F403089

General Info

Members Datasets Scaffolds Average Seq Length
315 190 630 121

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100360728|Ga0068861_1003607282
Length 133
Sequence VQLTLPAHADHNTFVAVPRISKEDLKAQLEGGTSPVIIDARLKYPYEHSTMRLPGAIRYTGDHGALPRDREIVVYDSDPNEIASTHIVAELIRLGYRAAALKGGISDWLAANLPTETKAAPKQAAPEPGALKG

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
145 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 34.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100360728 3300005719 Bacteria 1278
2 JGI25406J46586_10050927 3300003203 Bacteria 1389
3 Ga0058863_11661605 3300004799 Bacteria 690
4 Ga0065715_10244759 3300005293 Bacteria 1187
5 Ga0065715_10340695 3300005293 Unclassified 959
6 Ga0065715_10367977 3300005293 Bacteria 925
7 Ga0070676_10167533 3300005328 Viruses 1419
8 Ga0070676_11326997 3300005328 Bacteria 550
9 Ga0070670_100242765 3300005331 Unclassified 1568
10 Ga0070666_10008439 3300005335 Bacteria 6398
11 Ga0070666_10027622 3300005335 Bacteria 3718
12 Ga0070666_10957691 3300005335 Unclassified 634
13 Ga0070680_100198823 3300005336 Unclassified 1690
14 Ga0070680_100266446 3300005336 Bacteria 1450
15 Ga0070680_100275158 3300005336 Bacteria 1426
16 Ga0070660_100011148 3300005339 Bacteria 6377
17 Ga0070689_100103284 3300005340 Bacteria 2259
18 Ga0070689_100694703 3300005340 Bacteria 888
19 Ga0070687_100053687 3300005343 Bacteria 2097
20 Ga0070675_100080191 3300005354 Unclassified 2720
21 Ga0070675_100588879 3300005354 Unclassified 1008
22 Ga0070659_100108352 3300005366 Bacteria 2241
23 Ga0070659_100172224 3300005366 Bacteria 1774
24 Ga0070711_100518099 3300005439 Unclassified 985
25 Ga0070700_100114730 3300005441 Viruses 1796
26 Ga0070694_100032458 3300005444 Bacteria 3429
27 Ga0070708_100813013 3300005445 Unclassified 878
28 Ga0070708_101120558 3300005445 Unclassified 737
29 Ga0070681_10039809 3300005458 Bacteria 4712
30 Ga0070681_10294842 3300005458 Unclassified 1532
31 Ga0070681_10546322 3300005458 Bacteria 1072
32 Ga0070706_100627355 3300005467 Bacteria 998
33 Ga0070707_100187900 3300005468 Unclassified 2014
34 Ga0070707_100246944 3300005468 Unclassified 1737
35 Ga0070698_101327224 3300005471 Unclassified 670
36 Ga0070699_100003809 3300005518 Bacteria 13333
37 Ga0070679_100754792 3300005530 Bacteria 916
38 Ga0070697_100028901 3300005536 Unclassified 4443
39 Ga0070697_100511954 3300005536 Unclassified 1050
40 Ga0070686_100000649 3300005544 Bacteria 20369
41 Ga0070686_101382854 3300005544 Unclassified 590
42 Ga0070695_100003623 3300005545 Bacteria 9011
43 Ga0070695_100176946 3300005545 Bacteria 1509
44 Ga0070696_100284875 3300005546 Bacteria 1261
45 Ga0070696_100946065 3300005546 Bacteria 717
46 Ga0070696_102025850 3300005546 Unclassified 500
47 Ga0070693_100515899 3300005547 Bacteria 850
48 Ga0070704_100096697 3300005549 Bacteria 2214
49 Ga0068855_100120982 3300005563 Bacteria 2996
50 Ga0068854_100006356 3300005578 Bacteria 7514
51 Ga0068854_100295009 3300005578 Bacteria 1310
52 Ga0068856_100450395 3300005614 Bacteria 1308
53 Ga0068852_102551930 3300005616 Bacteria 531
54 Ga0068859_100039121 3300005617 Unclassified 4757
55 Ga0068861_100053232 3300005719 Unclassified 3078
56 Ga0068858_100141469 3300005842 Unclassified 2259
57 Ga0068858_100212874 3300005842 Bacteria 1829
58 Ga0068860_100304877 3300005843 Bacteria 1561
59 Ga0068860_100703808 3300005843 Unclassified 1020
60 Ga0068862_101274408 3300005844 Unclassified 735
61 Ga0068862_102622734 3300005844 Unclassified 516
62 Ga0081455_10093596 3300005937 Unclassified 2429
63 Ga0081538_10193862 3300005981 Bacteria 847
64 Ga0081539_10011658 3300005985 Bacteria 6913
65 Ga0070715_10373844 3300006163 Unclassified 785
66 Ga0070715_10933336 3300006163 Unclassified 536
67 Ga0097621_100318489 3300006237 Bacteria 1377
68 Ga0068871_100829312 3300006358 Unclassified 854
69 Ga0075428_100083455 3300006844 Bacteria 3486
70 Ga0075431_101455254 3300006847 Bacteria 644
71 Ga0075433_10058559 3300006852 Bacteria 3369
72 Ga0075433_10241996 3300006852 Bacteria 1602
73 Ga0075433_10281063 3300006852 Bacteria 1474
74 Ga0075433_10323071 3300006852 Bacteria 1365
75 Ga0075434_100008290 3300006871 Bacteria 9652
76 Ga0075434_100146276 3300006871 Bacteria 2384
77 Ga0075434_100280705 3300006871 Bacteria 1685
78 Ga0075434_100386920 3300006871 Bacteria 1420
79 Ga0075434_100666698 3300006871 Unclassified 1058
80 Ga0075434_101074520 3300006871 Bacteria 818
81 Ga0075429_100386892 3300006880 Unclassified 1225
82 Ga0075436_100033430 3300006914 Bacteria 3545
83 Ga0075436_100072623 3300006914 Bacteria 2381
84 Ga0075436_100656788 3300006914 Unclassified 775
85 Ga0075436_100883453 3300006914 Unclassified 668
86 Ga0097620_100039120 3300006931 Unclassified 4757
87 Ga0097620_100207273 3300006931 Unclassified 2046
88 Ga0075435_100001486 3300007076 Bacteria 15064
89 Ga0075435_100020074 3300007076 Bacteria 5110
90 Ga0075435_100085726 3300007076 Bacteria 2593
91 Ga0075435_100462848 3300007076 Bacteria 1094
92 Ga0075435_100899023 3300007076 Unclassified 772
93 Ga0075435_101010593 3300007076 Unclassified 726
94 Ga0075435_101417114 3300007076 Bacteria 609
95 Ga0105240_10220585 3300009093 Bacteria 2209
96 Ga0105240_10442860 3300009093 Unclassified 1455
97 Ga0105240_10553173 3300009093 Bacteria 1273
98 Ga0105240_11925764 3300009093 Unclassified 615
99 Ga0105240_12543985 3300009093 Unclassified 529
100 Ga0111539_10002176 3300009094 Bacteria 26185
101 Ga0111539_10218028 3300009094 Bacteria 2222
102 Ga0111539_12618093 3300009094 Unclassified 585
103 Ga0105245_11359697 3300009098 Unclassified 760
104 Ga0114129_10005483 3300009147 Bacteria 17932
105 Ga0114129_10016834 3300009147 Bacteria 10409
106 Ga0114129_10058608 3300009147 Bacteria 5386
107 Ga0114129_10183860 3300009147 Bacteria 2842
108 Ga0114129_10195088 3300009147 Bacteria 2746
109 Ga0114129_10754959 3300009147 Bacteria 1245
110 Ga0114129_11004364 3300009147 Bacteria 1050
111 Ga0114129_12523292 3300009147 Unclassified 614
112 Ga0105243_10755485 3300009148 Unclassified 954
113 Ga0105241_10377030 3300009174 Bacteria 1238
114 Ga0105242_10243980 3300009176 Bacteria 1616
115 Ga0105242_10597806 3300009176 Unclassified 1065
116 Ga0105242_11631367 3300009176 Unclassified 679
117 Ga0105248_10085674 3300009177 Unclassified 3545
118 Ga0105248_10648863 3300009177 Bacteria 1191
119 Ga0105238_10607382 3300009551 Bacteria 1102
120 Ga0105238_10717592 3300009551 Bacteria 1012
121 Ga0105249_10135914 3300009553 Bacteria 2352
122 Ga0105249_10684935 3300009553 Bacteria 1084
123 Ga0105249_11259585 3300009553 Unclassified 811
124 Ga0105239_10572267 3300010375 Unclassified 1287
125 Ga0105246_10760296 3300011119 Bacteria 856
126 Ga0105246_11811173 3300011119 Bacteria 584
127 Ga0157375_10202809 3300013308 Unclassified 2139
128 Ga0157375_10802744 3300013308 Viruses 1090
129 Ga0157375_11138101 3300013308 Unclassified 914
130 Ga0163163_10167340 3300014325 Bacteria 2245
131 Ga0157380_10153167 3300014326 Bacteria 1995
132 Ga0157380_10305675 3300014326 Unclassified 1467
133 Ga0157380_10646719 3300014326 Bacteria 1054
134 Ga0157380_11118840 3300014326 Bacteria 827
135 Ga0157380_11277867 3300014326 Bacteria 780
136 Ga0157379_10714674 3300014968 Unclassified 941
137 Ga0157376_10138470 3300014969 Bacteria 2181
138 Ga0182007_10090618 3300015262 Unclassified 1007
139 Ga0182005_1048614 3300015265 Bacteria 1152
140 Ga0206356_10262338 3300020070 Bacteria 703
141 Ga0206356_11809609 3300020070 Bacteria 791
142 Ga0207680_10020777 3300025903 Bacteria 3542
143 Ga0207680_11108179 3300025903 Unclassified 566
144 Ga0207699_10179950 3300025906 Unclassified 1420
145 Ga0207645_10436859 3300025907 Bacteria 883
146 Ga0207684_10604318 3300025910 Unclassified 937
147 Ga0207654_10124947 3300025911 Bacteria 1621
148 Ga0207707_10311606 3300025912 Unclassified 1360
149 Ga0207707_10500793 3300025912 Unclassified 1036
150 Ga0207695_10382453 3300025913 Unclassified 1293
151 Ga0207660_10189782 3300025917 Bacteria 1599
152 Ga0207660_10413839 3300025917 Bacteria 1087
153 Ga0207660_10892510 3300025917 Unclassified 725
154 Ga0207662_10488088 3300025918 Bacteria 847
155 Ga0207657_10024028 3300025919 Bacteria 5659
156 Ga0207652_10184782 3300025921 Bacteria 1874
157 Ga0207646_10158525 3300025922 Unclassified 2042
158 Ga0207681_10258163 3300025923 Viruses 1363
159 Ga0207681_10941906 3300025923 Bacteria 724
160 Ga0207650_10147205 3300025925 Unclassified 1856
161 Ga0207687_10892676 3300025927 Unclassified 760
162 Ga0207644_10955215 3300025931 Bacteria 719
163 Ga0207690_10106484 3300025932 Bacteria 2012
164 Ga0207690_10192365 3300025932 Bacteria 1544
165 Ga0207706_10246803 3300025933 Bacteria 1560
166 Ga0207686_10272812 3300025934 Bacteria 1245
167 Ga0207709_11141365 3300025935 Bacteria 641
168 Ga0207665_10654884 3300025939 Unclassified 823
169 Ga0207711_11349635 3300025941 Unclassified 655
170 Ga0207711_11640988 3300025941 Unclassified 586
171 Ga0207679_11071757 3300025945 Unclassified 739
172 Ga0207667_10577358 3300025949 Bacteria 1135
173 Ga0207651_10015148 3300025960 Unclassified 4472
174 Ga0207651_10281007 3300025960 Bacteria 1376
175 Ga0207712_11516226 3300025961 Unclassified 600
176 Ga0207668_10742448 3300025972 Viruses 865
177 Ga0207640_10009249 3300025981 Bacteria 5512
178 Ga0207640_10125847 3300025981 Bacteria 1845
179 Ga0207640_10186573 3300025981 Unclassified 1560
180 Ga0207658_11305338 3300025986 Unclassified 664
181 Ga0207703_10277143 3300026035 Bacteria 1522
182 Ga0207703_11268244 3300026035 Bacteria 709
183 Ga0207678_11782230 3300026067 Unclassified 539
184 Ga0207702_10279445 3300026078 Bacteria 1578
185 Ga0207675_100068019 3300026118 Unclassified 3330
186 Ga0207675_100445187 3300026118 Unclassified 1283
187 Ga0207675_102376007 3300026118 Unclassified 543
188 Ga0207428_10011735 3300027907 Bacteria 7727
189 Ga0268265_10454911 3300028380 Viruses 1196
190 Ga0268264_10182406 3300028381 Bacteria 1907
191 Ga0268264_12355250 3300028381 Unclassified 539
192 Ga0265314_10409909 3300031711 Unclassified 731
193 Ga0307405_10038450 3300031731 Bacteria 2885
194 Ga0307405_10093242 3300031731 Bacteria 2000
195 Ga0307413_10027308 3300031824 Bacteria 3161
196 Ga0307406_10024249 3300031901 Bacteria 3621
197 Ga0307407_10020008 3300031903 Unclassified 3419
198 Ga0307407_10080910 3300031903 Bacteria 1964
199 Ga0307412_10062465 3300031911 Bacteria 2508
200 Ga0307409_100029242 3300031995 Unclassified 3940
201 Ga0307409_100101807 3300031995 Bacteria 2384
202 Ga0307416_100040976 3300032002 Bacteria 3603
203 Ga0307416_100294251 3300032002 Bacteria 1609
204 Ga0307416_100474129 3300032002 Unclassified 1310
205 Ga0307414_10010975 3300032004 Bacteria 5292
206 Ga0307414_10197533 3300032004 Bacteria 1633
207 Ga0307411_10020966 3300032005 Bacteria 3813
208 Ga0307411_11220355 3300032005 Bacteria 682
209 Ga0307415_100096151 3300032126 Bacteria 2158
210 Ga0373930_0002282 3300034816 Unclassified 2959
211 Ga0373948_0002932 3300034817 Bacteria 2574
212 Ga0373950_0000409 3300034818 Bacteria 5240
213 Ga0373958_0020342 3300034819 Bacteria 1221
214 Ga0373959_0001972 3300034820 Bacteria 3267
215 Ga0373938_0007971 3300034957 Bacteria 1880
216 Ga0373928_0003354 3300035084 Bacteria 3056
217 Ga0373929_0001309 3300035085 Bacteria 4797
218 Ga0373940_0000192 3300035088 Bacteria 8373
219 Ga0373944_0121052 3300035089 Bacteria 902
220 Ga0373949_0004303 3300035090 Unclassified 3273
221 Ga0373951_0000583 3300035091 Bacteria 10066
222 Ga0373952_0021368 3300035092 Bacteria 1365
223 Ga0373932_0006188 3300035112 Bacteria 2826
224 Ga0373939_0000976 3300035114 Bacteria 7097
225 Ga0373939_0160834 3300035114 Bacteria 824
226 Ga0373941_0035565 3300035115 Bacteria 1509
227 Ga0373960_0003834 3300035121 Unclassified 3418
228 Ga0373942_0000122 3300035207 Bacteria 18181
229 Ga0373961_0005663 3300035241 Bacteria 2999
230 Ga0373962_0001519 3300035242 Bacteria 5486
231 Ga0373924_0281918 3300035410 Unclassified 737
232 Ga0373931_0011934 3300035691 Unclassified 4203
233 Ga0373935_0541550 3300035692 Bacteria 848
234 Ga0373937_0707436 3300036401 Bacteria 954
235 Ga0395898_0708089 3300037466 Bacteria 949
236 Ga0439433_0126622 3300041999 Unclassified 647
237 Ga0450916_001397 3300042530 Bacteria 2406
238 Ga0466963_0098657 3300044694 Bacteria 1997
239 Ga0466963_0171466 3300044694 Bacteria 1513
240 Ga0451576_0008076 3300045051 Bacteria 12410
241 Ga0451576_0163905 3300045051 Bacteria 2320
242 Ga0451576_0847443 3300045051 Unclassified 959
243 Ga0466967_0893468 3300045976 Bacteria 883
244 Ga0495639_0172944 3300046475 Bacteria 1049
245 Ga0495642_0161133 3300046528 Unclassified 973
246 Ga0495652_0443682 3300046529 Bacteria 910
247 Ga0495659_0109599 3300046664 Bacteria 1077
248 Ga0495647_0034594 3300046681 Unclassified 1893
249 Ga0495658_0238598 3300046683 Bacteria 1141
250 Ga0495669_0072943 3300046684 Bacteria 1567
251 Ga0495669_0441866 3300046684 Unclassified 631
252 Ga0495649_0332003 3300046694 Bacteria 770
253 Ga0496106_0083397 3300048909 Bacteria 2458
254 Ga0496107_0275547 3300048910 Unclassified 1252
255 Ga0496109_0229509 3300048912 Bacteria 1746
256 Ga0496110_0522228 3300048913 Unclassified 1080
257 Ga0496112_0171034 3300048915 Bacteria 2138
258 Ga0501299_174250 3300049522 Unclassified 558
259 Ga0501038_0843392 3300049574 Unclassified 679
260 Ga0501039_0833585 3300049575 Bacteria 719
261 Ga0501041_0335943 3300049577 Unclassified 954
262 Ga0501048_0823706 3300049582 Bacteria 667
263 Ga0501069_0526609 3300049585 Bacteria 706
264 Ga0501071_0835620 3300049587 Unclassified 710
265 Ga0501072_0867737 3300049588 Bacteria 705
266 Ga0501074_0784262 3300049590 Unclassified 672
267 Ga0501074_0844105 3300049590 Unclassified 645
268 Ga0501075_0447170 3300049591 Unclassified 985
269 Ga0501076_0070593 3300049592 Bacteria 2793
270 Ga0501079_0758117 3300049741 Unclassified 764
271 Ga0501079_1204812 3300049741 Bacteria 596
272 Ga0501081_0952452 3300049743 Bacteria 648
273 Ga0501083_0832480 3300049744 Bacteria 601
274 nmdc:mga05p37_144308_c1 3300050507 Bacteria 2916
275 nmdc:mga05p37_222978_c1 3300050507 Bacteria 2274
276 nmdc:mga05p37_292542_c1 3300050507 Bacteria 1938
277 nmdc:mga05p37_3473_c1 3300050507 Bacteria 18413
278 nmdc:mga05p37_607086_c1 3300050507 Bacteria 1234
279 nmdc:mga05p37_620948_c1 3300050507 Unclassified 1216
280 nmdc:mga05p37_6573_c1 3300050507 Bacteria 13704
281 nmdc:mga06r32_886832_c1 3300050510 Bacteria 849
282 nmdc:mga08y16_235807_c1 3300050511 Bacteria 1892
283 nmdc:mga08y16_5181_c1 3300050511 Bacteria 13615
284 nmdc:mga0n895_259607_c1 3300050512 Bacteria 1763
285 nmdc:mga0n895_26022_c1 3300050512 Bacteria 5535
286 nmdc:mga0n895_600393_c1 3300050512 Unclassified 1103
287 nmdc:mga0rr50_1073674_c1 3300050513 Unclassified 685
288 nmdc:mga0rr50_3877_c1 3300050513 Bacteria 8700
289 nmdc:mga0rr50_44239_c1 3300050513 Bacteria 3265
290 nmdc:mga0rr50_4452_c1 3300050513 Bacteria 8246
291 nmdc:mga0rr50_65966_c1 3300050513 Bacteria 2744
292 nmdc:mga0rr50_715960_c1 3300050513 Bacteria 854
293 nmdc:mga08x19_1038166_c1 3300050514 Unclassified 582
294 nmdc:mga08x19_1251515_c1 3300050514 Unclassified 526
295 nmdc:mga08x19_31619_c1 3300050514 Bacteria 3331
296 nmdc:mga08x19_47606_c1 3300050514 Bacteria 2745
297 nmdc:mga08x19_486314_c1 3300050514 Unclassified 871
298 nmdc:mga08x19_56234_c1 3300050514 Bacteria 1800
299 nmdc:mga08x19_844862_c1 3300050514 Unclassified 650
300 nmdc:mga0a205_1394604_c1 3300050515 Unclassified 548
301 nmdc:mga0a205_156348_c1 3300050515 Bacteria 2178
302 Ga0495655_0198682 3300053083 Bacteria 655
303 Ga0495619_0388378 3300053085 Bacteria 964
304 Ga0590071_001681 3300059421 Bacteria 5746
305 Ga0590071_003948 3300059421 Bacteria 3629
306 Ga0590074_006008 3300059423 Bacteria 2013
307 Ga0590074_015315 3300059423 Bacteria 1302
308 Ga0590075_001188 3300059424 Bacteria 6597
309 Ga0590075_001808 3300059424 Bacteria 5223
310 Ga0590077_000356 3300059426 Bacteria 12920
311 Ga0590077_001976 3300059426 Bacteria 4514
312 Ga0590077_004128 3300059426 Bacteria 2991
313 Ga0501082_0120235 3300060353 Bacteria 2277
314 Ga0501082_0521365 3300060353 Bacteria 1039
315 Ga0530510_1199270 3300061734 Unclassified 582
316 Ga0068861_100360728
317 JGI25406J46586_10050927
318 Ga0058863_11661605
319 Ga0065715_10244759
320 Ga0065715_10340695
321 Ga0065715_10367977
322 Ga0070676_10167533
323 Ga0070676_11326997
324 Ga0070670_100242765
325 Ga0070666_10008439
326 Ga0070666_10027622
327 Ga0070666_10957691
328 Ga0070680_100198823
329 Ga0070680_100266446
330 Ga0070680_100275158
331 Ga0070660_100011148
332 Ga0070689_100103284
333 Ga0070689_100694703
334 Ga0070687_100053687
335 Ga0070675_100080191
336 Ga0070675_100588879
337 Ga0070659_100108352
338 Ga0070659_100172224
339 Ga0070711_100518099
340 Ga0070700_100114730
341 Ga0070694_100032458
342 Ga0070708_100813013
343 Ga0070708_101120558
344 Ga0070681_10039809
345 Ga0070681_10294842
346 Ga0070681_10546322
347 Ga0070706_100627355
348 Ga0070707_100187900
349 Ga0070707_100246944
350 Ga0070698_101327224
351 Ga0070699_100003809
352 Ga0070679_100754792
353 Ga0070697_100028901
354 Ga0070697_100511954
355 Ga0070686_100000649
356 Ga0070686_101382854
357 Ga0070695_100003623
358 Ga0070695_100176946
359 Ga0070696_100284875
360 Ga0070696_100946065
361 Ga0070696_102025850
362 Ga0070693_100515899
363 Ga0070704_100096697
364 Ga0068855_100120982
365 Ga0068854_100006356
366 Ga0068854_100295009
367 Ga0068856_100450395
368 Ga0068852_102551930
369 Ga0068859_100039121
370 Ga0068861_100053232
371 Ga0068858_100141469
372 Ga0068858_100212874
373 Ga0068860_100304877
374 Ga0068860_100703808
375 Ga0068862_101274408
376 Ga0068862_102622734
377 Ga0081455_10093596
378 Ga0081538_10193862
379 Ga0081539_10011658
380 Ga0070715_10373844
381 Ga0070715_10933336
382 Ga0097621_100318489
383 Ga0068871_100829312
384 Ga0075428_100083455
385 Ga0075431_101455254
386 Ga0075433_10058559
387 Ga0075433_10241996
388 Ga0075433_10281063
389 Ga0075433_10323071
390 Ga0075434_100008290
391 Ga0075434_100146276
392 Ga0075434_100280705
393 Ga0075434_100386920
394 Ga0075434_100666698
395 Ga0075434_101074520
396 Ga0075429_100386892
397 Ga0075436_100033430
398 Ga0075436_100072623
399 Ga0075436_100656788
400 Ga0075436_100883453
401 Ga0097620_100039120
402 Ga0097620_100207273
403 Ga0075435_100001486
404 Ga0075435_100020074
405 Ga0075435_100085726
406 Ga0075435_100462848
407 Ga0075435_100899023
408 Ga0075435_101010593
409 Ga0075435_101417114
410 Ga0105240_10220585
411 Ga0105240_10442860
412 Ga0105240_10553173
413 Ga0105240_11925764
414 Ga0105240_12543985
415 Ga0111539_10002176
416 Ga0111539_10218028
417 Ga0111539_12618093
418 Ga0105245_11359697
419 Ga0114129_10005483
420 Ga0114129_10016834
421 Ga0114129_10058608
422 Ga0114129_10183860
423 Ga0114129_10195088
424 Ga0114129_10754959
425 Ga0114129_11004364
426 Ga0114129_12523292
427 Ga0105243_10755485
428 Ga0105241_10377030
429 Ga0105242_10243980
430 Ga0105242_10597806
431 Ga0105242_11631367
432 Ga0105248_10085674
433 Ga0105248_10648863
434 Ga0105238_10607382
435 Ga0105238_10717592
436 Ga0105249_10135914
437 Ga0105249_10684935
438 Ga0105249_11259585
439 Ga0105239_10572267
440 Ga0105246_10760296
441 Ga0105246_11811173
442 Ga0157375_10202809
443 Ga0157375_10802744
444 Ga0157375_11138101
445 Ga0163163_10167340
446 Ga0157380_10153167
447 Ga0157380_10305675
448 Ga0157380_10646719
449 Ga0157380_11118840
450 Ga0157380_11277867
451 Ga0157379_10714674
452 Ga0157376_10138470
453 Ga0182007_10090618
454 Ga0182005_1048614
455 Ga0206356_10262338
456 Ga0206356_11809609
457 Ga0207680_10020777
458 Ga0207680_11108179
459 Ga0207699_10179950
460 Ga0207645_10436859
461 Ga0207684_10604318
462 Ga0207654_10124947
463 Ga0207707_10311606
464 Ga0207707_10500793
465 Ga0207695_10382453
466 Ga0207660_10189782
467 Ga0207660_10413839
468 Ga0207660_10892510
469 Ga0207662_10488088
470 Ga0207657_10024028
471 Ga0207652_10184782
472 Ga0207646_10158525
473 Ga0207681_10258163
474 Ga0207681_10941906
475 Ga0207650_10147205
476 Ga0207687_10892676
477 Ga0207644_10955215
478 Ga0207690_10106484
479 Ga0207690_10192365
480 Ga0207706_10246803
481 Ga0207686_10272812
482 Ga0207709_11141365
483 Ga0207665_10654884
484 Ga0207711_11349635
485 Ga0207711_11640988
486 Ga0207679_11071757
487 Ga0207667_10577358
488 Ga0207651_10015148
489 Ga0207651_10281007
490 Ga0207712_11516226
491 Ga0207668_10742448
492 Ga0207640_10009249
493 Ga0207640_10125847
494 Ga0207640_10186573
495 Ga0207658_11305338
496 Ga0207703_10277143
497 Ga0207703_11268244
498 Ga0207678_11782230
499 Ga0207702_10279445
500 Ga0207675_100068019
501 Ga0207675_100445187
502 Ga0207675_102376007
503 Ga0207428_10011735
504 Ga0268265_10454911
505 Ga0268264_10182406
506 Ga0268264_12355250
507 Ga0265314_10409909
508 Ga0307405_10038450
509 Ga0307405_10093242
510 Ga0307413_10027308
511 Ga0307406_10024249
512 Ga0307407_10020008
513 Ga0307407_10080910
514 Ga0307412_10062465
515 Ga0307409_100029242
516 Ga0307409_100101807
517 Ga0307416_100040976
518 Ga0307416_100294251
519 Ga0307416_100474129
520 Ga0307414_10010975
521 Ga0307414_10197533
522 Ga0307411_10020966
523 Ga0307411_11220355
524 Ga0307415_100096151
525 Ga0373930_0002282
526 Ga0373948_0002932
527 Ga0373950_0000409
528 Ga0373958_0020342
529 Ga0373959_0001972
530 Ga0373938_0007971
531 Ga0373928_0003354
532 Ga0373929_0001309
533 Ga0373940_0000192
534 Ga0373944_0121052
535 Ga0373949_0004303
536 Ga0373951_0000583
537 Ga0373952_0021368
538 Ga0373932_0006188
539 Ga0373939_0000976
540 Ga0373939_0160834
541 Ga0373941_0035565
542 Ga0373960_0003834
543 Ga0373942_0000122
544 Ga0373961_0005663
545 Ga0373962_0001519
546 Ga0373924_0281918
547 Ga0373931_0011934
548 Ga0373935_0541550
549 Ga0373937_0707436
550 Ga0395898_0708089
551 Ga0439433_0126622
552 Ga0450916_001397
553 Ga0466963_0098657
554 Ga0466963_0171466
555 Ga0451576_0008076
556 Ga0451576_0163905
557 Ga0451576_0847443
558 Ga0466967_0893468
559 Ga0495639_0172944
560 Ga0495642_0161133
561 Ga0495652_0443682
562 Ga0495659_0109599
563 Ga0495647_0034594
564 Ga0495658_0238598
565 Ga0495669_0072943
566 Ga0495669_0441866
567 Ga0495649_0332003
568 Ga0496106_0083397
569 Ga0496107_0275547
570 Ga0496109_0229509
571 Ga0496110_0522228
572 Ga0496112_0171034
573 Ga0501299_174250
574 Ga0501038_0843392
575 Ga0501039_0833585
576 Ga0501041_0335943
577 Ga0501048_0823706
578 Ga0501069_0526609
579 Ga0501071_0835620
580 Ga0501072_0867737
581 Ga0501074_0784262
582 Ga0501074_0844105
583 Ga0501075_0447170
584 Ga0501076_0070593
585 Ga0501079_0758117
586 Ga0501079_1204812
587 Ga0501081_0952452
588 Ga0501083_0832480
589 nmdc:mga05p37_144308_c1
590 nmdc:mga05p37_222978_c1
591 nmdc:mga05p37_292542_c1
592 nmdc:mga05p37_3473_c1
593 nmdc:mga05p37_607086_c1
594 nmdc:mga05p37_620948_c1
595 nmdc:mga05p37_6573_c1
596 nmdc:mga06r32_886832_c1
597 nmdc:mga08y16_235807_c1
598 nmdc:mga08y16_5181_c1
599 nmdc:mga0n895_259607_c1
600 nmdc:mga0n895_26022_c1
601 nmdc:mga0n895_600393_c1
602 nmdc:mga0rr50_1073674_c1
603 nmdc:mga0rr50_3877_c1
604 nmdc:mga0rr50_44239_c1
605 nmdc:mga0rr50_4452_c1
606 nmdc:mga0rr50_65966_c1
607 nmdc:mga0rr50_715960_c1
608 nmdc:mga08x19_1038166_c1
609 nmdc:mga08x19_1251515_c1
610 nmdc:mga08x19_31619_c1
611 nmdc:mga08x19_47606_c1
612 nmdc:mga08x19_486314_c1
613 nmdc:mga08x19_56234_c1
614 nmdc:mga08x19_844862_c1
615 nmdc:mga0a205_1394604_c1
616 nmdc:mga0a205_156348_c1
617 Ga0495655_0198682
618 Ga0495619_0388378
619 Ga0590071_001681
620 Ga0590071_003948
621 Ga0590074_006008
622 Ga0590074_015315
623 Ga0590075_001188
624 Ga0590075_001808
625 Ga0590077_000356
626 Ga0590077_001976
627 Ga0590077_004128
628 Ga0501082_0120235
629 Ga0501082_0521365
630 Ga0530510_1199270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

21

111

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c07-assembly1.cif.gz_A oxoacyl-acp reductase of plasmodium falciparum 0.8498 57 88
3fnj-assembly2.cif.gz_E crystal structure of the full-length lp_1913 protein from lactobacillus plantarum, northeast structural genomics consortium target lpr140 0.8267 5 103
3iwh-assembly1.cif.gz_A crystal structure of rhodanese-like domain protein from staphylococcus aureus 0.8212 3 94
3o3w-assembly2.cif.gz_D crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.8158 4 98
3nhv-assembly1.cif.gz_C crystal structure of bh2092 protein from bacillus halodurans, northeast structural genomics consortium target bhr228f 0.8152 4 103
ID Description Score Start End Superfamily
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 57 88 3.40.50.720
2c07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8498 57 88 3.40.50.720
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8074 4 103 3.40.250.10
af_G5EEV0_138_283_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8016 4 107 3.40.250.10
af_Q54E40_34_193_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.7959 6 103 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A4Q6A7L1-F1-model_v4 deleted 0.9596 51 102
AF-A0A158F9C6-F1-model_v4 Membrane-associated protein 0.9116 4 103 GO:0005886
AF-A0A2V8F8T6-F1-model_v4 Rhodanese domain-containing protein 0.9077 1 91
AF-A0A537B304-F1-model_v4 Sulfurtransferase 0.8919 2 103 GO:0004792
GO:0005737
GO:0005886
AF-A0A0K2G7F1-F1-model_v4 Rhodanese domain-containing protein 0.8903 3 103 GO:0016020

Map