F403040

General Info

Members Datasets Scaffolds Average Seq Length
315 156 630 153

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100000227|Ga0070700_10000022724
Length 176
Sequence MNKLVKLLIVKSILDTILVATIALVVYMNAFPPTFHGWGEAVVQEKRIAGWAVNDADPWGRVEVQLFIDGKLAGTQVAQLSRPDVVASGWSRDEWHGYSFPLPDLKGVHEARVYAVHASGNGSRYTLQMLGDPIKFEILEDGTWKTFHAKAQSQAAKAQRRVNLLCVFAVSLCAFA

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
136 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
137 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
138 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
139 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
140 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
141 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
142 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 35.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100000227 3300005441 Bacteria 31044
2 MRS1b_contig_8300949 2162886011 Unclassified 1160
3 MBSR1b_contig_11683603 2162886012 Unclassified 814
4 JGI24751J29686_10001553 3300002459 Unclassified 4748
5 JGI24751J29686_10002303 3300002459 Unclassified 3867
6 Ga0065714_10064448 3300005288 Bacteria 81247
7 Ga0065704_10007900 3300005289 Unclassified 2826
8 Ga0065704_10023424 3300005289 Bacteria 941
9 Ga0065712_10000125 3300005290 Bacteria 81248
10 Ga0065715_10090097 3300005293 Bacteria 7653
11 Ga0065715_10091924 3300005293 Bacteria 5441
12 Ga0065715_11075007 3300005293 Unclassified 526
13 Ga0065707_10000983 3300005295 Bacteria 12505
14 Ga0065707_10280727 3300005295 Unclassified 1048
15 Ga0070690_100080104 3300005330 Bacteria 2136
16 Ga0070690_100712880 3300005330 Unclassified 771
17 Ga0070670_100000098 3300005331 Bacteria 80608
18 Ga0070670_100350018 3300005331 Unclassified 1298
19 Ga0070670_100359210 3300005331 Unclassified 1281
20 Ga0070680_100000085 3300005336 Bacteria 51915
21 Ga0070680_100381383 3300005336 Unclassified 1200
22 Ga0070682_100009737 3300005337 Bacteria 5441
23 Ga0070689_100000888 3300005340 Bacteria 18656
24 Ga0070691_10336498 3300005341 Unclassified 834
25 Ga0070687_100176597 3300005343 Unclassified 1276
26 Ga0070687_100615339 3300005343 Unclassified 748
27 Ga0070692_10075141 3300005345 Bacteria 1809
28 Ga0070692_10106066 3300005345 Bacteria 1547
29 Ga0070692_10220576 3300005345 Bacteria 1121
30 Ga0070673_100041401 3300005364 Bacteria 3543
31 Ga0070673_100883356 3300005364 Unclassified 828
32 Ga0070673_100963928 3300005364 Unclassified 793
33 Ga0070667_100661542 3300005367 Unclassified 965
34 Ga0070703_10128034 3300005406 Unclassified 929
35 Ga0070701_10051235 3300005438 Bacteria 2141
36 Ga0070705_100010863 3300005440 Bacteria 4572
37 Ga0070705_100123549 3300005440 Bacteria 1675
38 Ga0070705_100299263 3300005440 Bacteria 1152
39 Ga0070700_100223701 3300005441 Unclassified 1335
40 Ga0070700_100340747 3300005441 Bacteria 1108
41 Ga0070700_100714986 3300005441 Bacteria 798
42 Ga0070694_100205486 3300005444 Bacteria 1470
43 Ga0070694_100316688 3300005444 Bacteria 1200
44 Ga0070681_10000189 3300005458 Bacteria 47802
45 Ga0070681_10020660 3300005458 Bacteria 6597
46 Ga0068867_100161239 3300005459 Bacteria 1768
47 Ga0068867_100314065 3300005459 Bacteria 1296
48 Ga0070698_100032286 3300005471 Bacteria 5424
49 Ga0070699_100047091 3300005518 Unclassified 3731
50 Ga0070699_100333884 3300005518 Bacteria 1364
51 Ga0070699_100548408 3300005518 Bacteria 1052
52 Ga0070679_100000291 3300005530 Bacteria 42609
53 Ga0070679_100333229 3300005530 Bacteria 1466
54 Ga0070697_100047519 3300005536 Bacteria 3479
55 Ga0070697_100704293 3300005536 Unclassified 891
56 Ga0070672_100171805 3300005543 Bacteria 1803
57 Ga0070695_100010744 3300005545 Bacteria 5470
58 Ga0070695_100070853 3300005545 Bacteria 2281
59 Ga0070695_100088676 3300005545 Bacteria 2060
60 Ga0070695_100216731 3300005545 Bacteria 1377
61 Ga0070695_100377765 3300005545 Unclassified 1068
62 Ga0070696_100227588 3300005546 Unclassified 1402
63 Ga0070696_100360227 3300005546 Bacteria 1128
64 Ga0070693_100048099 3300005547 Bacteria 2428
65 Ga0070693_101355398 3300005547 Unclassified 552
66 Ga0070693_101652591 3300005547 Unclassified 504
67 Ga0070704_100040767 3300005549 Bacteria 3199
68 Ga0070664_100559494 3300005564 Bacteria 1058
69 Ga0070664_100579291 3300005564 Unclassified 1040
70 Ga0068857_100090379 3300005577 Bacteria 2740
71 Ga0068857_101610676 3300005577 Unclassified 634
72 Ga0068854_100410879 3300005578 Unclassified 1122
73 Ga0068854_101018039 3300005578 Bacteria 734
74 Ga0070702_100294343 3300005615 Bacteria 1120
75 Ga0068852_100470175 3300005616 Bacteria 1248
76 Ga0068859_100015044 3300005617 Bacteria 7769
77 Ga0068859_100041891 3300005617 Bacteria 4599
78 Ga0068859_100080012 3300005617 Bacteria 3308
79 Ga0068859_100103819 3300005617 Unclassified 2901
80 Ga0068859_100137082 3300005617 Bacteria 2520
81 Ga0068859_100371567 3300005617 Unclassified 1525
82 Ga0068859_100506321 3300005617 Bacteria 1303
83 Ga0068859_101022490 3300005617 Unclassified 908
84 Ga0068864_100045182 3300005618 Bacteria 3778
85 Ga0068864_101777955 3300005618 Unclassified 621
86 Ga0068866_10436013 3300005718 Unclassified 853
87 Ga0068861_100071484 3300005719 Unclassified 2690
88 Ga0068861_100706875 3300005719 Unclassified 937
89 Ga0068851_10000786 3300005834 Bacteria 13677
90 Ga0068870_10445445 3300005840 Unclassified 852
91 Ga0068863_100247020 3300005841 Bacteria 1723
92 Ga0068863_100354639 3300005841 Bacteria 1429
93 Ga0068863_100554266 3300005841 Bacteria 1135
94 Ga0068863_100907470 3300005841 Unclassified 881
95 Ga0068858_100093123 3300005842 Bacteria 2805
96 Ga0068858_100474568 3300005842 Bacteria 1207
97 Ga0068858_101571616 3300005842 Unclassified 649
98 Ga0068860_100065432 3300005843 Bacteria 3452
99 Ga0068860_100155807 3300005843 Unclassified 2201
100 Ga0068860_100186262 3300005843 Unclassified 2007
101 Ga0068860_100249719 3300005843 Bacteria 1727
102 Ga0068860_100377219 3300005843 Bacteria 1399
103 Ga0068860_101375874 3300005843 Unclassified 727
104 Ga0081539_10276690 3300005985 Unclassified 733
105 Ga0097621_100009648 3300006237 Bacteria 7018
106 Ga0097621_100166389 3300006237 Bacteria 1898
107 Ga0068871_100034606 3300006358 Bacteria 4009
108 Ga0068871_101516420 3300006358 Unclassified 633
109 Ga0075428_100113078 3300006844 Bacteria 2957
110 Ga0075430_100301798 3300006846 Unclassified 1325
111 Ga0075431_100045467 3300006847 Unclassified 4526
112 Ga0075433_10089518 3300006852 Bacteria 2720
113 Ga0075433_10146335 3300006852 Bacteria 2100
114 Ga0075433_10408174 3300006852 Bacteria 1198
115 Ga0075433_10494459 3300006852 Bacteria 1077
116 Ga0075433_10661692 3300006852 Bacteria 915
117 Ga0075433_11141482 3300006852 Unclassified 677
118 Ga0075434_100133015 3300006871 Bacteria 2507
119 Ga0075434_100187000 3300006871 Bacteria 2092
120 Ga0075429_100316894 3300006880 Bacteria 1365
121 Ga0068865_100386760 3300006881 Unclassified 1142
122 Ga0097620_100015044 3300006931 Bacteria 7769
123 Ga0097620_100041890 3300006931 Bacteria 4599
124 Ga0097620_100080012 3300006931 Bacteria 3308
125 Ga0097620_100103825 3300006931 Unclassified 2901
126 Ga0097620_100137092 3300006931 Bacteria 2520
127 Ga0097620_100371573 3300006931 Unclassified 1525
128 Ga0097620_100506312 3300006931 Bacteria 1303
129 Ga0097620_101022449 3300006931 Unclassified 908
130 Ga0075435_100830317 3300007076 Unclassified 805
131 Ga0105251_10118834 3300009011 Bacteria 1201
132 Ga0105240_10164605 3300009093 Bacteria 2631
133 Ga0111539_10136802 3300009094 Bacteria 2869
134 Ga0105245_10703630 3300009098 Bacteria 1044
135 Ga0105245_11349049 3300009098 Bacteria 763
136 Ga0105247_10002624 3300009101 Bacteria 12136
137 Ga0105247_11161646 3300009101 Bacteria 612
138 Ga0114129_10010245 3300009147 Bacteria 13373
139 Ga0114129_10101233 3300009147 Bacteria 3986
140 Ga0114129_10291776 3300009147 Bacteria 2176
141 Ga0114129_10392634 3300009147 Bacteria 1830
142 Ga0114129_12682658 3300009147 Unclassified 594
143 Ga0105243_10020636 3300009148 Bacteria 4996
144 Ga0105243_10134489 3300009148 Bacteria 2102
145 Ga0105243_10267214 3300009148 Bacteria 1534
146 Ga0105243_10709028 3300009148 Unclassified 982
147 Ga0105243_11094627 3300009148 Unclassified 805
148 Ga0105243_12089409 3300009148 Bacteria 602
149 Ga0105241_10068179 3300009174 Bacteria 2756
150 Ga0105241_10563057 3300009174 Unclassified 1025
151 Ga0105241_10613988 3300009174 Bacteria 984
152 Ga0105241_10618744 3300009174 Unclassified 980
153 Ga0105241_11386994 3300009174 Unclassified 672
154 Ga0105242_10036935 3300009176 Bacteria 3922
155 Ga0105242_10079638 3300009176 Bacteria 2736
156 Ga0105248_10008264 3300009177 Bacteria 11435
157 Ga0105248_10296485 3300009177 Bacteria 1821
158 Ga0105248_10411122 3300009177 Bacteria 1523
159 Ga0105248_10927126 3300009177 Bacteria 984
160 Ga0105237_10000839 3300009545 Bacteria 42008
161 Ga0105237_10121466 3300009545 Unclassified 2607
162 Ga0105237_10180740 3300009545 Bacteria 2110
163 Ga0105237_10457446 3300009545 Unclassified 1282
164 Ga0105237_10875087 3300009545 Unclassified 905
165 Ga0105238_10035475 3300009551 Bacteria 5070
166 Ga0105238_10174496 3300009551 Bacteria 2126
167 Ga0105249_10017713 3300009553 Bacteria 6326
168 Ga0105249_10306532 3300009553 Bacteria 1595
169 Ga0105249_10881968 3300009553 Bacteria 961
170 Ga0105246_10110312 3300011119 Unclassified 2020
171 Ga0105246_10201821 3300011119 Bacteria 1546
172 Ga0157373_10312028 3300013100 Unclassified 1118
173 Ga0157378_10304692 3300013297 Bacteria 1543
174 Ga0157378_12380210 3300013297 Unclassified 581
175 Ga0157378_12589204 3300013297 Unclassified 560
176 Ga0163162_10324371 3300013306 Unclassified 1672
177 Ga0163162_10721349 3300013306 Unclassified 1118
178 Ga0157372_10065413 3300013307 Bacteria 4082
179 Ga0157372_10624583 3300013307 Unclassified 1255
180 Ga0157375_10013982 3300013308 Bacteria 7156
181 Ga0157375_10107944 3300013308 Bacteria 2878
182 Ga0157375_10848447 3300013308 Bacteria 1060
183 Ga0157375_10926658 3300013308 Bacteria 1014
184 Ga0157375_11830240 3300013308 Unclassified 720
185 Ga0163163_10000669 3300014325 Bacteria 29324
186 Ga0163163_10062934 3300014325 Bacteria 3678
187 Ga0163163_10247308 3300014325 Bacteria 1833
188 Ga0163163_10269565 3300014325 Bacteria 1754
189 Ga0163163_10760034 3300014325 Bacteria 1033
190 Ga0157380_10106273 3300014326 Unclassified 2349
191 Ga0157380_10135151 3300014326 Unclassified 2110
192 Ga0157380_10516419 3300014326 Unclassified 1164
193 Ga0157380_10609985 3300014326 Unclassified 1081
194 Ga0157380_11081435 3300014326 Unclassified 840
195 Ga0157379_10301647 3300014968 Bacteria 1460
196 Ga0207656_10004544 3300025321 Bacteria 4856
197 Ga0207653_10091288 3300025885 Bacteria 1067
198 Ga0207647_10043457 3300025904 Bacteria 2812
199 Ga0207645_10093168 3300025907 Unclassified 1938
200 Ga0207643_10039800 3300025908 Unclassified 2645
201 Ga0207643_10197729 3300025908 Bacteria 1223
202 Ga0207654_10098496 3300025911 Unclassified 1797
203 Ga0207654_10180563 3300025911 Bacteria 1377
204 Ga0207654_10494058 3300025911 Unclassified 863
205 Ga0207654_10659234 3300025911 Bacteria 750
206 Ga0207707_10000218 3300025912 Bacteria 61709
207 Ga0207707_10017679 3300025912 Bacteria 6219
208 Ga0207695_10144397 3300025913 Bacteria 2325
209 Ga0207671_10023421 3300025914 Bacteria 4657
210 Ga0207671_10408914 3300025914 Bacteria 1079
211 Ga0207660_10000580 3300025917 Bacteria 24630
212 Ga0207652_10000066 3300025921 Bacteria 110924
213 Ga0207652_10292801 3300025921 Bacteria 1469
214 Ga0207646_11028086 3300025922 Bacteria 727
215 Ga0207694_10142157 3300025924 Unclassified 1930
216 Ga0207650_10000156 3300025925 Bacteria 81983
217 Ga0207687_11156521 3300025927 Unclassified 665
218 Ga0207709_10035991 3300025935 Bacteria 2931
219 Ga0207709_10052968 3300025935 Unclassified 2495
220 Ga0207709_10911417 3300025935 Bacteria 715
221 Ga0207670_10001499 3300025936 Bacteria 12273
222 Ga0207704_10308270 3300025938 Bacteria 1216
223 Ga0207691_10314575 3300025940 Unclassified 1343
224 Ga0207711_10139162 3300025941 Bacteria 2183
225 Ga0207711_10226968 3300025941 Bacteria 1710
226 Ga0207711_10863091 3300025941 Unclassified 842
227 Ga0207689_10334973 3300025942 Bacteria 1257
228 Ga0207689_10362965 3300025942 Bacteria 1204
229 Ga0207651_10021595 3300025960 Bacteria 3916
230 Ga0207651_10354338 3300025960 Bacteria 1237
231 Ga0207712_10194429 3300025961 Bacteria 1603
232 Ga0207712_10289933 3300025961 Bacteria 1339
233 Ga0207658_11367465 3300025986 Unclassified 648
234 Ga0207703_11244622 3300026035 Unclassified 716
235 Ga0207639_10113982 3300026041 Bacteria 2208
236 Ga0207639_10193625 3300026041 Bacteria 1738
237 Ga0207708_10000031 3300026075 Bacteria 155478
238 Ga0207708_10087887 3300026075 Bacteria 2394
239 Ga0207708_10197940 3300026075 Bacteria 1602
240 Ga0207702_10504136 3300026078 Bacteria 1180
241 Ga0207641_10012657 3300026088 Bacteria 6917
242 Ga0207641_10340703 3300026088 Unclassified 1427
243 Ga0207641_10345390 3300026088 Bacteria 1417
244 Ga0207641_10380437 3300026088 Unclassified 1352
245 Ga0207641_10538600 3300026088 Bacteria 1137
246 Ga0207648_10032323 3300026089 Bacteria 4620
247 Ga0207648_10115391 3300026089 Unclassified 2360
248 Ga0207648_10124381 3300026089 Unclassified 2268
249 Ga0207676_10002306 3300026095 Bacteria 13696
250 Ga0207676_12024019 3300026095 Unclassified 575
251 Ga0207674_10051131 3300026116 Unclassified 4218
252 Ga0207674_10764343 3300026116 Unclassified 933
253 Ga0207674_11264997 3300026116 Unclassified 707
254 Ga0207675_100125359 3300026118 Bacteria 2433
255 Ga0207675_100632448 3300026118 Bacteria 1075
256 Ga0207675_100805832 3300026118 Unclassified 953
257 Ga0207698_10362893 3300026142 Bacteria 1372
258 Ga0207428_10013603 3300027907 Bacteria 7101
259 Ga0207428_10369181 3300027907 Unclassified 1054
260 Ga0268265_11099629 3300028380 Unclassified 789
261 Ga0268264_10020559 3300028381 Bacteria 5393
262 Ga0268264_10206666 3300028381 Bacteria 1800
263 Ga0268264_10346690 3300028381 Bacteria 1412
264 Ga0268264_10648439 3300028381 Bacteria 1045
265 Ga0268264_10811338 3300028381 Bacteria 935
266 Ga0268264_10996979 3300028381 Unclassified 844
267 Ga0268264_11954326 3300028381 Unclassified 596
268 Ga0307408_101750415 3300031548 Unclassified 593
269 Ga0307405_11921610 3300031731 Unclassified 528
270 Ga0307410_10186899 3300031852 Bacteria 1573
271 Ga0307407_10750145 3300031903 Unclassified 739
272 Ga0307409_100536819 3300031995 Bacteria 1146
273 Ga0307414_10243490 3300032004 Bacteria 1490
274 Ga0307411_10116675 3300032005 Bacteria 1922
275 Ga0307415_100075972 3300032126 Bacteria 2380
276 Ga0373939_0093594 3300035114 Bacteria 1020
277 Ga0395898_0436593 3300037466 Bacteria 1247
278 Ga0496102_0023452 3300048905 Bacteria 5482
279 Ga0496104_1078365 3300048907 Bacteria 707
280 Ga0496107_0063413 3300048910 Bacteria 2678
281 Ga0496110_0889490 3300048913 Bacteria 796
282 Ga0496112_0766349 3300048915 Unclassified 891
283 Ga0501298_010959 3300049521 Bacteria 1567
284 Ga0501299_003127 3300049522 Bacteria 2371
285 Ga0501198_068650 3300049649 Unclassified 664
286 Ga0501202_047584 3300049652 Bacteria 943
287 Ga0501209_034108 3300049656 Bacteria 1310
288 Ga0501216_060506 3300049660 Unclassified 763
289 Ga0501217_017763 3300049661 Bacteria 1644
290 Ga0501227_026734 3300049665 Bacteria 1362
291 Ga0501235_064010 3300049669 Unclassified 864
292 Ga0501246_003403 3300049676 Bacteria 1279
293 Ga0501249_005534 3300049679 Bacteria 2582
294 Ga0501249_029809 3300049679 Unclassified 1214
295 Ga0501250_047852 3300049680 Unclassified 648
296 Ga0501225_0016850 3300049705 Bacteria 2031
297 Ga0501212_018311 3300049851 Bacteria 1066
298 nmdc:mga05p37_355666_c1 3300050507 Bacteria 1723
299 nmdc:mga05p37_405474_c1 3300050507 Bacteria 1591
300 nmdc:mga05p37_507308_c1 3300050507 Bacteria 1383
301 nmdc:mga05p37_95676_c1 3300050507 Bacteria 3659
302 nmdc:mga09592_31032_c1 3300050508 Unclassified 4451
303 nmdc:mga09592_637327_c1 3300050508 Bacteria 911
304 nmdc:mga0qj67_53410_c1 3300050509 Unclassified 3199
305 nmdc:mga06r32_73277_c1 3300050510 Unclassified 3317
306 nmdc:mga08y16_1351249_c1 3300050511 Unclassified 677
307 nmdc:mga08y16_211804_c1 3300050511 Bacteria 2007
308 nmdc:mga08y16_2895_c1 3300050511 Bacteria 17644
309 nmdc:mga0n895_182832_c1 3300050512 Bacteria 2128
310 nmdc:mga0n895_70214_c1 3300050512 Bacteria 3471
311 nmdc:mga0rr50_774287_c1 3300050513 Unclassified 819
312 nmdc:mga0rr50_84262_c1 3300050513 Unclassified 2460
313 nmdc:mga0a205_250375_c1 3300050515 Bacteria 1651
314 nmdc:mga0a205_26726_c1 3300050515 Bacteria 5507
315 nmdc:mga0a205_419347_c1 3300050515 Bacteria 1201
316 Ga0070700_100000227
317 MRS1b_contig_8300949
318 MBSR1b_contig_11683603
319 JGI24751J29686_10001553
320 JGI24751J29686_10002303
321 Ga0065714_10064448
322 Ga0065704_10007900
323 Ga0065704_10023424
324 Ga0065712_10000125
325 Ga0065715_10090097
326 Ga0065715_10091924
327 Ga0065715_11075007
328 Ga0065707_10000983
329 Ga0065707_10280727
330 Ga0070690_100080104
331 Ga0070690_100712880
332 Ga0070670_100000098
333 Ga0070670_100350018
334 Ga0070670_100359210
335 Ga0070680_100000085
336 Ga0070680_100381383
337 Ga0070682_100009737
338 Ga0070689_100000888
339 Ga0070691_10336498
340 Ga0070687_100176597
341 Ga0070687_100615339
342 Ga0070692_10075141
343 Ga0070692_10106066
344 Ga0070692_10220576
345 Ga0070673_100041401
346 Ga0070673_100883356
347 Ga0070673_100963928
348 Ga0070667_100661542
349 Ga0070703_10128034
350 Ga0070701_10051235
351 Ga0070705_100010863
352 Ga0070705_100123549
353 Ga0070705_100299263
354 Ga0070700_100223701
355 Ga0070700_100340747
356 Ga0070700_100714986
357 Ga0070694_100205486
358 Ga0070694_100316688
359 Ga0070681_10000189
360 Ga0070681_10020660
361 Ga0068867_100161239
362 Ga0068867_100314065
363 Ga0070698_100032286
364 Ga0070699_100047091
365 Ga0070699_100333884
366 Ga0070699_100548408
367 Ga0070679_100000291
368 Ga0070679_100333229
369 Ga0070697_100047519
370 Ga0070697_100704293
371 Ga0070672_100171805
372 Ga0070695_100010744
373 Ga0070695_100070853
374 Ga0070695_100088676
375 Ga0070695_100216731
376 Ga0070695_100377765
377 Ga0070696_100227588
378 Ga0070696_100360227
379 Ga0070693_100048099
380 Ga0070693_101355398
381 Ga0070693_101652591
382 Ga0070704_100040767
383 Ga0070664_100559494
384 Ga0070664_100579291
385 Ga0068857_100090379
386 Ga0068857_101610676
387 Ga0068854_100410879
388 Ga0068854_101018039
389 Ga0070702_100294343
390 Ga0068852_100470175
391 Ga0068859_100015044
392 Ga0068859_100041891
393 Ga0068859_100080012
394 Ga0068859_100103819
395 Ga0068859_100137082
396 Ga0068859_100371567
397 Ga0068859_100506321
398 Ga0068859_101022490
399 Ga0068864_100045182
400 Ga0068864_101777955
401 Ga0068866_10436013
402 Ga0068861_100071484
403 Ga0068861_100706875
404 Ga0068851_10000786
405 Ga0068870_10445445
406 Ga0068863_100247020
407 Ga0068863_100354639
408 Ga0068863_100554266
409 Ga0068863_100907470
410 Ga0068858_100093123
411 Ga0068858_100474568
412 Ga0068858_101571616
413 Ga0068860_100065432
414 Ga0068860_100155807
415 Ga0068860_100186262
416 Ga0068860_100249719
417 Ga0068860_100377219
418 Ga0068860_101375874
419 Ga0081539_10276690
420 Ga0097621_100009648
421 Ga0097621_100166389
422 Ga0068871_100034606
423 Ga0068871_101516420
424 Ga0075428_100113078
425 Ga0075430_100301798
426 Ga0075431_100045467
427 Ga0075433_10089518
428 Ga0075433_10146335
429 Ga0075433_10408174
430 Ga0075433_10494459
431 Ga0075433_10661692
432 Ga0075433_11141482
433 Ga0075434_100133015
434 Ga0075434_100187000
435 Ga0075429_100316894
436 Ga0068865_100386760
437 Ga0097620_100015044
438 Ga0097620_100041890
439 Ga0097620_100080012
440 Ga0097620_100103825
441 Ga0097620_100137092
442 Ga0097620_100371573
443 Ga0097620_100506312
444 Ga0097620_101022449
445 Ga0075435_100830317
446 Ga0105251_10118834
447 Ga0105240_10164605
448 Ga0111539_10136802
449 Ga0105245_10703630
450 Ga0105245_11349049
451 Ga0105247_10002624
452 Ga0105247_11161646
453 Ga0114129_10010245
454 Ga0114129_10101233
455 Ga0114129_10291776
456 Ga0114129_10392634
457 Ga0114129_12682658
458 Ga0105243_10020636
459 Ga0105243_10134489
460 Ga0105243_10267214
461 Ga0105243_10709028
462 Ga0105243_11094627
463 Ga0105243_12089409
464 Ga0105241_10068179
465 Ga0105241_10563057
466 Ga0105241_10613988
467 Ga0105241_10618744
468 Ga0105241_11386994
469 Ga0105242_10036935
470 Ga0105242_10079638
471 Ga0105248_10008264
472 Ga0105248_10296485
473 Ga0105248_10411122
474 Ga0105248_10927126
475 Ga0105237_10000839
476 Ga0105237_10121466
477 Ga0105237_10180740
478 Ga0105237_10457446
479 Ga0105237_10875087
480 Ga0105238_10035475
481 Ga0105238_10174496
482 Ga0105249_10017713
483 Ga0105249_10306532
484 Ga0105249_10881968
485 Ga0105246_10110312
486 Ga0105246_10201821
487 Ga0157373_10312028
488 Ga0157378_10304692
489 Ga0157378_12380210
490 Ga0157378_12589204
491 Ga0163162_10324371
492 Ga0163162_10721349
493 Ga0157372_10065413
494 Ga0157372_10624583
495 Ga0157375_10013982
496 Ga0157375_10107944
497 Ga0157375_10848447
498 Ga0157375_10926658
499 Ga0157375_11830240
500 Ga0163163_10000669
501 Ga0163163_10062934
502 Ga0163163_10247308
503 Ga0163163_10269565
504 Ga0163163_10760034
505 Ga0157380_10106273
506 Ga0157380_10135151
507 Ga0157380_10516419
508 Ga0157380_10609985
509 Ga0157380_11081435
510 Ga0157379_10301647
511 Ga0207656_10004544
512 Ga0207653_10091288
513 Ga0207647_10043457
514 Ga0207645_10093168
515 Ga0207643_10039800
516 Ga0207643_10197729
517 Ga0207654_10098496
518 Ga0207654_10180563
519 Ga0207654_10494058
520 Ga0207654_10659234
521 Ga0207707_10000218
522 Ga0207707_10017679
523 Ga0207695_10144397
524 Ga0207671_10023421
525 Ga0207671_10408914
526 Ga0207660_10000580
527 Ga0207652_10000066
528 Ga0207652_10292801
529 Ga0207646_11028086
530 Ga0207694_10142157
531 Ga0207650_10000156
532 Ga0207687_11156521
533 Ga0207709_10035991
534 Ga0207709_10052968
535 Ga0207709_10911417
536 Ga0207670_10001499
537 Ga0207704_10308270
538 Ga0207691_10314575
539 Ga0207711_10139162
540 Ga0207711_10226968
541 Ga0207711_10863091
542 Ga0207689_10334973
543 Ga0207689_10362965
544 Ga0207651_10021595
545 Ga0207651_10354338
546 Ga0207712_10194429
547 Ga0207712_10289933
548 Ga0207658_11367465
549 Ga0207703_11244622
550 Ga0207639_10113982
551 Ga0207639_10193625
552 Ga0207708_10000031
553 Ga0207708_10087887
554 Ga0207708_10197940
555 Ga0207702_10504136
556 Ga0207641_10012657
557 Ga0207641_10340703
558 Ga0207641_10345390
559 Ga0207641_10380437
560 Ga0207641_10538600
561 Ga0207648_10032323
562 Ga0207648_10115391
563 Ga0207648_10124381
564 Ga0207676_10002306
565 Ga0207676_12024019
566 Ga0207674_10051131
567 Ga0207674_10764343
568 Ga0207674_11264997
569 Ga0207675_100125359
570 Ga0207675_100632448
571 Ga0207675_100805832
572 Ga0207698_10362893
573 Ga0207428_10013603
574 Ga0207428_10369181
575 Ga0268265_11099629
576 Ga0268264_10020559
577 Ga0268264_10206666
578 Ga0268264_10346690
579 Ga0268264_10648439
580 Ga0268264_10811338
581 Ga0268264_10996979
582 Ga0268264_11954326
583 Ga0307408_101750415
584 Ga0307405_11921610
585 Ga0307410_10186899
586 Ga0307407_10750145
587 Ga0307409_100536819
588 Ga0307414_10243490
589 Ga0307411_10116675
590 Ga0307415_100075972
591 Ga0373939_0093594
592 Ga0395898_0436593
593 Ga0496102_0023452
594 Ga0496104_1078365
595 Ga0496107_0063413
596 Ga0496110_0889490
597 Ga0496112_0766349
598 Ga0501298_010959
599 Ga0501299_003127
600 Ga0501198_068650
601 Ga0501202_047584
602 Ga0501209_034108
603 Ga0501216_060506
604 Ga0501217_017763
605 Ga0501227_026734
606 Ga0501235_064010
607 Ga0501246_003403
608 Ga0501249_005534
609 Ga0501249_029809
610 Ga0501250_047852
611 Ga0501225_0016850
612 Ga0501212_018311
613 nmdc:mga05p37_355666_c1
614 nmdc:mga05p37_405474_c1
615 nmdc:mga05p37_507308_c1
616 nmdc:mga05p37_95676_c1
617 nmdc:mga09592_31032_c1
618 nmdc:mga09592_637327_c1
619 nmdc:mga0qj67_53410_c1
620 nmdc:mga06r32_73277_c1
621 nmdc:mga08y16_1351249_c1
622 nmdc:mga08y16_211804_c1
623 nmdc:mga08y16_2895_c1
624 nmdc:mga0n895_182832_c1
625 nmdc:mga0n895_70214_c1
626 nmdc:mga0rr50_774287_c1
627 nmdc:mga0rr50_84262_c1
628 nmdc:mga0a205_250375_c1
629 nmdc:mga0a205_26726_c1
630 nmdc:mga0a205_419347_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c7u-assembly1.cif.gz_A biofilm associated protein - bsp domain 0.6207 30 142
4u49-assembly1.cif.gz_A crystal structure of pectate lyase pel3 from pectobacterium carotovorum with two monomers in the a.u 0.6034 37 137
4u49-assembly2.cif.gz_B crystal structure of pectate lyase pel3 from pectobacterium carotovorum with two monomers in the a.u 0.5827 37 137
7m1b-assembly1.cif.gz_AAA suse-like protein bt2857 0.574 37 132
5zi5-assembly1.cif.gz_A crystal structure of legionella pneumophila aminopeptidase a 0.5736 34 102
ID Description Score Start End Superfamily
af_P06729_128_206_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6514 32 142 2.60.40.10
af_P06729_128_206_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6384 32 142 2.60.40.10
2z8rB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6279 40 136 2.60.40.10
af_Q58313_132_400_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5848 48 141 2.60.40.10
4u49A01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5793 37 137 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1G2PLB7-F1-model_v4 Bacterial Ig-like domain-containing protein 0.8932 36 137
AF-A0A1M3PLM5-F1-model_v4 Hedgehog/Intein (Hint) domain-containing protein 0.8807 31 103
AF-E1QJ71-F1-model_v4 Uncharacterized protein 0.8781 34 115
AF-A0A6P0NV17-F1-model_v4 Uncharacterized protein 0.8738 33 102
AF-A0A212QGK2-F1-model_v4 ADP-heptose:LPS heptosyltransferase 0.872 37 139 GO:0005829
GO:0008713
GO:0009244

Map