |
| 104 | 3300047319 | Ga0495674_0097850 | Ga0495674_0097850_921_1970 | 333 |
| 105 | 3300047321 | Ga0495676_0070431 | Ga0495676_0070431_602_1651 | 333 |
| 106 | 3300047322 | Ga0495680_0016360 | Ga0495680_0016360_951_1991 | 333 |
| 107 | 3300047322 | Ga0495680_0056132 | Ga0495680_0056132_504_1553 | 333 |
| 108 | 3300047471 | Ga0495684_0038146 | Ga0495684_0038146_2227_3276 | 333 |
| 109 | 3300047673 | Ga0495593_0016263 | Ga0495593_0016263_714_1763 | 333 |
| 110 | 3300049744 | Ga0501083_0052765 | Ga0501083_0052765_1581_2633 | 333 |
| 111 | 3300053085 | Ga0495619_0020607 | Ga0495619_0020607_1935_2984 | 333 |
| 112 | iso_pu_bacteria | 2513237084 | 2513573494 | 333 |
| 113 | iso_pu_bacteria | 2513237093 | 2513636569 | 333 |
| 114 | iso_pu_bacteria | 2724679232 | 2725950980 | 333 |
| 115 | 3300005327 | Ga0070658_10116662 | Ga0070658_101166622 | 334 |
| 116 | 3300005563 | Ga0068855_100054873 | Ga0068855_1000548733 | 334 |
| 117 | 3300005563 | Ga0068855_100101909 | Ga0068855_1001019093 | 334 |
| 118 | 3300005563 | Ga0068855_100180483 | Ga0068855_1001804832 | 334 |
| 119 | 3300005616 | Ga0068852_100044528 | Ga0068852_1000445282 | 334 |
| 120 | 3300005616 | Ga0068852_100436390 | Ga0068852_1004363901 | 334 |
| 121 | 3300009093 | Ga0105240_10040274 | Ga0105240_100402742 | 334 |
| 122 | 3300009551 | Ga0105238_10074463 | Ga0105238_100744633 | 334 |
| 123 | 3300013104 | Ga0157370_10188690 | Ga0157370_101886902 | 334 |
| 124 | 3300013307 | Ga0157372_10027211 | Ga0157372_100272117 | 334 |
| 125 | 3300021384 | Ga0213876_10053511 | Ga0213876_100535111 | 334 |
| 126 | 3300025909 | Ga0207705_10320622 | Ga0207705_103206221 | 334 |
| 127 | 3300025913 | Ga0207695_10003472 | Ga0207695_100034725 | 334 |
| 128 | 3300025913 | Ga0207695_10276026 | Ga0207695_102760261 | 334 |
| 129 | 3300025917 | Ga0207660_10220831 | Ga0207660_102208311 | 334 |
| 130 | 3300025949 | Ga0207667_10071957 | Ga0207667_100719572 | 334 |
| 131 | 3300025949 | Ga0207667_10142944 | Ga0207667_101429443 | 334 |
| 132 | 3300025949 | Ga0207667_10159555 | Ga0207667_101595552 | 334 |
| 133 | 3300037312 | Ga0395899_0119793 | Ga0395899_0119793_411_1493 | 334 |
| 134 | 3300037418 | Ga0395900_0146354 | Ga0395900_0146354_453_1535 | 334 |
| 135 | 3300037466 | Ga0395898_0114215 | Ga0395898_0114215_1386_2468 | 334 |
| 136 | 3300037471 | Ga0395905_0030469 | Ga0395905_0030469_1332_2390 | 334 |
| 137 | 3300037471 | Ga0395905_0045721 | Ga0395905_0045721_2222_3244 | 334 |
| 138 | 3300038443 | Ga0395901_0357525 | Ga0395901_0357525_120_1202 | 334 |
| 139 | 3300039437 | Ga0436365_1846395 | Ga0436365_1846395_1009_2088 | 334 |
| 140 | 3300048917 | Ga0496114_0300881 | Ga0496114_0300881_208_1305 | 335 |
| 141 | iso_pu_bacteria | 8016603502 | 8016612063 | 335 |
| 142 | 3300005327 | Ga0070658_10004712 | Ga0070658_100047127 | 336 |
| 143 | 3300005336 | Ga0070680_100001752 | Ga0070680_10000175212 | 336 |
| 144 | 3300005339 | Ga0070660_100044678 | Ga0070660_1000446783 | 336 |
| 145 | 3300005341 | Ga0070691_10040933 | Ga0070691_100409333 | 336 |
| 146 | 3300005458 | Ga0070681_10002984 | Ga0070681_1000298412 | 336 |
| 147 | 3300005530 | Ga0070679_100012824 | Ga0070679_1000128245 | 336 |
| 148 | 3300005563 | Ga0068855_100007480 | Ga0068855_10000748010 | 336 |
| 149 | 3300005842 | Ga0068858_100041300 | Ga0068858_1000413002 | 336 |
| 150 | 3300009093 | Ga0105240_10081026 | Ga0105240_100810263 | 336 |
| 151 | 3300014968 | Ga0157379_10005157 | Ga0157379_100051573 | 336 |
| 152 | 3300025909 | Ga0207705_10044848 | Ga0207705_100448482 | 336 |
| 153 | 3300025912 | Ga0207707_10049220 | Ga0207707_100492204 | 336 |
| 154 | 3300025913 | Ga0207695_10040040 | Ga0207695_100400405 | 336 |
| 155 | 3300025917 | Ga0207660_10247128 | Ga0207660_102471282 | 336 |
| 156 | 3300025919 | Ga0207657_10057367 | Ga0207657_100573673 | 336 |
| 157 | 3300025921 | Ga0207652_10083238 | Ga0207652_100832383 | 336 |
| 158 | 3300025949 | Ga0207667_10067055 | Ga0207667_100670552 | 336 |
| 159 | 3300026035 | Ga0207703_10040635 | Ga0207703_100406352 | 336 |
| 160 | 3300026035 | Ga0207703_10181646 | Ga0207703_101816462 | 336 |
| 161 | 3300035692 | Ga0373935_0118891 | Ga0373935_0118891_79_1146 | 336 |
| 162 | 3300046518 | Ga0495631_0035951 | Ga0495631_0035951_109_1161 | 336 |
| 163 | 3300047471 | Ga0495684_0235290 | Ga0495684_0235290_61_1128 | 336 |
| 164 | 3300006038 | Ga0075365_10026592 | Ga0075365_100265922 | 337 |
| 165 | 3300006358 | Ga0068871_100200400 | Ga0068871_1002004002 | 337 |
| 166 | 3300006852 | Ga0075433_10056749 | Ga0075433_100567492 | 337 |
| 167 | 3300006871 | Ga0075434_100194625 | Ga0075434_1001946252 | 337 |
| 168 | 3300009177 | Ga0105248_10346089 | Ga0105248_103460891 | 337 |
| 169 | 3300013306 | Ga0163162_10263082 | Ga0163162_102630822 | 337 |
| 170 | 3300014969 | Ga0157376_10360434 | Ga0157376_103604342 | 337 |
| 171 | 3300025253 | Ga0209677_100454 | Ga0209677_10045415 | 337 |
| 172 | 3300025261 | Ga0209233_1000216 | Ga0209233_100021692 | 337 |
| 173 | 3300037853 | Ga0436364_1216893 | Ga0436364_1216893_2258_3310 | 337 |
| 174 | 3300039437 | Ga0436365_0872987 | Ga0436365_0872987_240_1292 | 337 |
| 175 | 3300039438 | Ga0436360_1019583 | Ga0436360_1019583_39_1091 | 337 |
| 176 | 3300039450 | Ga0436363_1181037 | Ga0436363_1181037_2383_3435 | 337 |
| 177 | 3300050492 | nmdc:mga0yw44_20434_c1 | nmdc:mga0yw44_20434_c1_2389_3480 | 337 |
| 178 | 3300005434 | Ga0070709_10026709 | Ga0070709_100267093 | 338 |
| 179 | 3300005435 | Ga0070714_100023336 | Ga0070714_1000233363 | 338 |
| 180 | 3300005436 | Ga0070713_100004199 | Ga0070713_1000041995 | 338 |
| 181 | 3300005437 | Ga0070710_10080160 | Ga0070710_100801602 | 338 |
| 182 | 3300005439 | Ga0070711_100020817 | Ga0070711_1000208172 | 338 |
| 183 | 3300005457 | Ga0070662_100073579 | Ga0070662_1000735792 | 338 |
| 184 | 3300005471 | Ga0070698_100059339 | Ga0070698_1000593393 | 338 |
| 185 | 3300005564 | Ga0070664_100038292 | Ga0070664_1000382925 | 338 |
| 186 | 3300005578 | Ga0068854_100056592 | Ga0068854_1000565922 | 338 |
| 187 | 3300005614 | Ga0068856_100208908 | Ga0068856_1002089082 | 338 |
| 188 | 3300005614 | Ga0068856_100466069 | Ga0068856_1004660692 | 338 |
| 189 | 3300006028 | Ga0070717_10027092 | Ga0070717_100270923 | 338 |
| 190 | 3300006173 | Ga0070716_100206406 | Ga0070716_1002064062 | 338 |
| 191 | 3300006175 | Ga0070712_100164764 | Ga0070712_1001647642 | 338 |
| 192 | 3300011119 | Ga0105246_10179193 | Ga0105246_101791932 | 338 |
| 193 | 3300014325 | Ga0163163_10289953 | Ga0163163_102899532 | 338 |
| 194 | 3300025913 | Ga0207695_10084549 | Ga0207695_100845492 | 338 |
| 195 | 3300025915 | Ga0207693_10005719 | Ga0207693_100057192 | 338 |
| 196 | 3300025916 | Ga0207663_10006785 | Ga0207663_100067854 | 338 |
| 197 | 3300025933 | Ga0207706_10127166 | Ga0207706_101271662 | 338 |
| 198 | 3300025939 | Ga0207665_10243636 | Ga0207665_102436362 | 338 |
| 199 | 3300025981 | Ga0207640_10040135 | Ga0207640_100401352 | 338 |
| 200 | 3300030521 | Ga0307511_10031184 | Ga0307511_100311843 | 338 |
| 201 | 3300035086 | Ga0373934_0019523 | Ga0373934_0019523_881_1948 | 338 |
| 202 | 3300035117 | Ga0373953_0020936 | Ga0373953_0020936_640_1707 | 338 |
| 203 | 3300035692 | Ga0373935_0024571 | Ga0373935_0024571_2476_3543 | 338 |
| 204 | 3300035724 | Ga0373933_0010864 | Ga0373933_0010864_2584_3651 | 338 |
| 205 | 3300036401 | Ga0373937_0009868 | Ga0373937_0009868_2305_3357 | 338 |
| 206 | 3300036401 | Ga0373937_0039000 | Ga0373937_0039000_2308_3375 | 338 |
| 207 | 3300046463 | Ga0495653_0089283 | Ga0495653_0089283_626_1693 | 338 |
| 208 | 3300046477 | Ga0495664_0002083 | Ga0495664_0002083_2802_3869 | 338 |
| 209 | 3300046516 | Ga0495628_0008049 | Ga0495628_0008049_1765_2832 | 338 |
| 210 | 3300046529 | Ga0495652_0010324 | Ga0495652_0010324_3833_4900 | 338 |
| 211 | 3300046536 | Ga0495587_0011083 | Ga0495587_0011083_3464_4531 | 338 |
| 212 | 3300046543 | Ga0495645_0008459 | Ga0495645_0008459_2404_3471 | 338 |
| 213 | 3300046559 | Ga0495667_0078712 | Ga0495667_0078712_803_1870 | 338 |
| 214 | 3300046680 | Ga0495646_0020514 | Ga0495646_0020514_557_1624 | 338 |
| 215 | 3300047317 | Ga0495604_0094109 | Ga0495604_0094109_772_1839 | 338 |
| 216 | 3300047322 | Ga0495680_0042755 | Ga0495680_0042755_1263_2330 | 338 |
| 217 | 3300047444 | Ga0495675_0004828 | Ga0495675_0004828_4106_5173 | 338 |
| 218 | 3300047471 | Ga0495684_0031910 | Ga0495684_0031910_44_1111 | 338 |
| 219 | 3300048088 | Ga0495602_0005594 | Ga0495602_0005594_9546_10613 | 338 |
| 220 | 3300053077 | Ga0495601_0002565 | Ga0495601_0002565_7725_8792 | 338 |
| 221 | 3300053078 | Ga0495612_0013471 | Ga0495612_0013471_1194_2261 | 338 |
| 222 | 3300053084 | Ga0495595_0119448 | Ga0495595_0119448_117_1184 | 338 |
| 223 | 3300053085 | Ga0495619_0017314 | Ga0495619_0017314_2096_3163 | 338 |
| 224 | iso_pu_bacteria | 2508501128 | 2509148633 | 338 |
| 225 | iso_pu_bacteria | 3005594810 | 3005595665 | 338 |
| 226 | 3300005337 | Ga0070682_100103850 | Ga0070682_1001038501 | 339 |
| 227 | 3300005356 | Ga0070674_100328092 | Ga0070674_1003280921 | 339 |
| 228 | 3300005436 | Ga0070713_100015639 | Ga0070713_1000156392 | 339 |
| 229 | 3300005437 | Ga0070710_10129255 | Ga0070710_101292551 | 339 |
| 230 | 3300005441 | Ga0070700_100143903 | Ga0070700_1001439032 | 339 |
| 231 | 3300006844 | Ga0075428_100096737 | Ga0075428_1000967373 | 339 |
| 232 | 3300013297 | Ga0157378_10144809 | Ga0157378_101448093 | 339 |
| 233 | 3300013308 | Ga0157375_10242222 | Ga0157375_102422222 | 339 |
| 234 | 3300025915 | Ga0207693_10088420 | Ga0207693_100884203 | 339 |
| 235 | 3300027907 | Ga0207428_10032685 | Ga0207428_100326852 | 339 |
| 236 | 3300033180 | Ga0307510_10005631 | Ga0307510_1000563113 | 339 |
| 237 | 3300048911 | Ga0496108_0110397 | Ga0496108_0110397_1182_2273 | 339 |
| 238 | 3300050515 | nmdc:mga0a205_151275_c1 | nmdc:mga0a205_151275_c1_290_1381 | 339 |
| 239 | iso_pu_bacteria | 2513237095 | 2513652315 | 339 |
| 240 | 3300005536 | Ga0070697_100289374 | Ga0070697_1002893742 | 340 |
| 241 | 3300006038 | Ga0075365_10020339 | Ga0075365_100203393 | 340 |
| 242 | 3300006178 | Ga0075367_10168066 | Ga0075367_101680662 | 340 |
| 243 | 3300006353 | Ga0075370_10083583 | Ga0075370_100835832 | 340 |
| 244 | 3300025910 | Ga0207684_10162250 | Ga0207684_101622501 | 340 |
| 245 | 3300025910 | Ga0207684_10211013 | Ga0207684_102110131 | 340 |
| 246 | 3300035171 | Ga0373946_0006895 | Ga0373946_0006895_2983_4071 | 340 |
| 247 | 3300035692 | Ga0373935_0120651 | Ga0373935_0120651_324_1412 | 340 |
| 248 | 3300035695 | Ga0373927_0054782 | Ga0373927_0054782_183_1271 | 340 |
| 249 | 3300035695 | Ga0373927_0111775 | Ga0373927_0111775_351_1439 | 340 |
| 250 | 3300035725 | Ga0373947_0091145 | Ga0373947_0091145_396_1484 | 340 |
| 251 | 3300039447 | Ga0436361_0272484 | Ga0436361_0272484_1468_2547 | 340 |
| 252 | 3300046674 | Ga0495588_0045290 | Ga0495588_0045290_123_1211 | 340 |
| 253 | 3300046681 | Ga0495647_0014402 | Ga0495647_0014402_1150_2238 | 340 |
| 254 | 3300046683 | Ga0495658_0023354 | Ga0495658_0023354_1376_2464 | 340 |
| 255 | 3300046689 | Ga0495613_0037499 | Ga0495613_0037499_676_1764 | 340 |
| 256 | 3300046690 | Ga0495624_0060370 | Ga0495624_0060370_41_1129 | 340 |
| 257 | 3300046794 | Ga0495589_0034025 | Ga0495589_0034025_14_1102 | 340 |
| 258 | 3300047315 | Ga0495581_0117303 | Ga0495581_0117303_123_1211 | 340 |
| 259 | 3300050492 | nmdc:mga0yw44_3879_c1 | nmdc:mga0yw44_3879_c1_4830_5927 | 340 |
| 260 | 3300053077 | Ga0495601_0028303 | Ga0495601_0028303_1594_2691 | 340 |
| 261 | 3300053085 | Ga0495619_0011343 | Ga0495619_0011343_3217_4314 | 340 |
| 262 | iso_pu_bacteria | 2528768022 | 2528853761 | 340 |
| 263 | iso_pu_bacteria | 2824671348 | 2824672539 | 340 |
| 264 | iso_pu_bacteria | 2824687955 | 2824689128 | 340 |
| 265 | iso_pu_bacteria | 2824704595 | 2824705393 | 340 |
| 266 | iso_pu_bacteria | 2824753945 | 2824755465 | 340 |
| 267 | iso_pu_bacteria | 2824753945 | 2824755843 | 340 |
| 268 | iso_pu_bacteria | 2824763712 | 2824763749 | 340 |
| 269 | iso_pu_bacteria | 2824763712 | 2824764896 | 340 |
| 270 | iso_pu_bacteria | 2841983080 | 2841991138 | 340 |
| 271 | iso_pu_bacteria | 2904711408 | 2904715895 | 340 |
| 272 | iso_pu_bacteria | 2904711408 | 2904716577 | 340 |
| 273 | iso_pu_bacteria | 3005587118 | 3005589171 | 340 |
| 274 | iso_pu_bacteria | 3005718088 | 3005720353 | 340 |
| 275 | iso_pu_bacteria | 8006926726 | 8006929070 | 340 |
| 276 | iso_pu_bacteria | 8019538911 | 8019543557 | 340 |
| 277 | 3300003659 | JGI25404J52841_10000160 | JGI25404J52841_100001604 | 341 |
| 278 | 3300005983 | Ga0081540_1005280 | Ga0081540_10052805 | 341 |
| 279 | 3300006844 | Ga0075428_100167927 | Ga0075428_1001679272 | 341 |
| 280 | 3300009094 | Ga0111539_10011650 | Ga0111539_100116502 | 341 |
| 281 | 3300009174 | Ga0105241_10000845 | Ga0105241_100008457 | 341 |
| 282 | 3300044706 | Ga0466964_0015330 | Ga0466964_0015330_635_1669 | 341 |
| 283 | 3300048924 | Ga0496121_0033935 | Ga0496121_0033935_1268_2302 | 341 |
| 284 | 3300050511 | nmdc:mga08y16_88976_c1 | nmdc:mga08y16_88976_c1_191_1270 | 341 |
| 285 | iso_pu_bacteria | 2838122688 | 2838130754 | 341 |
| 286 | iso_pu_bacteria | 2935769743 | 2935771640 | 341 |
| 287 | iso_pu_bacteria | 2935777560 | 2935779420 | 341 |
| 288 | iso_pu_bacteria | 2935785616 | 2935791008 | 341 |
| 289 | iso_pu_bacteria | 2935793552 | 2935800092 | 341 |
| 290 | iso_pu_bacteria | 8016622563 | 8016628100 | 341 |
| 291 | iso_pu_bacteria | 8019547302 | 8019555214 | 341 |
| 292 | 3300003203 | JGI25406J46586_10024743 | JGI25406J46586_100247432 | 342 |
| 293 | 3300003659 | JGI25404J52841_10016855 | JGI25404J52841_100168553 | 342 |
| 294 | 3300003659 | JGI25404J52841_10019413 | JGI25404J52841_100194131 | 342 |
| 295 | 3300005340 | Ga0070689_100026611 | Ga0070689_1000266114 | 342 |
| 296 | 3300005355 | Ga0070671_100159190 | Ga0070671_1001591902 | 342 |
| 297 | 3300005983 | Ga0081540_1003820 | Ga0081540_100382012 | 342 |
| 298 | 3300005983 | Ga0081540_1052847 | Ga0081540_10528473 | 342 |
| 299 | 3300005985 | Ga0081539_10000640 | Ga0081539_1000064099 | 342 |
| 300 | 3300006175 | Ga0070712_100204694 | Ga0070712_1002046941 | 342 |
| 301 | 3300046477 | Ga0495664_0073015 | Ga0495664_0073015_870_1925 | 342 |
| 302 | 3300046533 | Ga0495640_0036930 | Ga0495640_0036930_1372_2427 | 342 |
| 303 | 3300046642 | Ga0495634_0053186 | Ga0495634_0053186_1520_2575 | 342 |
| 304 | 3300046663 | Ga0495635_0190970 | Ga0495635_0190970_314_1369 | 342 |
| 305 | 3300047319 | Ga0495674_0128592 | Ga0495674_0128592_281_1336 | 342 |
| 306 | 3300047471 | Ga0495684_0004597 | Ga0495684_0004597_8293_9348 | 342 |
| 307 | 3300048907 | Ga0496104_0285146 | Ga0496104_0285146_150_1187 | 342 |
| 308 | 3300048908 | Ga0496105_0137305 | Ga0496105_0137305_609_1646 | 342 |
| 309 | 3300048910 | Ga0496107_0041198 | Ga0496107_0041198_282_1319 | 342 |
| 310 | 3300048911 | Ga0496108_0019431 | Ga0496108_0019431_3138_4175 | 342 |
| 311 | 3300048912 | Ga0496109_0009979 | Ga0496109_0009979_617_1654 | 342 |
| 312 | 3300048913 | Ga0496110_0439829 | Ga0496110_0439829_63_1100 | 342 |
| 313 | 3300053077 | Ga0495601_0019234 | Ga0495601_0019234_1398_2453 | 342 |
| 314 | 3300053085 | Ga0495619_0036463 | Ga0495619_0036463_1069_2124 | 342 |
| 315 | 3300053093 | Ga0500651_0100405 | Ga0500651_0100405_314_1465 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k2m-assembly2.cif.gz_D | bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa | 0.7207 | 10 | 340 |
| 5k2m-assembly1.cif.gz_A | bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa | 0.7184 | 10 | 340 |
| 5k2m-assembly2.cif.gz_D | bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa | 0.7136 | 10 | 340 |
| 5k2m-assembly1.cif.gz_A | bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa | 0.7114 | 10 | 340 |
| 1uc9-assembly1.cif.gz_A | crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 | 0.6917 | 11 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O88935_218_393_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.6924 | 125 | 319 | 3.30.470.20 |
| af_P04425_124_309_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.6548 | 116 | 342 | 3.30.360.10 |
| 3lkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6531 | 10 | 99 | 3.40.50.2300 |
| 3q2oA02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.6529 | 125 | 210 | 3.30.1490.20 |
| af_Q75JF9_20_363_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.6432 | 204 | 315 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A160UDU0-F1-model_v4 | deleted | 0.9831 | 51 | 342 |
|
| AF-A0A160UDU0-F1-model_v4 | deleted | 0.9732 | 51 | 342 |
|
| AF-X5XHN2-F1-model_v4 | DUF6815 domain-containing protein | 0.9498 | 12 | 337 |
|
| AF-Q89QP3-F1-model_v4 | Bll3081 protein | 0.9479 | 1 | 340 |
|
| AF-A0A086P5X6-F1-model_v4 | Uncharacterized protein | 0.9439 | 47 | 172 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar