F403100

General Info

Members Datasets Scaffolds Average Seq Length
315 205 284 346

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10027092|Ga0070717_100270923
Length 419
Sequence MQPKSGVDMRRKSRLDKAMFRRVVLRARCSFSGATPKATPWMFLDHTNNQFLSVGKKGDEHDMTVGEAGKLALLWPRDAPKWHAKTPQDYRLHRVFEAMTALGIEAEPAIYADDVADQVRDQLLRCDGVLVWVDPLFAGQNRIVLDALLRDVASKGVWVSAHPDVILKMGVKEVLHHTRHLGWGTDTHLYRNTATFREEFPQRLRAGGARVLKQNRGNGGEGVWRVELSSEPAQGAATVRVLHAPRGSVTQDMPLGDFMNRCETYFANEGCIIDQPFQARLPDGMIRCYMGADKAVGFGHQFIKALIAPPPEGPDSAQPGPRIMHPASAPEFRALRTKMESEWTPQMMQLLGIEAESLPIIWDADFLYGPRDAAGQDTYVLCEINVSSVFPFPEQAPSEIARLARARVQSKKETRPMSA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
3 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
6 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
7 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
8 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
9 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
10 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
11 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
12 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
13 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
14 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
15 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
16 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
17 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
18 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
19 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
20 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
21 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
22 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
201 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
202 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
203 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
204 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
205 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.16
Metatranscriptomes 0
Isolates 9.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 5.71
Rhizoplane 4.13
Rhizosphere 79.37
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10024743 3300003203 Bacteria 2347
2 JGI25404J52841_10000160 3300003659 Bacteria 7600
3 JGI25404J52841_10016855 3300003659 Bacteria 1584
4 JGI25404J52841_10019413 3300003659 Bacteria 1473
5 Ga0070658_10004712 3300005327 Bacteria 11087
6 Ga0070658_10116662 3300005327 Bacteria 2216
7 Ga0070683_100436412 3300005329 Unclassified 1249
8 Ga0070680_100001752 3300005336 Bacteria 15939
9 Ga0070682_100103850 3300005337 Bacteria 1881
10 Ga0070682_100144518 3300005337 Unclassified 1625
11 Ga0070660_100015766 3300005339 Bacteria 5466
12 Ga0070660_100044678 3300005339 Bacteria 3390
13 Ga0070689_100026611 3300005340 Bacteria 4355
14 Ga0070691_10040933 3300005341 Bacteria 2190
15 Ga0070671_100159190 3300005355 Bacteria 1909
16 Ga0070674_100184364 3300005356 Unclassified 1601
17 Ga0070674_100328092 3300005356 Bacteria 1229
18 Ga0070659_100260469 3300005366 Bacteria 1439
19 Ga0070709_10026709 3300005434 Bacteria 3425
20 Ga0070709_10089332 3300005434 Bacteria 2028
21 Ga0070714_100023336 3300005435 Bacteria 5081
22 Ga0070714_100212801 3300005435 Bacteria 1773
23 Ga0070713_100004199 3300005436 Bacteria 9616
24 Ga0070713_100015639 3300005436 Bacteria 5682
25 Ga0070713_100069995 3300005436 Bacteria 2960
26 Ga0070713_100121490 3300005436 Bacteria 2292
27 Ga0070710_10080160 3300005437 Bacteria 1904
28 Ga0070710_10129255 3300005437 Bacteria 1538
29 Ga0070701_10146416 3300005438 Unclassified 1356
30 Ga0070711_100020817 3300005439 Bacteria 4233
31 Ga0070700_100143903 3300005441 Bacteria 1623
32 Ga0070678_100018844 3300005456 Bacteria 4482
33 Ga0070662_100073579 3300005457 Bacteria 2525
34 Ga0070681_10002984 3300005458 Bacteria 15697
35 Ga0070681_10012089 3300005458 Bacteria 8559
36 Ga0070681_10017034 3300005458 Bacteria 7263
37 Ga0070685_10092958 3300005466 Unclassified 1828
38 Ga0070698_100059339 3300005471 Bacteria 3864
39 Ga0070679_100012824 3300005530 Bacteria 8020
40 Ga0070684_100308216 3300005535 Unclassified 1453
41 Ga0070697_100289374 3300005536 Bacteria 1407
42 Ga0068853_100031600 3300005539 Bacteria 4479
43 Ga0070672_100320363 3300005543 Unclassified 1318
44 Ga0070696_100013179 3300005546 Bacteria 5546
45 Ga0068855_100007480 3300005563 Bacteria 13224
46 Ga0068855_100028307 3300005563 Bacteria 6702
47 Ga0068855_100054873 3300005563 Bacteria 4682
48 Ga0068855_100101909 3300005563 Bacteria 3304
49 Ga0068855_100180483 3300005563 Bacteria 2387
50 Ga0070664_100038292 3300005564 Bacteria 4036
51 Ga0068854_100056592 3300005578 Bacteria 2827
52 Ga0068856_100208908 3300005614 Bacteria 1967
53 Ga0068856_100466069 3300005614 Bacteria 1284
54 Ga0070702_100051765 3300005615 Unclassified 2352
55 Ga0068852_100044528 3300005616 Bacteria 3770
56 Ga0068852_100436390 3300005616 Bacteria 1294
57 Ga0068863_100515973 3300005841 Unclassified 1178
58 Ga0068858_100041300 3300005842 Bacteria 4277
59 Ga0081540_1003820 3300005983 Bacteria 11788
60 Ga0081540_1005280 3300005983 Bacteria 9666
61 Ga0081540_1052847 3300005983 Bacteria 1997
62 Ga0081539_10000640 3300005985 Bacteria 70720
63 Ga0070717_10027092 3300006028 Bacteria 4578
64 Ga0075365_10020339 3300006038 Bacteria 4115
65 Ga0075365_10026592 3300006038 Bacteria 3675
66 Ga0070716_100206406 3300006173 Bacteria 1310
67 Ga0070712_100164764 3300006175 Bacteria 1715
68 Ga0070712_100204694 3300006175 Bacteria 1552
69 Ga0075367_10168066 3300006178 Unclassified 1365
70 Ga0075370_10083583 3300006353 Unclassified 1837
71 Ga0068871_100200400 3300006358 Bacteria 1723
72 Ga0075428_100096737 3300006844 Bacteria 3218
73 Ga0075428_100167927 3300006844 Bacteria 2380
74 Ga0075433_10056749 3300006852 Plasmid 3422
75 Ga0075434_100194625 3300006871 Bacteria 2048
76 Ga0068865_100142688 3300006881 Unclassified 1807
77 Ga0105240_10001948 3300009093 Bacteria 34189
78 Ga0105240_10040274 3300009093 Bacteria 5977
79 Ga0105240_10081026 3300009093 Bacteria 3990
80 Ga0105240_10457167 3300009093 Bacteria 1427
81 Ga0111539_10011650 3300009094 Bacteria 11034
82 Ga0105243_10059165 3300009148 Plasmid 3057
83 Ga0105241_10000845 3300009174 Bacteria 23178
84 Ga0105242_10116755 3300009176 Unclassified 2283
85 Ga0105248_10301893 3300009177 Unclassified 1803
86 Ga0105248_10346089 3300009177 Bacteria 1674
87 Ga0105238_10074463 3300009551 Bacteria 3388
88 Ga0105246_10024249 3300011119 Bacteria 3939
89 Ga0105246_10179193 3300011119 Bacteria 1630
90 Ga0157370_10188690 3300013104 Bacteria 1914
91 Ga0157378_10144809 3300013297 Bacteria 2209
92 Ga0163162_10263082 3300013306 Bacteria 1857
93 Ga0163162_10343370 3300013306 Unclassified 1625
94 Ga0157372_10027211 3300013307 Bacteria 6225
95 Ga0157372_10034924 3300013307 Bacteria 5533
96 Ga0157375_10146293 3300013308 Unclassified 2494
97 Ga0157375_10242222 3300013308 Bacteria 1963
98 Ga0163163_10094639 3300014325 Bacteria 3006
99 Ga0163163_10289953 3300014325 Bacteria 1689
100 Ga0157379_10005157 3300014968 Bacteria 11217
101 Ga0157376_10150930 3300014969 Unclassified 2095
102 Ga0157376_10360434 3300014969 Bacteria 1394
103 Ga0163161_10093153 3300017792 Unclassified 2232
104 Ga0213876_10001710 3300021384 Bacteria 13330
105 Ga0213876_10053511 3300021384 Bacteria 2132
106 Ga0209677_100454 3300025253 Bacteria 23786
107 Ga0209233_1000216 3300025261 Bacteria 108123
108 Ga0207705_10044848 3300025909 Bacteria 3178
109 Ga0207705_10320622 3300025909 Bacteria 1191
110 Ga0207684_10162250 3300025910 Bacteria 1925
111 Ga0207684_10211013 3300025910 Bacteria 1675
112 Ga0207707_10023373 3300025912 Bacteria 5407
113 Ga0207707_10049220 3300025912 Bacteria 3671
114 Ga0207707_10062033 3300025912 Bacteria 3253
115 Ga0207695_10001012 3300025913 Bacteria 49532
116 Ga0207695_10003472 3300025913 Bacteria 22178
117 Ga0207695_10040040 3300025913 Bacteria 5031
118 Ga0207695_10084549 3300025913 Bacteria 3203
119 Ga0207695_10276026 3300025913 Bacteria 1575
120 Ga0207693_10005719 3300025915 Bacteria 10326
121 Ga0207693_10088420 3300025915 Bacteria 2428
122 Ga0207663_10006785 3300025916 Bacteria 5893
123 Ga0207660_10220831 3300025917 Bacteria 1487
124 Ga0207660_10247128 3300025917 Bacteria 1407
125 Ga0207657_10002616 3300025919 Bacteria 19452
126 Ga0207657_10057367 3300025919 Bacteria 3355
127 Ga0207652_10083238 3300025921 Bacteria 2801
128 Ga0207700_10193907 3300025928 Bacteria 1708
129 Ga0207690_10251074 3300025932 Bacteria 1366
130 Ga0207706_10127166 3300025933 Bacteria 2241
131 Ga0207665_10243636 3300025939 Bacteria 1326
132 Ga0207661_10386732 3300025944 Unclassified 1267
133 Ga0207667_10013656 3300025949 Bacteria 9283
134 Ga0207667_10067055 3300025949 Bacteria 3739
135 Ga0207667_10071957 3300025949 Bacteria 3594
136 Ga0207667_10142944 3300025949 Bacteria 2464
137 Ga0207667_10159555 3300025949 Bacteria 2320
138 Ga0207640_10040135 3300025981 Bacteria 2967
139 Ga0207703_10040635 3300026035 Bacteria 3723
140 Ga0207703_10181646 3300026035 Bacteria 1857
141 Ga0207641_10271428 3300026088 Unclassified 1592
142 Ga0207683_10104731 3300026121 Bacteria 2528
143 Ga0207428_10032685 3300027907 Bacteria 4277
144 Ga0268265_10415265 3300028380 Unclassified 1248
145 Ga0307511_10031184 3300030521 Bacteria 4767
146 Ga0307511_10075941 3300030521 Bacteria 2407
147 Ga0307510_10005631 3300033180 Bacteria 14933
148 Ga0373934_0019523 3300035086 Bacteria 2603
149 Ga0373953_0020936 3300035117 Bacteria 2448
150 Ga0373946_0006895 3300035171 Bacteria 4135
151 Ga0373946_0009420 3300035171 Bacteria 3597
152 Ga0373935_0024571 3300035692 Bacteria 3710
153 Ga0373935_0118891 3300035692 Bacteria 1763
154 Ga0373935_0120651 3300035692 Bacteria 1751
155 Ga0373927_0054782 3300035695 Bacteria 2579
156 Ga0373927_0111775 3300035695 Unclassified 1780
157 Ga0373927_0189031 3300035695 Bacteria 1351
158 Ga0373933_0010864 3300035724 Bacteria 4997
159 Ga0373947_0091145 3300035725 Bacteria 1901
160 Ga0373937_0009868 3300036401 Bacteria 8324
161 Ga0373937_0039000 3300036401 Bacteria 4328
162 Ga0395899_0119793 3300037312 Bacteria 1886
163 Ga0395900_0146354 3300037418 Bacteria 2415
164 Ga0395898_0114215 3300037466 Bacteria 2587
165 Ga0395905_0030469 3300037471 Bacteria 5084
166 Ga0395905_0045721 3300037471 Bacteria 4106
167 Ga0395905_0124310 3300037471 Bacteria 2426
168 Ga0436364_1216893 3300037853 Bacteria 3624
169 Ga0395901_0357525 3300038443 Bacteria 1506
170 Ga0436365_0269340 3300039437 Bacteria 68150
171 Ga0436365_0872987 3300039437 Bacteria 2669
172 Ga0436365_1846395 3300039437 Bacteria 2186
173 Ga0436360_1019583 3300039438 Bacteria 1345
174 Ga0436361_0272484 3300039447 Bacteria 3851
175 Ga0436363_1181037 3300039450 Bacteria 6101
176 Ga0466964_0015330 3300044706 Bacteria 2916
177 Ga0466967_0077108 3300045976 Bacteria 2999
178 Ga0495629_0000942 3300046459 Bacteria 23392
179 Ga0495641_0001683 3300046461 Bacteria 18490
180 Ga0495651_0005812 3300046462 Bacteria 9412
181 Ga0495651_0017555 3300046462 Bacteria 5541
182 Ga0495653_0053038 3300046463 Bacteria 3104
183 Ga0495653_0082213 3300046463 Bacteria 2378
184 Ga0495653_0089283 3300046463 Bacteria 2259
185 Ga0495653_0209254 3300046463 Bacteria 1318
186 Ga0495582_0000972 3300046473 Bacteria 16034
187 Ga0495639_0004217 3300046475 Bacteria 6166
188 Ga0495662_0008235 3300046476 Bacteria 5134
189 Ga0495664_0002083 3300046477 Bacteria 10699
190 Ga0495664_0047918 3300046477 Bacteria 2536
191 Ga0495664_0073015 3300046477 Bacteria 2051
192 Ga0495594_0173857 3300046499 Bacteria 1225
193 Ga0495596_0108172 3300046500 Unclassified 1080
194 Ga0495608_0028233 3300046511 Bacteria 3814
195 Ga0495608_0130842 3300046511 Bacteria 1606
196 Ga0495628_0008049 3300046516 Bacteria 9074
197 Ga0495631_0035951 3300046518 Bacteria 2214
198 Ga0495652_0010324 3300046529 Bacteria 8460
199 Ga0495652_0061569 3300046529 Bacteria 3167
200 Ga0495665_0006774 3300046531 Bacteria 6180
201 Ga0495640_0024849 3300046533 Bacteria 4353
202 Ga0495640_0036930 3300046533 Bacteria 3449
203 Ga0495640_0058358 3300046533 Bacteria 2632
204 Ga0495587_0004022 3300046536 Bacteria 9744
205 Ga0495587_0011083 3300046536 Bacteria 5718
206 Ga0495645_0008459 3300046543 Bacteria 7186
207 Ga0495645_0264553 3300046543 Bacteria 1137
208 Ga0495667_0029319 3300046559 Bacteria 3704
209 Ga0495667_0078712 3300046559 Bacteria 2143
210 Ga0495634_0036556 3300046642 Bacteria 3358
211 Ga0495634_0053186 3300046642 Bacteria 2713
212 Ga0495634_0124893 3300046642 Bacteria 1645
213 Ga0495635_0027521 3300046663 Bacteria 3954
214 Ga0495635_0069985 3300046663 Bacteria 2405
215 Ga0495635_0190970 3300046663 Bacteria 1390
216 Ga0495588_0045290 3300046674 Bacteria 2255
217 Ga0495657_0002485 3300046675 Bacteria 15496
218 Ga0495623_0019926 3300046679 Bacteria 4335
219 Ga0495646_0016265 3300046680 Bacteria 4722
220 Ga0495646_0020514 3300046680 Bacteria 4181
221 Ga0495647_0014402 3300046681 Bacteria 2755
222 Ga0495658_0000532 3300046683 Bacteria 20782
223 Ga0495658_0023354 3300046683 Bacteria 3282
224 Ga0495613_0002000 3300046689 Bacteria 15474
225 Ga0495613_0037499 3300046689 Bacteria 3594
226 Ga0495613_0038247 3300046689 Bacteria 3556
227 Ga0495624_0060370 3300046690 Bacteria 2377
228 Ga0495589_0034025 3300046794 Bacteria 2559
229 Ga0495600_0000403 3300046809 Bacteria 22314
230 Ga0495581_0005201 3300047315 Bacteria 7527
231 Ga0495581_0117303 3300047315 Bacteria 1548
232 Ga0495604_0006190 3300047317 Bacteria 9500
233 Ga0495604_0094109 3300047317 Bacteria 2215
234 Ga0495674_0001752 3300047319 Bacteria 21368
235 Ga0495674_0023498 3300047319 Bacteria 5680
236 Ga0495674_0097850 3300047319 Bacteria 2499
237 Ga0495674_0128592 3300047319 Bacteria 2135
238 Ga0495676_0070431 3300047321 Bacteria 2693
239 Ga0495680_0002464 3300047322 Bacteria 18944
240 Ga0495680_0016360 3300047322 Bacteria 6376
241 Ga0495680_0042755 3300047322 Bacteria 3593
242 Ga0495680_0056132 3300047322 Bacteria 3050
243 Ga0495675_0004828 3300047444 Bacteria 8198
244 Ga0495675_0026176 3300047444 Bacteria 3718
245 Ga0495684_0004597 3300047471 Bacteria 10782
246 Ga0495684_0031910 3300047471 Bacteria 4045
247 Ga0495684_0038146 3300047471 Bacteria 3684
248 Ga0495684_0235290 3300047471 Bacteria 1338
249 Ga0495593_0016263 3300047673 Bacteria 4199
250 Ga0495602_0005594 3300048088 Bacteria 13194
251 Ga0496101_0305497 3300048904 Bacteria 1247
252 Ga0496101_0475893 3300048904 Unclassified 986
253 Ga0496104_0285146 3300048907 Bacteria 1564
254 Ga0496105_0137305 3300048908 Bacteria 2014
255 Ga0496107_0041198 3300048910 Bacteria 3316
256 Ga0496108_0019431 3300048911 Bacteria 5579
257 Ga0496108_0110397 3300048911 Bacteria 2351
258 Ga0496108_0408451 3300048911 Unclassified 1186
259 Ga0496109_0009979 3300048912 Bacteria 8108
260 Ga0496110_0439829 3300048913 Bacteria 1188
261 Ga0496111_0078828 3300048914 Bacteria 2402
262 Ga0496114_0300881 3300048917 Bacteria 1416
263 Ga0496114_0332972 3300048917 Unclassified 1342
264 Ga0496121_0033935 3300048924 Bacteria 4605
265 Ga0501041_0141168 3300049577 Unclassified 1502
266 Ga0501079_0108504 3300049741 Bacteria 2155
267 Ga0501083_0052765 3300049744 Bacteria 2731
268 nmdc:mga0yw44_20434_c1 3300050492 Bacteria 3675
269 nmdc:mga0yw44_3879_c1 3300050492 Bacteria 6737
270 nmdc:mga08y16_88976_c1 3300050511 Bacteria 3218
271 nmdc:mga0a205_151275_c1 3300050515 Bacteria 2220
272 Ga0495601_0002565 3300053077 Bacteria 10327
273 Ga0495601_0019234 3300053077 Bacteria 4164
274 Ga0495601_0028303 3300053077 Bacteria 3471
275 Ga0495612_0013471 3300053078 Bacteria 3294
276 Ga0495612_0017111 3300053078 Bacteria 2904
277 Ga0495595_0119448 3300053084 Bacteria 1283
278 Ga0495619_0011343 3300053085 Bacteria 5611
279 Ga0495619_0017314 3300053085 Bacteria 4564
280 Ga0495619_0020607 3300053085 Bacteria 4202
281 Ga0495619_0036463 3300053085 Bacteria 3203
282 Ga0500651_0100405 3300053093 Bacteria 1774
283 Ga0500595_012917 3300053119 Bacteria 3213
284 Ga0501082_0038166 3300060353 Bacteria 4144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10012089 Ga0070681_1001208910 278
2 3300025912 Ga0207707_10062033 Ga0207707_100620332 278
3 iso_pu_bacteria 2885409591 2885414120 280
4 iso_pu_bacteria 8016613128 8016621746 280
5 3300048904 Ga0496101_0305497 Ga0496101_0305497_17_943 284
6 3300048904 Ga0496101_0475893 Ga0496101_0475893_22_891 286
7 3300005435 Ga0070714_100212801 Ga0070714_1002128012 291
8 3300048914 Ga0496111_0078828 Ga0496111_0078828_49_1020 299
9 3300005436 Ga0070713_100121490 Ga0070713_1001214904 305
10 3300025928 Ga0207700_10193907 Ga0207700_101939072 305
11 3300046461 Ga0495641_0001683 Ga0495641_0001683_2012_2977 307
12 3300046463 Ga0495653_0082213 Ga0495653_0082213_639_1604 307
13 3300046476 Ga0495662_0008235 Ga0495662_0008235_700_1665 307
14 3300046500 Ga0495596_0108172 Ga0495596_0108172_20_952 307
15 3300046511 Ga0495608_0130842 Ga0495608_0130842_23_988 307
16 3300046663 Ga0495635_0027521 Ga0495635_0027521_891_1856 307
17 3300046683 Ga0495658_0000532 Ga0495658_0000532_11831_12796 307
18 3300047315 Ga0495581_0005201 Ga0495581_0005201_3329_4294 307
19 3300048911 Ga0496108_0408451 Ga0496108_0408451_212_1144 307
20 3300045976 Ga0466967_0077108 Ga0466967_0077108_1084_2142 314
21 3300046462 Ga0495651_0005812 Ga0495651_0005812_2071_3150 318
22 3300046463 Ga0495653_0209254 Ga0495653_0209254_92_1171 318
23 3300046477 Ga0495664_0047918 Ga0495664_0047918_24_1103 318
24 3300046529 Ga0495652_0061569 Ga0495652_0061569_202_1281 318
25 3300046533 Ga0495640_0024849 Ga0495640_0024849_1368_2447 318
26 3300046536 Ga0495587_0004022 Ga0495587_0004022_4434_5513 318
27 3300046543 Ga0495645_0264553 Ga0495645_0264553_16_1095 318
28 3300046642 Ga0495634_0124893 Ga0495634_0124893_494_1573 318
29 3300046663 Ga0495635_0069985 Ga0495635_0069985_410_1489 318
30 3300046675 Ga0495657_0002485 Ga0495657_0002485_12220_13299 318
31 3300046679 Ga0495623_0019926 Ga0495623_0019926_1317_2396 318
32 3300046680 Ga0495646_0016265 Ga0495646_0016265_1864_2943 318
33 3300046809 Ga0495600_0000403 Ga0495600_0000403_18929_20008 318
34 3300047317 Ga0495604_0006190 Ga0495604_0006190_6508_7587 318
35 3300047319 Ga0495674_0023498 Ga0495674_0023498_2554_3633 318
36 3300047322 Ga0495680_0002464 Ga0495680_0002464_7821_8900 318
37 3300047444 Ga0495675_0026176 Ga0495675_0026176_468_1547 318
38 3300053078 Ga0495612_0017111 Ga0495612_0017111_365_1378 318
39 3300021384 Ga0213876_10001710 Ga0213876_100017102 324
40 3300039437 Ga0436365_0269340 Ga0436365_0269340_12042_13055 324
41 3300005841 Ga0068863_100515973 Ga0068863_1005159731 325
42 3300009148 Ga0105243_10059165 Ga0105243_100591651 325
43 3300009176 Ga0105242_10116755 Ga0105242_101167552 325
44 3300009177 Ga0105248_10301893 Ga0105248_103018932 325
45 3300011119 Ga0105246_10024249 Ga0105246_100242495 325
46 3300013306 Ga0163162_10343370 Ga0163162_103433701 325
47 3300013308 Ga0157375_10146293 Ga0157375_101462932 325
48 3300014325 Ga0163163_10094639 Ga0163163_100946397 325
49 3300017792 Ga0163161_10093153 Ga0163161_100931533 325
50 3300025944 Ga0207661_10386732 Ga0207661_103867321 325
51 3300028380 Ga0268265_10415265 Ga0268265_104152651 325
52 3300048917 Ga0496114_0332972 Ga0496114_0332972_43_1035 325
53 3300009093 Ga0105240_10457167 Ga0105240_104571672 326
54 3300005456 Ga0070678_100018844 Ga0070678_1000188445 331
55 3300026121 Ga0207683_10104731 Ga0207683_101047312 331
56 3300005434 Ga0070709_10089332 Ga0070709_100893322 332
57 3300005436 Ga0070713_100069995 Ga0070713_1000699951 332
58 3300030521 Ga0307511_10075941 Ga0307511_100759412 332
59 3300049577 Ga0501041_0141168 Ga0501041_0141168_425_1477 332
60 3300049741 Ga0501079_0108504 Ga0501079_0108504_22_1074 332
61 3300053119 Ga0500595_012917 Ga0500595_012917_579_1655 332
62 3300060353 Ga0501082_0038166 Ga0501082_0038166_1160_2212 332
63 3300005329 Ga0070683_100436412 Ga0070683_1004364121 333
64 3300005337 Ga0070682_100144518 Ga0070682_1001445182 333
65 3300005339 Ga0070660_100015766 Ga0070660_10001576610 333
66 3300005356 Ga0070674_100184364 Ga0070674_1001843641 333
67 3300005366 Ga0070659_100260469 Ga0070659_1002604692 333
68 3300005438 Ga0070701_10146416 Ga0070701_101464162 333
69 3300005458 Ga0070681_10017034 Ga0070681_100170349 333
70 3300005466 Ga0070685_10092958 Ga0070685_100929581 333
71 3300005535 Ga0070684_100308216 Ga0070684_1003082162 333
72 3300005539 Ga0068853_100031600 Ga0068853_1000316002 333
73 3300005543 Ga0070672_100320363 Ga0070672_1003203631 333
74 3300005546 Ga0070696_100013179 Ga0070696_10001317910 333
75 3300005563 Ga0068855_100028307 Ga0068855_1000283077 333
76 3300005615 Ga0070702_100051765 Ga0070702_1000517653 333
77 3300006881 Ga0068865_100142688 Ga0068865_1001426882 333
78 3300009093 Ga0105240_10001948 Ga0105240_1000194823 333
79 3300013307 Ga0157372_10034924 Ga0157372_100349243 333
80 3300014969 Ga0157376_10150930 Ga0157376_101509303 333
81 3300025912 Ga0207707_10023373 Ga0207707_100233737 333
82 3300025913 Ga0207695_10001012 Ga0207695_1000101248 333
83 3300025919 Ga0207657_10002616 Ga0207657_1000261615 333
84 3300025932 Ga0207690_10251074 Ga0207690_102510742 333
85 3300025949 Ga0207667_10013656 Ga0207667_100136566 333
86 3300026088 Ga0207641_10271428 Ga0207641_102714281 333
87 3300035171 Ga0373946_0009420 Ga0373946_0009420_2087_3136 333
88 3300035695 Ga0373927_0189031 Ga0373927_0189031_87_1136 333
89 3300037471 Ga0395905_0124310 Ga0395905_0124310_177_1223 333
90 3300046459 Ga0495629_0000942 Ga0495629_0000942_1690_2739 333
91 3300046462 Ga0495651_0017555 Ga0495651_0017555_2008_3048 333
92 3300046463 Ga0495653_0053038 Ga0495653_0053038_1854_2894 333
93 3300046473 Ga0495582_0000972 Ga0495582_0000972_3239_4288 333
94 3300046475 Ga0495639_0004217 Ga0495639_0004217_3485_4534 333
95 3300046499 Ga0495594_0173857 Ga0495594_0173857_15_1064 333
96 3300046511 Ga0495608_0028233 Ga0495608_0028233_1509_2549 333
97 3300046531 Ga0495665_0006774 Ga0495665_0006774_2407_3456 333
98 3300046533 Ga0495640_0058358 Ga0495640_0058358_704_1753 333
99 3300046559 Ga0495667_0029319 Ga0495667_0029319_1959_3008 333
100 3300046642 Ga0495634_0036556 Ga0495634_0036556_1616_2665 333
101 3300046689 Ga0495613_0002000 Ga0495613_0002000_4852_5901 333
102 3300046689 Ga0495613_0038247 Ga0495613_0038247_2435_3475 333
103 3300047319 Ga0495674_0001752 Ga0495674_0001752_2718_3758 333
104 3300047319 Ga0495674_0097850 Ga0495674_0097850_921_1970 333
105 3300047321 Ga0495676_0070431 Ga0495676_0070431_602_1651 333
106 3300047322 Ga0495680_0016360 Ga0495680_0016360_951_1991 333
107 3300047322 Ga0495680_0056132 Ga0495680_0056132_504_1553 333
108 3300047471 Ga0495684_0038146 Ga0495684_0038146_2227_3276 333
109 3300047673 Ga0495593_0016263 Ga0495593_0016263_714_1763 333
110 3300049744 Ga0501083_0052765 Ga0501083_0052765_1581_2633 333
111 3300053085 Ga0495619_0020607 Ga0495619_0020607_1935_2984 333
112 iso_pu_bacteria 2513237084 2513573494 333
113 iso_pu_bacteria 2513237093 2513636569 333
114 iso_pu_bacteria 2724679232 2725950980 333
115 3300005327 Ga0070658_10116662 Ga0070658_101166622 334
116 3300005563 Ga0068855_100054873 Ga0068855_1000548733 334
117 3300005563 Ga0068855_100101909 Ga0068855_1001019093 334
118 3300005563 Ga0068855_100180483 Ga0068855_1001804832 334
119 3300005616 Ga0068852_100044528 Ga0068852_1000445282 334
120 3300005616 Ga0068852_100436390 Ga0068852_1004363901 334
121 3300009093 Ga0105240_10040274 Ga0105240_100402742 334
122 3300009551 Ga0105238_10074463 Ga0105238_100744633 334
123 3300013104 Ga0157370_10188690 Ga0157370_101886902 334
124 3300013307 Ga0157372_10027211 Ga0157372_100272117 334
125 3300021384 Ga0213876_10053511 Ga0213876_100535111 334
126 3300025909 Ga0207705_10320622 Ga0207705_103206221 334
127 3300025913 Ga0207695_10003472 Ga0207695_100034725 334
128 3300025913 Ga0207695_10276026 Ga0207695_102760261 334
129 3300025917 Ga0207660_10220831 Ga0207660_102208311 334
130 3300025949 Ga0207667_10071957 Ga0207667_100719572 334
131 3300025949 Ga0207667_10142944 Ga0207667_101429443 334
132 3300025949 Ga0207667_10159555 Ga0207667_101595552 334
133 3300037312 Ga0395899_0119793 Ga0395899_0119793_411_1493 334
134 3300037418 Ga0395900_0146354 Ga0395900_0146354_453_1535 334
135 3300037466 Ga0395898_0114215 Ga0395898_0114215_1386_2468 334
136 3300037471 Ga0395905_0030469 Ga0395905_0030469_1332_2390 334
137 3300037471 Ga0395905_0045721 Ga0395905_0045721_2222_3244 334
138 3300038443 Ga0395901_0357525 Ga0395901_0357525_120_1202 334
139 3300039437 Ga0436365_1846395 Ga0436365_1846395_1009_2088 334
140 3300048917 Ga0496114_0300881 Ga0496114_0300881_208_1305 335
141 iso_pu_bacteria 8016603502 8016612063 335
142 3300005327 Ga0070658_10004712 Ga0070658_100047127 336
143 3300005336 Ga0070680_100001752 Ga0070680_10000175212 336
144 3300005339 Ga0070660_100044678 Ga0070660_1000446783 336
145 3300005341 Ga0070691_10040933 Ga0070691_100409333 336
146 3300005458 Ga0070681_10002984 Ga0070681_1000298412 336
147 3300005530 Ga0070679_100012824 Ga0070679_1000128245 336
148 3300005563 Ga0068855_100007480 Ga0068855_10000748010 336
149 3300005842 Ga0068858_100041300 Ga0068858_1000413002 336
150 3300009093 Ga0105240_10081026 Ga0105240_100810263 336
151 3300014968 Ga0157379_10005157 Ga0157379_100051573 336
152 3300025909 Ga0207705_10044848 Ga0207705_100448482 336
153 3300025912 Ga0207707_10049220 Ga0207707_100492204 336
154 3300025913 Ga0207695_10040040 Ga0207695_100400405 336
155 3300025917 Ga0207660_10247128 Ga0207660_102471282 336
156 3300025919 Ga0207657_10057367 Ga0207657_100573673 336
157 3300025921 Ga0207652_10083238 Ga0207652_100832383 336
158 3300025949 Ga0207667_10067055 Ga0207667_100670552 336
159 3300026035 Ga0207703_10040635 Ga0207703_100406352 336
160 3300026035 Ga0207703_10181646 Ga0207703_101816462 336
161 3300035692 Ga0373935_0118891 Ga0373935_0118891_79_1146 336
162 3300046518 Ga0495631_0035951 Ga0495631_0035951_109_1161 336
163 3300047471 Ga0495684_0235290 Ga0495684_0235290_61_1128 336
164 3300006038 Ga0075365_10026592 Ga0075365_100265922 337
165 3300006358 Ga0068871_100200400 Ga0068871_1002004002 337
166 3300006852 Ga0075433_10056749 Ga0075433_100567492 337
167 3300006871 Ga0075434_100194625 Ga0075434_1001946252 337
168 3300009177 Ga0105248_10346089 Ga0105248_103460891 337
169 3300013306 Ga0163162_10263082 Ga0163162_102630822 337
170 3300014969 Ga0157376_10360434 Ga0157376_103604342 337
171 3300025253 Ga0209677_100454 Ga0209677_10045415 337
172 3300025261 Ga0209233_1000216 Ga0209233_100021692 337
173 3300037853 Ga0436364_1216893 Ga0436364_1216893_2258_3310 337
174 3300039437 Ga0436365_0872987 Ga0436365_0872987_240_1292 337
175 3300039438 Ga0436360_1019583 Ga0436360_1019583_39_1091 337
176 3300039450 Ga0436363_1181037 Ga0436363_1181037_2383_3435 337
177 3300050492 nmdc:mga0yw44_20434_c1 nmdc:mga0yw44_20434_c1_2389_3480 337
178 3300005434 Ga0070709_10026709 Ga0070709_100267093 338
179 3300005435 Ga0070714_100023336 Ga0070714_1000233363 338
180 3300005436 Ga0070713_100004199 Ga0070713_1000041995 338
181 3300005437 Ga0070710_10080160 Ga0070710_100801602 338
182 3300005439 Ga0070711_100020817 Ga0070711_1000208172 338
183 3300005457 Ga0070662_100073579 Ga0070662_1000735792 338
184 3300005471 Ga0070698_100059339 Ga0070698_1000593393 338
185 3300005564 Ga0070664_100038292 Ga0070664_1000382925 338
186 3300005578 Ga0068854_100056592 Ga0068854_1000565922 338
187 3300005614 Ga0068856_100208908 Ga0068856_1002089082 338
188 3300005614 Ga0068856_100466069 Ga0068856_1004660692 338
189 3300006028 Ga0070717_10027092 Ga0070717_100270923 338
190 3300006173 Ga0070716_100206406 Ga0070716_1002064062 338
191 3300006175 Ga0070712_100164764 Ga0070712_1001647642 338
192 3300011119 Ga0105246_10179193 Ga0105246_101791932 338
193 3300014325 Ga0163163_10289953 Ga0163163_102899532 338
194 3300025913 Ga0207695_10084549 Ga0207695_100845492 338
195 3300025915 Ga0207693_10005719 Ga0207693_100057192 338
196 3300025916 Ga0207663_10006785 Ga0207663_100067854 338
197 3300025933 Ga0207706_10127166 Ga0207706_101271662 338
198 3300025939 Ga0207665_10243636 Ga0207665_102436362 338
199 3300025981 Ga0207640_10040135 Ga0207640_100401352 338
200 3300030521 Ga0307511_10031184 Ga0307511_100311843 338
201 3300035086 Ga0373934_0019523 Ga0373934_0019523_881_1948 338
202 3300035117 Ga0373953_0020936 Ga0373953_0020936_640_1707 338
203 3300035692 Ga0373935_0024571 Ga0373935_0024571_2476_3543 338
204 3300035724 Ga0373933_0010864 Ga0373933_0010864_2584_3651 338
205 3300036401 Ga0373937_0009868 Ga0373937_0009868_2305_3357 338
206 3300036401 Ga0373937_0039000 Ga0373937_0039000_2308_3375 338
207 3300046463 Ga0495653_0089283 Ga0495653_0089283_626_1693 338
208 3300046477 Ga0495664_0002083 Ga0495664_0002083_2802_3869 338
209 3300046516 Ga0495628_0008049 Ga0495628_0008049_1765_2832 338
210 3300046529 Ga0495652_0010324 Ga0495652_0010324_3833_4900 338
211 3300046536 Ga0495587_0011083 Ga0495587_0011083_3464_4531 338
212 3300046543 Ga0495645_0008459 Ga0495645_0008459_2404_3471 338
213 3300046559 Ga0495667_0078712 Ga0495667_0078712_803_1870 338
214 3300046680 Ga0495646_0020514 Ga0495646_0020514_557_1624 338
215 3300047317 Ga0495604_0094109 Ga0495604_0094109_772_1839 338
216 3300047322 Ga0495680_0042755 Ga0495680_0042755_1263_2330 338
217 3300047444 Ga0495675_0004828 Ga0495675_0004828_4106_5173 338
218 3300047471 Ga0495684_0031910 Ga0495684_0031910_44_1111 338
219 3300048088 Ga0495602_0005594 Ga0495602_0005594_9546_10613 338
220 3300053077 Ga0495601_0002565 Ga0495601_0002565_7725_8792 338
221 3300053078 Ga0495612_0013471 Ga0495612_0013471_1194_2261 338
222 3300053084 Ga0495595_0119448 Ga0495595_0119448_117_1184 338
223 3300053085 Ga0495619_0017314 Ga0495619_0017314_2096_3163 338
224 iso_pu_bacteria 2508501128 2509148633 338
225 iso_pu_bacteria 3005594810 3005595665 338
226 3300005337 Ga0070682_100103850 Ga0070682_1001038501 339
227 3300005356 Ga0070674_100328092 Ga0070674_1003280921 339
228 3300005436 Ga0070713_100015639 Ga0070713_1000156392 339
229 3300005437 Ga0070710_10129255 Ga0070710_101292551 339
230 3300005441 Ga0070700_100143903 Ga0070700_1001439032 339
231 3300006844 Ga0075428_100096737 Ga0075428_1000967373 339
232 3300013297 Ga0157378_10144809 Ga0157378_101448093 339
233 3300013308 Ga0157375_10242222 Ga0157375_102422222 339
234 3300025915 Ga0207693_10088420 Ga0207693_100884203 339
235 3300027907 Ga0207428_10032685 Ga0207428_100326852 339
236 3300033180 Ga0307510_10005631 Ga0307510_1000563113 339
237 3300048911 Ga0496108_0110397 Ga0496108_0110397_1182_2273 339
238 3300050515 nmdc:mga0a205_151275_c1 nmdc:mga0a205_151275_c1_290_1381 339
239 iso_pu_bacteria 2513237095 2513652315 339
240 3300005536 Ga0070697_100289374 Ga0070697_1002893742 340
241 3300006038 Ga0075365_10020339 Ga0075365_100203393 340
242 3300006178 Ga0075367_10168066 Ga0075367_101680662 340
243 3300006353 Ga0075370_10083583 Ga0075370_100835832 340
244 3300025910 Ga0207684_10162250 Ga0207684_101622501 340
245 3300025910 Ga0207684_10211013 Ga0207684_102110131 340
246 3300035171 Ga0373946_0006895 Ga0373946_0006895_2983_4071 340
247 3300035692 Ga0373935_0120651 Ga0373935_0120651_324_1412 340
248 3300035695 Ga0373927_0054782 Ga0373927_0054782_183_1271 340
249 3300035695 Ga0373927_0111775 Ga0373927_0111775_351_1439 340
250 3300035725 Ga0373947_0091145 Ga0373947_0091145_396_1484 340
251 3300039447 Ga0436361_0272484 Ga0436361_0272484_1468_2547 340
252 3300046674 Ga0495588_0045290 Ga0495588_0045290_123_1211 340
253 3300046681 Ga0495647_0014402 Ga0495647_0014402_1150_2238 340
254 3300046683 Ga0495658_0023354 Ga0495658_0023354_1376_2464 340
255 3300046689 Ga0495613_0037499 Ga0495613_0037499_676_1764 340
256 3300046690 Ga0495624_0060370 Ga0495624_0060370_41_1129 340
257 3300046794 Ga0495589_0034025 Ga0495589_0034025_14_1102 340
258 3300047315 Ga0495581_0117303 Ga0495581_0117303_123_1211 340
259 3300050492 nmdc:mga0yw44_3879_c1 nmdc:mga0yw44_3879_c1_4830_5927 340
260 3300053077 Ga0495601_0028303 Ga0495601_0028303_1594_2691 340
261 3300053085 Ga0495619_0011343 Ga0495619_0011343_3217_4314 340
262 iso_pu_bacteria 2528768022 2528853761 340
263 iso_pu_bacteria 2824671348 2824672539 340
264 iso_pu_bacteria 2824687955 2824689128 340
265 iso_pu_bacteria 2824704595 2824705393 340
266 iso_pu_bacteria 2824753945 2824755465 340
267 iso_pu_bacteria 2824753945 2824755843 340
268 iso_pu_bacteria 2824763712 2824763749 340
269 iso_pu_bacteria 2824763712 2824764896 340
270 iso_pu_bacteria 2841983080 2841991138 340
271 iso_pu_bacteria 2904711408 2904715895 340
272 iso_pu_bacteria 2904711408 2904716577 340
273 iso_pu_bacteria 3005587118 3005589171 340
274 iso_pu_bacteria 3005718088 3005720353 340
275 iso_pu_bacteria 8006926726 8006929070 340
276 iso_pu_bacteria 8019538911 8019543557 340
277 3300003659 JGI25404J52841_10000160 JGI25404J52841_100001604 341
278 3300005983 Ga0081540_1005280 Ga0081540_10052805 341
279 3300006844 Ga0075428_100167927 Ga0075428_1001679272 341
280 3300009094 Ga0111539_10011650 Ga0111539_100116502 341
281 3300009174 Ga0105241_10000845 Ga0105241_100008457 341
282 3300044706 Ga0466964_0015330 Ga0466964_0015330_635_1669 341
283 3300048924 Ga0496121_0033935 Ga0496121_0033935_1268_2302 341
284 3300050511 nmdc:mga08y16_88976_c1 nmdc:mga08y16_88976_c1_191_1270 341
285 iso_pu_bacteria 2838122688 2838130754 341
286 iso_pu_bacteria 2935769743 2935771640 341
287 iso_pu_bacteria 2935777560 2935779420 341
288 iso_pu_bacteria 2935785616 2935791008 341
289 iso_pu_bacteria 2935793552 2935800092 341
290 iso_pu_bacteria 8016622563 8016628100 341
291 iso_pu_bacteria 8019547302 8019555214 341
292 3300003203 JGI25406J46586_10024743 JGI25406J46586_100247432 342
293 3300003659 JGI25404J52841_10016855 JGI25404J52841_100168553 342
294 3300003659 JGI25404J52841_10019413 JGI25404J52841_100194131 342
295 3300005340 Ga0070689_100026611 Ga0070689_1000266114 342
296 3300005355 Ga0070671_100159190 Ga0070671_1001591902 342
297 3300005983 Ga0081540_1003820 Ga0081540_100382012 342
298 3300005983 Ga0081540_1052847 Ga0081540_10528473 342
299 3300005985 Ga0081539_10000640 Ga0081539_1000064099 342
300 3300006175 Ga0070712_100204694 Ga0070712_1002046941 342
301 3300046477 Ga0495664_0073015 Ga0495664_0073015_870_1925 342
302 3300046533 Ga0495640_0036930 Ga0495640_0036930_1372_2427 342
303 3300046642 Ga0495634_0053186 Ga0495634_0053186_1520_2575 342
304 3300046663 Ga0495635_0190970 Ga0495635_0190970_314_1369 342
305 3300047319 Ga0495674_0128592 Ga0495674_0128592_281_1336 342
306 3300047471 Ga0495684_0004597 Ga0495684_0004597_8293_9348 342
307 3300048907 Ga0496104_0285146 Ga0496104_0285146_150_1187 342
308 3300048908 Ga0496105_0137305 Ga0496105_0137305_609_1646 342
309 3300048910 Ga0496107_0041198 Ga0496107_0041198_282_1319 342
310 3300048911 Ga0496108_0019431 Ga0496108_0019431_3138_4175 342
311 3300048912 Ga0496109_0009979 Ga0496109_0009979_617_1654 342
312 3300048913 Ga0496110_0439829 Ga0496110_0439829_63_1100 342
313 3300053077 Ga0495601_0019234 Ga0495601_0019234_1398_2453 342
314 3300053085 Ga0495619_0036463 Ga0495619_0036463_1069_2124 342
315 3300053093 Ga0500651_0100405 Ga0500651_0100405_314_1465 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20668

DUF6815

Domain of unknown function (DUF6815)

283

390

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k2m-assembly2.cif.gz_D bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa 0.7207 10 340
5k2m-assembly1.cif.gz_A bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa 0.7184 10 340
5k2m-assembly2.cif.gz_D bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa 0.7136 10 340
5k2m-assembly1.cif.gz_A bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa 0.7114 10 340
1uc9-assembly1.cif.gz_A crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 0.6917 11 337
ID Description Score Start End Superfamily
af_O88935_218_393_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6924 125 319 3.30.470.20
af_P04425_124_309_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.6548 116 342 3.30.360.10
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6531 10 99 3.40.50.2300
3q2oA02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.6529 125 210 3.30.1490.20
af_Q75JF9_20_363_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6432 204 315 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A160UDU0-F1-model_v4 deleted 0.9831 51 342
AF-A0A160UDU0-F1-model_v4 deleted 0.9732 51 342
AF-X5XHN2-F1-model_v4 DUF6815 domain-containing protein 0.9498 12 337
AF-Q89QP3-F1-model_v4 Bll3081 protein 0.9479 1 340
AF-A0A086P5X6-F1-model_v4 Uncharacterized protein 0.9439 47 172

Feature Viewer

pLDDT pTM Quality
92.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map